4CG0A

Savinase crystal structures for combined single crystal diffraction and powder diffraction analysis
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords SUBTILISIN SAVINASE
publication title Analysis of an Industrial Production Suspension of Bacillus Lentus Subtilisin Crystals by Powder Diffraction: A Powerful Quality-Control Tool.
pubmed doi rcsb
source organism Bacillus lentus
total genus 99
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4cg0A00
1GA4A 1T1EA 1ZVKA 4HVLA 1R64A 4FONA 1P8JA 1CSEE 1EGQA 1Y3FE 3OSZA 2PMWB 3Q5GA 3T41A 1GTJ1 5AVKA 4WOBA 3DDZX 1C9MA 1WMEA 1IAVA 2P4EA 4KPGA 4H6XA 4HX2A 1PEKE 5CW1A 3DE7X 2V8BA 3AJ8A 2W2OA 3ZXXA 1TO2E 4JP8A 2WUVA 5ARCA 5JXJA 2PYZA 2SNIE 1TM3E 3Q40A 1MEEA 1Q5PA 2QTWB 1Y48E 1YJAA 2TECE 4M1ZA 2B6NA 2SECE 4NMXB 4KG7A 3GCWA 3EE6A 1DBIA 3UNXA 3DW1X 3WQBA 1SUPA 3VYVA 5AVJA 1DUIA 3DVSX 4AKTA 1AU9A 1JEAA 3PRKE 1SBHA 4WOCA 1V6CA 2Z2ZA 1AF4A 3DE2X 1KDVA 1Y3BE 2X8JA 1C9JA 3DWEX 1SIUA 3EDYA 1SVNA 2Z56A 3DVQX 2PWAA 1YU6A 1BFUA 3ZXYA 4KB5A 2W2PA 2ID4A 4AKSA 3DE0X 3F7OA 5JXGA 1T1IA 4DZTA 3F49S 1OYOA 5B1DA 3L1KA 4C3UA 3QMPA 3WIUA 2Z30A 1BE6A 1LW6E 5FFNA 5AQEA 3GT3A 2IY9A 4CG0A 1SPBS 4BWGA 4OV6B 1P7VA 4GI3A 1TECE 4OMDA 3TECE 3LXUX 4OMCA 1SIBE 3VSBA 2Z57A 1YJCA 1GNSA 1Y1KE 3D9QX 3DE3X 5ARDA 2ST1A 2Z2XA 1WMFA 1Y4DE 3LPAA 1TK2A 1TMGE 3P5BA 3DE6X 1SBTA 2SBTA 2W2NA 1WMDA 3CO0S 1AK9A 2PKCA 1VSBA 2HD4A 1AQNA 1WVMA 4Z2AA 2ZWPA 1SCAA 4NE9A 2GKOA 2DP4E 1SUCA 5JMOA 1UBNA 1ZVJA 4ZOQI 3DW3X 4LVOA 5AMXA 3A3PA 1BJRE 3AJ9A 1SN7A 1SBNE 4MZDA 1GT91 1HT3A 3SQOA 3DE1X 1OYVA 2ZRQA 1BH6A 5I9SA 3QFHA 1TM5E 2PRKA 3D43A 1V5IA 3LPCA 4C3VA 3A3OA 4CFYA 3I30X 3TI7A 1AVTA 3PTLA 3TI9A 1TM1E 3AFGA 2PWBA 4LVNA 1KDZA 3VV2A 4CFZA 3DYBA 1C9NA 2W2QA 1SUAA 1Y3CE 3VTAA 3WHIA 1SBCA 1PJ8A 3SICE 5B1EA 2XRMA 2G4VA 3DE4X 1S01A 2Z58A 1BE8A 2XTJA 1Y4AE 3F7MA 1WSDA 2SICE 1TM4E 1GA6A 1AH2A 3I34X 4NE7A 1BFKA 5SICE 3DVRX 1S02A 1SUEA 4H6VA 5FAXA 2PQ2A 2ZWOA 3I2YX 1KDYA 1PTKA 5K7SA 3CNQS 2Z2YA 1MPTA 1NDQA 1R0RE 1GNVA 1GCIA 3BX1A 3LPDA 1PFGA 2WWTA 5JXHA 1T1GA 5JXIA 3EIFA 2DQKA 4DJ5X 2HPZA 1SBIA 1KE1A 3QTLA 2WUWE 3VHQA 1SELA 2IXTA 4J94A 1EA7A 1GTG1 2DUJA 3VV3A 1SUDA 4ZARA 1S2NA 1OT5A 1Y9ZA 1ST3A 2WV7A 1AV7A 1GTL1 1IC6A 1TO1E 1SUBA 5FBZA 1KE2A 4B5LA 1NLUA 4H6WA 3HJRA 2W2MA 3WIVA 1A2QA 5ARBA 3BPSA 2E1PA 1SIOA 3GCXA 1C3LA 1ST2A 2X8JB 3GT4A 1NDUA 3A3NA 1SCJA 1Y33E 1SCNE 4RYDA 1P7WA 3BGOS 1SCBA 1THMA 1CNMA 1SH7A 2ID8A 4DWWA 3H42B 1TM7E 4YN3A 1GA1A 4I0WB 1YJBA 1Y3DE 1XF1A 3DE5X 3I37X 1SCDA 4K8RB 1R6VA 1Y34E
chains in the Genus database with same CATH superfamily
3LAWA 1P5JA 2A7XA 3EHEA 1Z5GA 1XHEA 3SVZA 4TKZA 4BLPA 3DCJA 1MUUA 3OOYA 4EJFA 5LQUA 1Y5RA 4ESHA 4HLUC 1MNAA 3ENQA 3L0ZA 5K0TA 4EW1A 4FONA 1KRHA 2M2IA 4WZAA 5MF6A 3DLAA 3WNVA 4H7DA 2Q1TA 4MNTA 3C3DA 3G68A 2OZEA 2IXDA 4PBTA 7MHTA 3KQOA 1GQ2A 3RFCA 1E1YA 3D3NA 1GPWB 1G6HA 1UBLS 2P2YA 1H1TA 4MWSA 3BD7A 1T5LA 2HNKA 4C08A 2YTZA 4J1TC 2V9PA 3S1AB 4CKEB 2GS9A 2HOQA 4ETNA 4F45A 5B36A 2P90A 4LMRA 2C7PA 4EHIA 1LX6A 4IWYA 5FI1B 1DLIA 4YB8A 3VR5D 4QGBA 3DV0A 1JHZA 1QRSA 1DIAA 3NM4A 1QVVA 4L28A 4G5XA 4YXFA 3UV3A 3ECCA 1ZDMA 2IHZA 3P2IA 4DHWA 2V0NA 3KD3A 1PEAA 1OBHA 4OTZA 4KH0A 3U9TA 4QGSA 2H65A 4ENQA 3EFBA 3WHPA 2AGVA 3HCCA 2COEA 1K6JA 2N0SA 3OWOA 4OJKA 5CDSA 5JRZA 3GIDA 5A9TA 3M4YA 3SYKA 3L93A 3VUFA 4UBMA 1BA2A 3PQ3A 3ZBUA 1BHJA 1LEHA 3X1JA 5KVVA 3GFRA 5FEMA 2JAXA 2ZIGA 1COZA 1Y48E 2Q8PA 4YJFB 1DCFA 1P2BA 4BLRA 2IXBA 3TIGA 3I76A 4YROA 4Z86A 2GSWA 2YXLA 5JS8A 1DRWA 4G3XA 5L3SA 1HEYA 3G8YA 3L6OO 3IKMB 4GDFA 3RIGA 4EG5A 3N0WA 3Q98A 4I1SA 3GCWA 3MJEA 3MRTA 1L7XA 4HMQA 4KO2S 4U8GA 5LYJF 1DBIA 1WUHS 4O0LA 5EIWA 4CVNA 4NPHA 4XFJA 4YS6A 3PQ6A 3DPIA 3E82A 4HGNA 4V0OA 1P8AA 3NDJA 3VYVA 2I3DA 2CVPA 4N0PA 2OY0A 3WLOA 4D8WA 4IJQA 5JSYA 4HAXA 2K2QB 1W5FA 3FB1A 1DUIA 2AFVA 3P9XA 1QIIA 1HQYE 4RA9B 3WWCA 5TIIA 3W77A 1NJ8A 1GPH1 3GUHA 3OIVA 3OU7A 4HH1A 4NBLA 1SZJG 2ROQA 5BV0A 1WR8A 3OJXA 1OI2A 4J91A 4MUEA 1KI4A 2X7JA 4LDPA 4QDXA 5C8YB 4NJMA 4ARCA 1OX4B 4F6RB 2LV8A 1YJ5A 2JHPA 4NCHA 1YAHA 3BRQA 3U48A 4IIBA 5J58A 4EYEA 4K1XA 5FWXB 2EBWA 4LQCA 3RRJA 2RGXA 1CB7A 1TT7A 1VECA 4KN8A 4WFJA 4ZVOA 3SR0A 3NHPA 4DQDA 1G21B 3IJPA 1E1NA 1GSHA 3PFIA 2CHGA 1KK0A 2WP8J 4MARA 4NYJR 4TX1A 1BVYF 3TW0A 2PWAA 2EFYA 1UT6A 2NO9A 2X9NA 3DWGA 3EXHC 3LIIA 5J1TB 1W76A 1FSFA 3RPEA 3QWIA 3WO1A 2C07A 2HWUA 1QONA 2IHYA 4G0XA 4J16A 4MH0R 4Y18A 3VAAA 1TJ3A 2GRAA 3DEZA 3O1JC 3GVXA 4S3MA 4F1JA 6ADHA 1JW9B 4XB6B 3ZIAA 3L0CA 1KSFX 4FFRA 1ZYUA 5E8RA 4ZC1A 5GZ1A 1FSPA 1BDBA 3NTLA 1ZISA 3R40A 3UTDA 1Z88A 3F49S 1TK9A 4I8IA 3VZQA 1M2OA 1UKYA 1XVVA 5BY2A 4C3UA 1ORTA 4KZKA 2J33A 3TGPA 3L0DA 4ZU3A 1LY1A 4ZEMA 1A9XA 3E1SA 4JKYA 1YK0A 2NUAB 3INTA 4IS3A 1AMNA 4LE2A 2R7NA 2J3HA 1VL5A 3JD4A 1OREA 5DYTA 3C70A 1B6RA 1L2TA 3GMSA 5TMPA 3ENKA 4OAQA 3NANA 4GYKA 3WRXA 4CG0A 3E8MA 4NYMQ 2F48A 2KJQA 4PC6A 3DMGA 4RVCA 1WOMA 3UB2A 2PL1A 3K8ZA 2BGIA 3NDRA 4GWLA 3CZMA 3LUHA 1CUJA 1A9PA 1ZA1A 4BU0A 2Q5EA 3GBPA 1T6ZA 1YXMA 2R6R1 3V8EA 4MQMA 2XMQA 4ZZ1A 2GUGA 1TKAA 2GD6A 3BGSA 2GK6A 3GDFA 4GKAA 4W63A 4XDYA 2AK2A 3Q0TA 4K9QA 5F1OA 4IJVA 1RRMA 3WK8A 4CLOA 2GDJA 1K8YB 1F51E 2O8VA 4BV8A 4YJGB 1UBRS 2A4KA 4U1RA 1FFXB 1N2XA 3HKDA 5E7MA 5LXTF 1QK4A 2YY7A 2YRXA 4QTUB 3OE5A 4R7TA 2GT1A 2HQRA 2CBGA 3DVLA 3RVQA 4ZHQF 3SNKA 2C7BA 1ZXXA 3B1FA 3DCYA 3Q8KA 1JLKA 2VO1A 5A3VA 3NV7A 4R8RA 2DUWA 1G5IA 3ZQJA 2ZR7A 3CVVA 2XZTA 2ST1A 4JOSA 4BTEA 1XALA 1OXVA 2ZSHA 4NZ9A 4JU8A 1TQ8A 5CVCA 2XBMA 3T9BA 1YRWA 2AA3A 3LPAA 4NG4A 3PR2B 2O8FB 4JUAA 2V7WA 1QV9A 1BCSB 2WA1A 1GDDA 3AEZA 4JT8A 4DCSA 1RXWA 1O0BA 3PHLA 2VDRB 2JBHA 2AOVA 2WQZA 3EPRA 3AHFA 1ADFA 3H8SA 3KZCA 3FBWA 2ASVA 2PKCA 4YQYA 4C6TA 2ZUBA 4L27A 1UXKA 1U0TA 3FPJA 2H2AA 3K31A 3LYUA 1HYHA 2Y99A 4JJFA 1N0IA 3GGOA 3PNPA 1E3LA 2QMYA 3ABZA 3GJXC 3OI7A 4GSLA 1NIJA 4R2XA 3RWBA 3OAAD 3SS9X 3DYIA 4GOOD 4EHKA 1SCAA 4PFKA 1HDGO 4QECA 2AMVA 2JGJA 4AK9A 3HHPA 3LHSA 3NBXX 1L0BA 3K2IA 3IR7A 3RU3A 3VAYA 2QP3A 4U3JA 5IJ9A 4M4SA 2KB0A 3CUUA 1BKDR 2WVJA 5JEEA 3NHBA 4LNUB 4E08A 3Q3VA 5JMOA 3E35A 3F9CA 2WG2A 3P2KA 1WD5A 2PT6A 3WL3A 4EZBA 2GAAA 4GVXA 4KX5A 3SSNA 4UPEA 3GRZA 5I8PA 1MO6A 1SXQA 2R6HA 4GLBA 3NCTA 1GR1A 1RPTA 3C4JA 1QGUA 1XE3A 2JH3A 2O20A 4EG6A 2FPGA 4TUYB 3W9YA 1JFTA 2Q7DA 1VSQA 1YRLA 2BLLA 2GAOA 2IYWA 2PR7A 5AJHA 3T3DA 3U9LA 4D4GA 4UQPA 4GOMD 4LI0A 1UZUA 4N7JA 4DV4B 2FETA 4C7KA 1LI4A 4ZO8A 1JXAA 3CFYA 4WZBE 4NMMA 1U5AA 3WQHA 1FLDA 1ECGA 3HO6A 3LL4A 4M88A 3U7FB 4RPLA 4XJXA 1XA3A 1O96B 4I6JA 3IEKA 3TINA 5CB8A 1P6UA 5TEVA 3KOOA 4MP3A 4B3MB 4B44A 3W2FA 1HSOA 1UZAA 5B4TA 1F2TA 3HDTA 4GQIA 4GW3A 1IQPA 1OYVA 1PD0A 1SXJA 3FFXA 5H3LA 2R7KA 2R1VB 4RJLA 1DWOA 2XE4A 3E2MA 2B61A 2JI9A 5AW6A 2JHGA 1WXEA 2O8BB 1B93A 1P44A 5I7SA 3L1HA 5BOVA 3WLQA 5HUQA 3REFA 1DIRA 1E2QA 4BQQA 2ZBFA 1VL2A 4MX8A 2G5PA 3ZZ1A 4MK4A 4B6GA 2YJTD 4O2BF 2OVFA 2WC1A 1A2OA 4KIFA 1FMLA 1VB3A 3TJMA 2WWFA 3W5HA 4E51A 3EVNA 3BK1A 1C3XA 3IUPA 4R31A 2F9MA 3BD8A 3V4OA 3PFHA 5BUQA 1KP2A 1MX5A 4H1HA 4O5OA 2WKSA 4E31A 4P3PA 1VKNA 2OA0A 3GCGA 1TM1E 2Z6UA 4S1PA 4XYEA 1FFCA 2VRWA 3LO8A 5CX1B 4ZT2A 1C1DB 2B4AA 4QVIA 1R5JA 1VGRA 5CD1A 1R8QA 3AF3A 5FNVB 3ZNQA 4B9EA 5DWQA 4EZEA 2QN2A 3GN1A 1BMQA 1B26A 2J09A 3IV6A 4UNQA 1KYQA 1EA5A 3Q0EA 4UHEA 1QLJA 3RG8A 3ZCXA 1PHRA 4CMBA 5I7HA 5KOHA 1CU1A 1IULA 3HGQA 3ZIUA 4OFZA 3QELA 5ICFA 4BVHA 2DH5A 1E89A 1T4BA 2AYXA 3TN7A 3V8VA 4BX3A 3RVSA 2ZT6A 3TE7A 3W1WA 5B55A 1H05A 2H85A 4CQMA 2GQ0A 3U4IA 3K1JA 1QV7A 2IIVA 4BO8A 1ZPDA 5B1EA 5BWBA 4N76A 2BH9A 4H4CA 4UM9B 1Y9JA 5ICEA 1P33A 4CEJA 1ECFA 3E3OA 4R2LA 3F97A 3A14A 2VP9A 3MCZA 4MI6A 5ECWA 4IEFB 5K51A 3WL7A 4R3UC 1UIMA 5ENDA 1KH3A 2XTJA 3AEQA 1I5EA 1OSNA 5ESXA 3I6MA 4GZMA 3DAHA 3VC1A 4DVGA 1X42A 2BONA 4PYQA 4OL9A 2RFLA 1DC3A 3R0QA 5FIUA 1DAOA 3RGWS 1KKMA 1OB2A 4B46A 4V0NA 1SBQA 1TVKA 2QN6A 2X0NA 1BOFA 2QUZA 3JQAA 4LBWA 1EVIA 2QD2A 4AMGA 4UATA 2PA3A 4GPTA 1PTJC 1NONA 4M7WA 2QN7A 2BF4A 4Q01A 4WI1A 3EC7A 4MWGA 2O5CA 3Q7TA 3NBQA 5DLEA 1S9HA 5IAAA 2VXBA 4DUPA 3GJ8A 1IE3A 3HBNA 3QVXA 3ET4A 3TAXA 1U4SA 4H6VA 4CL0A 3EEBA 2CHEA 5I7UA 5MDHA 3DGFC 2I78A 4WK4B 1QP7A 4E2WA 5LC1A 5LJLA 4NCAA 4PRYA 4G86A 4JLPA 3OLZA 2EARA 3K30A 1V26A 2BW0A 1GN8A 2W2KA 4XJVA 2GUWA 2XOEA 3BZBA 2B1RA 4UHDA 4ZZ3A 4H1VA 1JT2A 1VMKA 2NQ2C 1A9YA 1ZWKA 4GI5A 5D3MA 5F4ZA 3ZX5A 1TTHA 1YJ8A 5J2TB 5HRAA 1BE0A 5K4GA 1PJCA 3ND8A 1HKUA 3M9LA 4KIWA 2VDQB 2O3TA 4CMEA 2VBGA 4LCEA 3F4LA 5KBYA 2YH2A 3RC1A 3ZLUA 1OLXB 2F6RA 4WN9A 1H0RA 1XQ6A 1EFRD 1GFIA 3HCPA 1XNRB 1MC4A 4PC2A 5A5FA 4HNTA 4BNGA 2H9YA 5KTSA 4Q6BA 4CT0A 4D8YA 4ZQFA 4L74A 1K1EA 5IBCA 3C6YA 2IY7A 2J46A 3GMIA 1CS4C 1CY4A 4H1UA 5K3DA 1BWQA 3BIFA 2IYFA 2VDWB 1NAHA 3G7SA 4NMLA 1GU7A 4WNYA 1Z33A 2P9BA 1P4GA 3EBPA 2R3SA 4BE9A 1WB6A 2FFAA 2OORA 3BQNB 3JQ8A 1KYVA 2CNWD 3KPWA 4FSHA 1YL6A 4O4JB 5FI0B 3DMNA 1MQ8B 2IKSA 3B6EA 1L5NA 2XCIA 3L2OB 4WVFA 2AD5A 2P1DA 3KHUA 3OCCA 2XADA 2BEWB 4HN9A 4P3XA 1UKBA 1K7SN 5ILGA 2WY2D 4E7OA 1IM5A 1T8SA 1P72A 1Y8AA 2QKYA 3AEUA 3GLGB 2UDPA 4ZGWA 2W4QA 3AM1A 3KL4A 1H8ED 2OL4A 1P7PA 5HYVA 4WZAE 2GVZC 1SHZA 2QNIA 2FJ0A 4TSKA 5D8DA 1LB1B 4MS4A 3LWNA 4Y30A 4Z99A 4ZAWA 2V9ZA 4CTKA 4YPFA 3VSEA 5FBVB 3EXG1 1X7ZB 5ITSA 2XR1A 1TEXA 4O4HF 4DR1B 4GVPA 5KO2A 4RQAA 4D02A 5DM70 1XEXA 2JATA 3LHFA 2IS1A 4RK7A 5ILOA 1NHGA 3ET5A 4IVNA 4M9RA 2QORA 1NYQA 2MCFA 3C43A 4OJQA 2IXAA 4HUJA 1XMJA 4PN7A 1IRIA 3LRTA 2FN8A 1OBFO 1R1DA 2VCEA 4DGSA 4LMAA 3IKVA 4MVJF 9GPBA 1T15A 3S7ZA 4HDMB 2BMDA 1CTQA 3KUCA 4WGFA 3VSAA 5ALEA 1Y6FA 4PHCA 3UW3A 3DAOA 3C5VA 3OIFA 4HH4A 4WE3A 4C88A 4ZCTA 1J2UA 1KFBB 1ISHA 2CXPA 4C3ZA 1QPBA 1TCAA 4MIOA 2ANCA 2XNHA 1U2GC 3SVTA 3I5UA 1E9FA 5J4HA 4KJXA 2Z5VA 1HDEA 3FCUB 4N0EA 1WKVA 2WUGA 3Q72A 1TU4A 2PDAA 3ETLA 3N2ZB 3GPCA 5ITZA 1RWOA 2GO1A 2QVZX 3MIIA 1ILEA 3RG2A 3B51X 4MJLA 4PX5A 1FVFA 3SU8A 1E2IA 2BMJA 4UCWA 5A0VA 1YQ9A 2QRGA 4RMJA 3D7MA 1PG2A 2B9EA 1XMPA 4XIIA 4Y9RA 4AUKA 4WLEA 2QDKA 4DV3B 1XLTA 4IS2A 3LE8A 4CLHA 4IVQA 4G0ZA 3ZC3A 3TD6A 2GEJA 3FY4A 4V2UA 5COBA 1M2EA 5DBFA 3NAGA 2RAVA 1L5GB 4GNRA 2NP6A 2VQSA 3KJGA 3FPSA 4RQTA 1DFHA 3G7UA 1NUSA 4OP3A 2WHRA 4B6SA 1V16B 1ZSNA 3NIBA 2J5QA 1SR8A 5CH8A 4RV4A 1JJ7A 4QYWA 4XPIB 3OZTA 2ZJ8A 2AFHE 2WVAA 4UD2A 4UU7A 2NWQA 4I0WB 5D3ZA 4A8JA 5LLTA 1P6XA 1E9RA 2IFTA 4M21A 3DR3A 2YW2A 3ZY4A 5FWYA 1GL3A 3JAWB 4M3NA 1BXKA 1RWWA 2J9GA 2MINB 2ZZMA 1TAQA 3TW4A 3DBRA 4IDCA 4JGGA 3WLHA 3BFVA 4BNKA 1I7LA 3FGNA 2XB6A 4LGVA 3TIVA 2C2OA 1XDWA 3KUXA 4Q6WA 4QQNA 3K70C 2WFZA 4WXHA 5F73A 2B8JA 3R0ZA 1QJCA 4Z9YA 4YUXA 2GYWA 1NSTA 5GGXA 2WTXA 2FWPA 3AESA 5JCOA 4KI7A 3WIBA 3QFTA 2P1RA 3G2NA 3SCZA 2HK8A 2IDKA 3GJ3A 3AUUA 2VIIA 4IZHA 1UFVA 1ZJWA 821PA 3V2GA 3L8HA 4OXNA 3R3HA 2XKJE 3KTAB 3AY6A 3K1AB 3T3MB 4ZGBA 4C7OA 2NU8B 1LS1A 4XA8A 5EE3A 5F76A 3DP9A 1YZFA 3D5EA 4KQGA 5TQ0B 1D1TA 4G8DA 4C7XA 5DNYB 3EPHA 2W00A 2EKZA 1MA3A 1D2EA 4LZPA 1PEKE 1Y8RB 2FB9A 3OECA 4WAUA 1P5HA 3QG1A 4R9UC 4XD2A 2WAXA 3KSDO 4XOIA 1EP2B 4YRPA 3B5EA 4KBYA 1E1LA 4N5NA 3SM9A 1U94A 4RVOA 4ZRNA 1LKZA 1PJAA 4ZTUB 3BFPA 2HA0A 4U7GA 1HPLA 5DYYA 4M1TA 4YO8A 3U31A 2PKQO 2JCGA 2O2DA 5BVHB 4QAJA 5DM0A 2EZ9A 1FNSA 3AL3A 4W7SA 4FFBA 4PY2A 4BNLA 4DJTA 1QR6A 4II7A 4JR0A 5FLYA 4DR7B 3E9NA 4PIVA 3Q40A 4UHFA 1UWVA 2IU6A 2EQBA 3BWEA 2HRBA 2Z98A 3L07A 1NLFA 1TLLA 5PGMA 3MBOA 3W4JA 5EPOA 2WJJA 4CKBB 3ILSA 4URWR 1Z0FA 3KV3O 3CBQA 1Y7TA 1BMFA 4H0CA 4J7XA 2GPTA 4QQKA 2Q4TA 4ZYLA 3D6NB 1P2SA 3AR6A 1JIVA 1P3JA 4IKOA 2RKOA 2VDJA 1NBME 2BP7A 2F7SA 2WFLB 4LZNA 2VLBA 2YC4C 1XNGA 4MA5A 4P84A 2XGMA 4YIKA 5IMBA 4UULA 3ROQA 2AYZA 2OYSA 4V02A 5EZYA 3HMQA 2LIPA 2YXEA 5TRTA 3RW9A 5IUNC 3C6KA 5IUJC 3K05A 1SHLA 3NWPA 3TJZA 2EF1A 1OAKA 5JAZA 2CLSA 5CVDA 4EY7A 3HO1A 1Z36A 3OM9A 4DC0A 3AK4A 5ERXA 4RTPA 3GLUA 5JAQA 3W5SA 2LRHA 4FM9A 1T0UA 4C14A 4RLHA 3EA0A 4NULA 2BLNA 5C3UA 1JG1A 1TKCA 3D5QA 4BGIA 3D0QA 5BSFA 2BZ1A 1OGJA 1XRMA 2E21A 4Q9HA 5AJXA 2FEXA 2ZPTX 3N2LA 1CRWG 3R5JA 3O0DA 5DX1A 3GLIE 3THWA 2OG1A 2XOXA 1FP4B 4OXIA 1C9JA 4MUNA 1MX1A 1T9KA 2YNMC 3IP9A 4MUMA 3O84A 3RV4A 1Q16A 3RCBA 4ZOCA 3WP1B 4RLFA 3GLGE 3GJSA 4B2PA 5THKA 3CJQA 5AKKA 4DG8A 1DINA 4QPDA 2R8YA 2M9MA 1QSGA 2YWBA 3GZNB 4E5SA 2ONJA 2GJ8A 3L0YA 4YP1A 4S1WA 5HJ2A 2R85A 1CY7A 5C31A 2YKGA 1JPUA 1CDZA 1BW9A 3C39A 1SRRA 3PBKA 1DQSA 1LS6A 4IGAA 5KNCD 3PQ5A 2DF8A 3TKAA 3DUFB 3FCCA 3UJHA 5B37A 4PWZA 1WMAA 3QW2A 2DLCX 1F7UA 1WKBA 4KWCA 3K71B 1J09A 2NU9B 1DQZA 1VIYA 2OD9A 4QUJA 3TS1A 1LPOA 2X8BA 2DUUA 1JA0A 2HUNA 3VYTB 5JBNA 1CLUA 1E3QA 4FCVA 4ZI7A 1PNTA 4Y9TA 5AKJA 4B32A 3FFWA 2V7XA 2IIQA 1Q50A 2VJMB 2WU1A 3E1GA 5LZ7A 3ZLVA 4B71A 3V4RA 2VI5A 2NSHA 4CMGA 4GM4A 1XKTA 3FNFA 3WG9A 4KHPB 2GBLA 1SXJE 2QW8A 3SXJA 5JIBA 1I4OA 2HRCA 4LYDA 3RU2A 3T0IA 4ER3A 3QYPA 1K6EA 3ZKWB 4D44A 1QLWA 3MT8A 1KHHA 4FOOA 2H3HA 3LNTA 2HJSA 1W0CA 1DG3A 4TS3A 3H6HA 4KE6A 3O93A 4HD8A 2C4HA 1F0NA 1QV6A 5CHYA 5B3AA 4U2FA 3W2IA 1KSJA 1D5WA 2YVUA 4MOWA 3C98A 4R2HA 5GV7A 3IEMA 2DR2A 2VQ3A 3HEBA 2QMEA 2O8NA 4EYOA 2WVGA 1DRJA 1RM0A 3S8EA 2NXNA 2OCAA 2HSJA 2QDXA 4KAAA 2Z3WA 1IY0A 1G3IA 2ADMA 2OV8A 1J2TA 1KYTA 3TIIA 1K4KA 1UXOA 1M8FA 4TRMA 5KYYA 3QOYA 3OCYA 4DM7A 2IOFA 3HR7A 4INOA 2PWYA 3H19A 1EDDA 2IYZA 5AK3A 2C98A 1WV1A 1E99A 2A8YA 1HZZA 2AOXA 2H6EA 3IV7A 4L0MA 4OKNA 3CVWA 2WJ6A 4A0GA 5CDTA 3A6KA 5D6NA 4Y6LA 3UBTA 5YASA 4GWGA 1UBMS 1W8IA 2EL9A 2X0KA 5IAGA 3RHFA 4TQ9A 5TMBA 2B0JA 3B60A 4GZ5A 5E9JA 1LPSA 4JJEA 5EXDA 1LVGA 2AQKA 3ZV3A 1WTAA 3VKGA 3VPSA 5EGNA 1V96A 4EAAA 3O47A 4ZV9A 2KW5A 2CJPA 5AKZA 1OIXA 3WRVA 1W88B 2O0LA 1FW8A 2Y9PB 3GQVA 3HUDA 4DS3A 3FPGA 1E3EA 3COVA 4QD3A 5HF9A 3BAZA 3D2BA 1LVHA 1GPDG 3TNFA 4ZVUA 1P2FA 1V4VA 4BE7B 2C9OA 3D2CA 2BTQA 1MABB 4FFOA 4QUHA 3G0HA 3BIWA 1GQQA 3A06A 3KTDA 3M34A 1AMOA 1Z3CA 1SQFA 3MG9A 3DZFA 3GFTA 3VPBA 5KHOC 1Z39A 3NYIA 4XQEA 3HDQA 4X91A 4LXHA 2RBKA 3ZD8A 4DADA 1T3SA 2F3SA 2H1HA 2XBUA 3HJAA 4Y1RB 3D0RA 5CJJA 1OWMA 1J0AA 4HDOB 5CPFA 3R24A 2OO7A 3PIIA 2Q5QA 2F1HA 1ESEA 2PGLA 3MLAA 1W34A 3MWDA 1JTVA 4FZVA 2IYTA 4J7AA 5I7AA 5LFAA 1TVMA 1D1SA 1MEOA 3DEFA 4LHXA 2Q3CA 3DG9A 4BUZA 4BXOA 1F2VA 1TVEA 1WBBA 3Q7EA 2HZ7A 4XD7A 2LTAA 1RAIA 3IMEA 3B1JA 5ERYA 1UJ4A 1DX6A 3WQRA 2XB8A 4BLVA 1I4WA 2AWNA 2DJIA 2Q3BA 1GJRA 2X5NA 1TEVA 3FWKA 3I2JA 1RHJA 4PFSA 2XNSA 1Z6PA 3JVEA 4G26A 4X3CA 4LRSB 5FBHA 1U90A 1VB5A 4V0RA 3WDSA 5BNFA 1ID1A 2AF4C 2O52A 3REOA 3KFXA 3E7DA 1Y8ZA 1MOQA 2FR8C 1RCUA 1Y7PA 3R3UA 1KK1A 4GC9A 3OTIA 1JDUA 4JAVC 4L8WB 3TCXB 4PSDA 3CKMA 3W6ZA 1NUHA 5FBKA 1Q92A 1ZBDA 4RPGA 4ZO4A 4NARA 2O1SA 5HDQA 1IZ9A 4QBGB 3STYA 4AS2A 4EO9A 1Y4SA 3H2SA 5JLJA 4X90A 4TT8A 4OHOA 4C03A 2R47A 5ALPA 1R4MA 3RWMB 4CQLB 3UG7A 1UBCA 4KYTA 4S2EA 3COWA 5D1HA 1U8YA 2C7QA 1U0HC 1WZUA 1I2CA 1EBUA 1FX0A 2YRWA 4L73A 3SIWA 2ZAOA 2LKCA 3AFGA 3GGSA 5AD1A 1USWA 1FRVA 3FLAA 3G88A 3EVZA 5EJ2A 3KB6A 2X9QA 3PD1A 4YGYA 1OWPA 3QV2A 1D04A 5ENVA 1NNI1 1JX6A 4A03A 1IDN1 4B6FA 2E0IA 3Q9NA 3VHXB 4CN9A 3LGSA 2QZ9A 3UT5B 3RKSA 3HV2A 3LXRA 1XRNA 3QBJA 3R6GA 4OBWA 3V1KA 4N7BA 4AQYB 5KJ6A 1Q0UA 2JCYA 2XB4A 4P32A 3OF3A 4DMFA 2AOTB 1XZPA 3DLPX 3DHWC 2YZGA 3LGAA 4C2UA 2UYYA 1IZ0A 3OZCA 3WYFA 3SICE 3SXPA 1K7YA 4KDFA 3AKZA 3DC7A 4YX9A 2CXOA 1APBA 1WUKS 4UXJA 3DHNA 3NDIA 2ZJ0A 3DE4X 3T1NA 1TW2A 1PNOA 4N5HX 4MITA 1XO1A 1ZX1A 1KBQA 1HNNA 4XUDA 3R9XA 1SB9A 3G8CA 1B0UA 1I33A 4UVGA 1NLYA 1PX0A 1UAGA 3ZWBA 5GZ6A 1SXHA 5KYTA 3NJ8A 4BB6A 2CLIB 1J5EB 2C42A 3FMPB 1I9GA 3RFTA 3EAFA 2IT1A 2R8PA 3T38A 3U7IA 3JYNA 4HYEA 1AH2A 4D96A 2E6KA 4J0GA 1A72A 2Q6VA 4FIZA 2OEPA 4G5FA 2REQB 3VZDA 4EG3A 4EPVA 2WWYA 3TOCA 2GXSA 1CNFA 4NOMA 2PJZA 4HNRA 4UJ5A 3UKDA 2A9PA 1T2AA 1FYWA 3FCXA 5IUKC 1GRRA 3T7EA 4I4TA 3H7AA 3M5CA 2QJTA 4LXXA 2ZJYA 4QQRA 3LBIA 4P0QB 3EIUA 3RGGA 2P2DA 4ER0A 1J8YF 3MA0A 3G2MA 3G8AA 1OXBB 4GMDA 1Y5IA 3TLEA 3TQRA 1K9SA 4H3KB 1IHUA 2C4UA 4R5MA 2VP2A 5A9SA 5C8DA 2Z2YA 3UMMA 5F7JA 1OFIA 3FI0A 2L69A 4NCXA 1EH5A 3EQ8A 4YLYA 2BDEA 4LOAA 2YHUA 3U3JA 1GNVA 2O9JA 1GCIA 2HA6A 4GXQA 4JA2A 4Y1GA 3RBZA 1Y3AA 3HUEA 4ZVPA 3RTAA 4MMZB 3TNLA 4ZGGA 3CISA 4F8YA 4NBWA 3AF2A 4ROSA 3SC2A 3F78A 2QGFA 3B3GA 4RDIA 1G38A 2C2KA 3ZUPA 1LH0A 3TLGA 4PHTA 5CLJA 1AS2A 5JXIA 2Q2NA 3PUXA 5GONA 2WSLA 3Q85A 4RENA 5C34B 1RRKA 2VDPB 1NVFA 2L19A 3IFSA 3JALB 3KU4A 4JLWA 4CL2A 1UK9A 1KTVA 2GBCA 1NE2A 3HKEA 2V7UA 2D6FA 2OYCA 3MTQA 1E1KA 3OUUA 3AM3A 4OHVA 5CIWA 1NQXA 4RELA 4D9MA 621PA 2XX3A 3FN4A 4MGIR 3TSWA 2OAQ1 3OHPA 5JD6A 2POCA 1U04A 1SBIA 2QT0A 3AJEA 3KXIA 1CJVC 5IVDA 5JY1A 3WLSA 4PSAA 3U7JA 1KE1A 5B4VA 4B1FA 2VQFB 1F60A 4CF7A 1OH6A 2J1LA 1D2AA 1FXWA 3THXA 4LGYA 5E6SB 1KNQA 1Z28A 3VHQA 3MMPA 4QJBA 2RHHA 4RPKA 3UAWA 3JQBA 2G1UA 1D9ZA 5DGHA 4JD5A 1ONBA 3M3HA 1D7AA 3WSWA 2CV1A 1YNSA 1YBFA 2IP1A 1F8UA 5CX4A 1DJOA 1EWTA 2R25B 4X84A 2QF7A 4OQMA 3AM4A 5FJJA 4DTCA 3EDOA 1V71A 4NYIR 4F0JA 1FYXA 2R751 2B2CA 2ZRFA 2R6JA 1IVNA 3HFRA 3KUKA 4MKRA 3WV5A 3ZE1B 1YZGA 4CYMA 1FFHA 4F2HA 1EFTA 4KXVA 1HE8B 2IPAB 3IOBA 3DT8A 4F4HA 1W85B 3BCHA 3B89A 2MDTA 3BEDA 4F1KA 2PZJA 4I1OA 1P1BA 1XL1A 3G13A 3O38A 4FD3A 4Y2YA 2Z83A 2OQIA 3WK4A 1ACLA 1G8AA 1YIOA 5EHQA 4LRQA 1GUAA 5LYJB 3JAMA 2RAUA 1UQTA 2VJOA 2GN1A 5EE0A 4NOJA 5GOTA 5L7YA 1FK8A 1ZK4A 2AFIA 2C4NA 2LZ0A 5EWJB 5C1BA 3BMCB 5BSUA 1IB0A 3ZR4B 2R8XA 1CULC 1NA5A 3VZPA 4EPTA 3CMMA 1SXPA 5LMNB 2BFPA 3WGOA 5KSYA 4JQCA 1ST2A 4KFCA 5H4HA 4LYFA 1YU9A 1JJIA 1Z4LA 4MS3A 2FRVA 3ULKA 3N75A 3USCS 5AW3A 1SMKA 1B23P 3SKVA 2CMHA 3SF8B 9LDBA 5C37A 2I3AA 1XZNA 5JDCA 3UKOA 3NIFB 5IJZA 3HY6A 2PZFA 2VHWA 4KR3A 3BM5A 3MBIA 3TW6A 5CA1A 4DMHA 2G1JA 2PFSA 3ZV4A 1N7GA 1MZVA 1NAIA 4FMCB 4ZANA 3COYA 2IQIA 3BWYA 4RYDA 1Z5UA 1U11A 3VR2A 4C0AC 2X23A 2GO7A 1XVUA 4RA6B 3HB4X 2FR1A 1LLCA 4PGGA 1U6IA 3AF0A 5GADl 2QM8A 2H5JA 2IDZA 4MUHA 3FF4A 3ODPA 3C7CB 4D4IA 2C99A 2ZYHA 2BTOA 3PDHA 4RVFA 3OEHD 4YN3A 5J9FA 4EJ2A 4KPEC 3SOPA 5JJCA 1T5DX 1IAQA 4I2VA 1P7YA 3UWKA 3VR6H 3ZHSA 4BZZA 1Q0TA 1N78A 1SCDA 2FMXA 1RLJA 2Z9DA 3DO5A 4GZLA 5AVTA 4LDAA 4OH7A 1PEYA 1XTRA 2YUIA 3B82A 5KTKA 3AWDA 1NMXA 3GRCA 5J4YA 3DNFA 4N7RA 3RSOA 2ZSBA 4ZOAA 2W2LD 1E1MA 2FWNA 1EUDB 2QRHA 2ZJZA 4DMUB 4DA4A 1JFFB 4E33A 1X7GA 2QMHA 4UUBA 1RRGA 5EE1A 4KITB 4CM8B 1Z17A 1S8AA 1RWBA 3KSMA 1VJ5A 2YJNA 3F0TA 4FJ2A 8GPBA 2XZDA 4DOMA 4D9JA 5IN4A 4KR2A 4G0UA 3G9QA 1P2TA 5GMOA 5C4MA 4BNDA 1EIZA 1Y1QA 4DILA 3OTOB 3EIWA 1LPNA 1X0VA 1XRLA 2ZI9A 4G09A 2OP0A 1OKKD 1L1EA 3O6VA 4MCIA 5SZIA 4CIDA 3I73A 1MN6A 4ZJUA 1U8TA 2I6GA 4BV2A 1C9KA 1R16A 4W5WA 1F4LA 2CKMA 2KS6A 5C18A 1OR8A 1NI4B 4ZZ0A 2YJGA 4QTTB 3R9WA 2PVCA 1D6NA 1PR3A 3OC6A 4CTOA 1DLJA 5LXTB 1LRJA 1W47A 3IQDB 3AXSA 3W6NA 4O0MA 1KC3A 5CGQB 5CW1A 5WRFA 2OXTA 4ZHQB 2GNPA 3TNYA 4RZHA 5A62A 5JSZB 3A4IA 1QIGA 4PNHA 1N33B 3DE7X 5E95A 4UBNA 2R7AA 3QFFA 2A2ZA 2HPVA 4U9UA 3NVKI 2PZEA 4YQZA 3NBUA 2QUJA 2QM3A 2I9PA 4FFPA 1HDOA 1T2NA 1U7TA 3QPBA 1SC1A 2CYCA 2WYIA 4G23A 4G41A 1AN9A 2AUNA 4YA6A 3A6DA 4MAFA 4UAUA 1N3LA 1FUUA 1UJ5A 1Y9EA 4LBVA 2P2GA 4PYKA 5FBLB 4RZ3A 3FNHA 2ATIA 2ZVJA 4YAOA 4PLZA 1EFAA 3MWKA 1A9QA 5EKDA 1E3WA 4PAQA 4DCJA 4WCVA 4UHCA 2XWPA 3GRAA 3RK1A 4M98A 2JIMA 4M1EA 3OMLA 4LHZA 4DARA 1K4MA 4JNKA 2RCYA 4EGSA 4UTPA 1E0JA 1W5BA 5TQJA 1N2EA 1SKQA 1WXXA 3ENZA 3NR2A 4LC1A 5H3HA 3RTEA 5JV5A 1G41A 4JBNA 2FW7A 5ELLA 1TIKA 2Q1SA 1Z13A 2VEDA 5F9HA 5JNTA 1YDHA 2ES4A 4GX5A 1DRUA 1DRKA 1TYZA 2F90A 3IMKA 3NT5A 3IUEA 2GJSA 2DWQA 2BUBA 4LXQA 4MB0A 3AIIA 4TMWA 1N8NA 1PNRA 2HLDA 5K0NA 2JD0A 3F71A 1PJ4A 1R12A 4TL8A 4LQ4A 3KEGA 4EKGA 4D9IA 1OI4A 1GYPA 1I32A 1QG6A 3K72B 4TRNA 4D0RA 3KV1A 2PY6A 4BVJA 4C0XA 1JHOA 2GCEA 2VNIA 3A37A 2J67A 3KO8A 3TZKA 5CBPB 1NNSA 1UJ2A 2DRIA 2VQDA 3NHUA 5HIIA 2CNBA 1ZUNB 1VL6A 3HWWA 4R8KA 1EDOA 4XQ0A 3D3QA 3PUVA 1RI1A 5FTJA 4EG7A 5CEEA 4ABTA 3UMVA 1U3WA 4PYLA 2NLOA 1CY1A 1TA4A 1UK7A 3ZCSA 1E1RD 2IX3A 2H1WA 4EGJA 2IHJA 5F21A 3FXAA 4BKRA 4D9EA 4F2GA 4JUCA 521PA 4Y8VA 1NN0A 3DONA 4AD8A 5FLKA 1GGVA 2ORVA 5CXQA 5AT1A 2XQKA 1JR6A 2HSDA 4LOKA 3PT9A 3TZQA 2OZVA 2IPMA 2HF8A 5TGZA 2HSWA 4MVJH 1ZN9A 2E6UX 1LD3A 1RXEA 3DZHA 3I2KA 3JWGA 3LFTA 1UIRA 3PXBA 4NHEA 2KMLA 3TXAA 2UZIR 4ZI5A 3WMRA 4CG2A 4EY6A 2ODEA 1JHDA 2Y1CA 3F7OA 4RCYA 1RQ7A 4Z0HO 4AURA 1ICEA 5JAUA 4QODA 4CR8A 1T29A 5KYNA 4MGZR 1QF6A 1SEVA 2A9QA 3M1LA 1OYOA 4P3KA 3CLVA 4Y7DA 1ORIA 4O2BB 4INPA 4D4JA 3IQFA 4YUYA 5HIKA 2PPVA 3DO8A 3RIEA 3CVOA 1K86A 3E05A 3FCEA 4L85A 1V4NA 3QFSA 1XRRA 4H7PA 4E13A 3IVCA 1V43A 4ITVA 3IILA 3SC6A 4ENRA 3RVJA 3BKWA 3BBPA 1T2DA 1EVLA 1ADCA 1U0NA 1ZKDA 2NV6A 2PX3A 3EIXA 1A4RA 3GFSA 1T8PA 2Z5FA 3LHIA 4A16A 3VA7A 4LFAB 1E3DA 4R2MA 3MOGA 1KOGA 3BFKA 2VF2A 4TTVA 1J00A 3RVNA 3ND5A 3CGGA 4GI3A 2JS7A 3UGJA 3OIUA 2DCMA 3NOOA 1JSRA 2XODA 3DL0A 1J7KA 3BREA 1LBTA 1AS3A 1CE8A 3D4IA 2IH4A 4LJSA 3Q9LA 2H48A 2V4MA 2O2HA 3GRRA 4G8BA 4MCJA 3PXAA 1XX6A 1U3GA 5CHEA 2OBNA 1PL8A 3OWXA 2KLHA 1H42A 3NFYA 4QBHA 5HJ5A 1WCIA 4P5DA 2QA5A 4R2WA 1Y1KE 1XNJA 1CUGA 2RB5A 1QDEA 3L6DA 1KZGB 1KOJA 1QGDA 1NTOA 3B9QA 5KWEA 5ARDA 4D25A 4IG4A 2JIDA 2EKLA 2IOFK 2JFUA 3NHLA 4K1LA 2VUTA 4CKWB 3IPXA 1WMFA 3ZXSA 5BSWA 4RJJA 4J1TA 1VHJA 1TK2A 1KZ9A 1XAHA 1NGSA 5CVTA 5HM6A 2LBPA 1JG3A 4HTFB 4OQ4A 5IYZF 1OILA 3OP4A 2G9ZA 4JEUA 3JYQA 4WXEA 4AL4A 3ZCUA 3AVVA 4YR9A 2VDLB 3MAGA 2RK3A 1JP7A 1EE9A 2IYXA 3VZRA 1OE0A 2H08A 2FUG1 3ZU3A 5KYUB 4YWHA 1YTUA 5AH0A 4O2AF 3RS7A 3F3SA 2PSFA 5K3EA 2FUNB 5BQXA 1E0AA 2W6ID 2C5LA 2RHGB 2XYRA 4OJTA 3H4MA 3UA3A 1HKHA 1VL1A 2OCPA 3FKSA 1JR2A 1I0IA 4HV4A 2ZWPA 1Z4OA 3RVRA 4QIHA 1HQCA 1I51A 4KMOA 3ROTA 1RKXA 3OA2A 4HY3A 1VLLA 3I53A 4MVJM 3X44A 3ZUGA 1PP4A 2XXAA 4ALJA 3TXYA 5I51A 4LDNA 4GQAA 1X8LA 1YOVB 3DUWA 2JL1A 4AIIA 1S1MA 1SUCA 2NADA 4ZEXA 3P9IA 2ALJA 2C9ZA 3HB0A 5HKAA 3JWPA 1PZNA 3W8EA 5IKEA 3G0CA 4U0JA 1JMVA 4PC1A 4XIJA 1OFVA 5EMMA 4MLZA 1W29A 2KI5A 3CE9A 3ZHVA 4BMZA 2WIJA 1PWHA 2EGGA 4MYCA 5A4MS 2RH8A 2FWMX 5CGZA 5DI3A 1S0UA 2XGSA 3AEKB 2QMZA 1GZVA 3VR3A 3DMHA 5DRYA 2Q45A 2QAGA 3GFOA 3NP9A 1DG1G 1Q21A 1K7CA 2B69A 2ZSEA 2CZQA 1VLQA 1VPEA 2C5SA 2YV4A 2QXTA 4HEJA 1LSOA 1Y98A 4HWTA 1JVSA 1J42A 1EUCB 2A78A 4IJKA 5K2MA 5HQ3A 5E4JA 3KVOA 4X65B 2JHFA 3JRNA 3OPQA 4Y2XA 1ZXBA 2NXEA 3NATA 3FSGD 3OICA 4Q47A 5KTTA 5JNWA 1MR3F 5JFTA 4OBEA 1TZKA 5BUCA 5JS2A 2YJ5A 4KMMA 2EQAA 3RYTC 3UAOA 2H0AA 3LDHA 1UJBA 3HDYA 1J20A 5KOJA 2FZ4A 3MGKA 2F43B 2HLHA 2P4HX 3K6KA 3KTFA 2AEEA 4BJ6A 1BDIA 2IBTA 1XZBA 4QM6A 3T1HB 7REQA 3DBVO 1DOAA 2V98A 5EWLB 1CQXA 4NBRA 1MV5A 1K5PA 1XTSA 3MT7A 3V7WA 1P0MA 1KVRA 1D1PA 6CHYA 1PL0A 1VSUA 1C7IA 1YRBA 3EXHA 3C48A 1Y37A 3W8DA 3AVXA 5HOEA 4OLHA 2IJGX 3TQQA 3TI9A 2G5GX 1B8PA 3H9EO 4K9PA 4CQJA 2G9QA 2ET6A 1H5UA 4AY3A 3EMBA 2D0PB 2I4OA 3NWEA 4NYMR 2HMVA 2VJBA 5LLSA 2ZI4A 1C4WA 2JFBA 4K9KA 3W1VA 2I91A 2YMQA 5AKYA 4DNQA 4C6SA 4AJNA 3AVYA 3B1KA 3H5NA 1O58A 2II6A 3FUXA 2I62A 1E4EA 1POWA 4G0QA 4A36A 1KIFA 1IVSA 1QHGA 3SDSA 4YRRA 1KY2A 2W2QA 3U5TA 1ODKA 1I4EB 3CA8A 5E6UA 4K81B 3WS7A 1GXSB 3PPIA 5T41A 4WKPA 1R00A 1JIJA 1QTIA 1JWLA 4WNAA 2DQ4A 4YRSA 1W9MA 4ZAZA 3VTAA 3MCTA 1H3FA 4QTYA 1KI8A 1WL8A 2A14A 3HBFA 2FP4B 2ZBUA 3ZWKA 1JQLB 4A6PA 4AF7A 5F9FA 1N7IA 2CUNA 3IE0A 4RPCA 3FSRA 5CM2Z 4Y2VA 3S8MA 1IK4A 2VSOA 3CWQA 1N77A 1UT8A 1U9IA 3S0JA 3CYFA 2F62A 3QX8A 2RJNA 5DIFA 5F51A 4Y6RA 4TS9A 4HDNB 4B6OA 4BVAA 5GPBA 2GXQA 4N8SA 5TPZA 1PJLA 2WYOA 4F4DA 3EFHA 4OHWA 4WHMA 3X1KA 1N0VC 1D0VA 2G07A 4X8LA 1FDRA 4EB6A 1W0KA 2G71A 2Q9CA 3CZ9A 1IONA 1GA6A 3F90A 4HGQA 3WNZA 4BCBA 3GELA 2DB3A 3IAHA 5IANA 4CIVA 3MWEA 1NV9A 2AFIE 2IXEA 2KSQA 4QTZA 2W6CX 1EBBA 2B4TO 4G5RA 4MUBA 4LDRA 1GAWA 1RBZA 5C9ZA 3Q41A 5AUQA 1EZ1A 3AZQA 1I0LA 3FZYA 4RHYA 1BX1A 1NVTA 3HJHA 2I6TA 2WYWA 4IHKA 3VR5H 4ES6A 4ZD6A 3HN2A 4EPWA 2D8MA 4AXBA 2CDRA 2V4ZA 2XI4A 4OIFA 5AHRA 3DZJA 3IBTA 4UNPA 5CYOA 5B2ZA 3V8BA 2BGLA 1DAHA 1C7EA 5B4UA 1OXUA 4B7XA 2YR0A 3DDCA 4PGHA 2HJ9A 2IP2A 1XPOA 1Y3IA 1NDQA 2I8CA 2IW3A 3OESA 1ZM4A 3ROFA 3TW8B 4DYVA 1XA4A 3ESAA 3KKZA 1B14A 4PIPA 3UF0A 4M38A 4EJ0A 1XPRA 4XW2A 4OLAA 1R4AA 1T24A 3A2LA 2PV7A 1A8PA 2IVFA 2ZFUA 3O2NA 1VE1A 5KNDA 4IUBS 3WYNA 4ALLA 1QNLA 4LHEA 2A9OA 3N2KA 3GGJA 5HCIA 4US1R 5IVHA 2BI8A 2D5LA 4FHFA 4CN8A 1DJPA 1GNPA 1N2GA 2RGRA 4V38A 2F8SA 1VJDA 3O8OA 2LPMA 1AHNA 2ZI5A 3HXPA 3HB1A 2QUKA 3WNDA 4PZZA 2FPWA 1FPMA 1P2DA 4MEJA 4MPTA 2PLRA 4A0RA 3GF4A 3AM5A 4EY8A 2CLCX 1G7TA 3KKOA 4RHXA 2P6OA 4RHCA 2GYYA 1QDLB 1UKZA 2C9CA 3CX4A 3KDPA 4IHQA 4PHHA 4PG7A 2O2GA 2W6PA 5HF6A 3WSTA 1I3MA 1VPDA 2HSGA 1IPEA 1M0EA 3SEFA 4B83A 4UDOA 2WT9A 3SJ7A 1PT6A 4ISBA 4ZVVA 2X22A 3GH3A 4LXGA 1H69A 4P54A 5ELMA 1N2HA 3V32A 9ABPA 1W4AA 2WG0A 1FPQA 5K8JB 3CHYA 3GRKA 1MB9A 3ZHTA 4DLBA 1H3NA 2OUKA 3CSDA 4YXWD 5KAMA 2D54A 1Q84A 2JCVA 1LPMA 2PBZA 1RYFA 2ZW9A 3FTCA 1S2NA 1CZOA 4AO8A 1MORA 3BK2A 3EZ9A 1IPHA 3IP6A 3S68A 1TZJA 4ZT7A 2KX7A 3T4UA 1Z0AA 1GQYA 1OT5A 1TZBA 3EZ2A 3KCQA 3KEMA 4FMDB 4G1FA 3MYYA 3NEJA 4KXFB 2Q6KA 3AY3A 3E9DA 1GTMA 1RBYA 3HA7A 4NZMA 4RXMA 4ZWNA 4YLEA 2GPSA 3IUQA 3AERB 4TZKA 1DBPA 3CN7A 3ZBQA 1IC6A 4ZVQA 4O59O 1T5TA 1QKJA 4TWAA 3VBEA 3PEUA 1LNQA 1UOQA 2B4QA 2JVKA 4CXMA 2Q6OA 3AVQA 3IQWA 1TOAA 3T0GA 3CS3A 1OFGA 2YJ3A 4QHSA 1TE2A 4AO6A 4Z3KA 3MT0A 5JOQA 4IIDA 3NKVA 1AQIA 1QBKC 2ZJBA 3HJRA 4O63O 3B78A 1AKVA 4LSGA 4CKCB 4OXYA 1M6WA 2O3JA 3IEXA 4LYHA 4WKNA 2R1TA 1SZPA 3FF1A 3GARA 3ELBA 3FUWA 4MI1A 3V1YA 3U7QA 3IDFA 1ICIA 2VH2A 3L5OA 4KZPA 2ZRIA 3R09A 4L4XA 4RTRA 3VYSB 1ZUWA 1WZEA 2XUFA 1CERA 5LZ5A 3GGPA 4P93A 1QHHA 4RGYA 3TNJA 3LC7O 4EUSA 5FRDA 2CK3A 1NJ6A 1Z06A 1A8HA 2JC3A 1N4AA 5B3JA 3NHYA 1KZ4A 3GEPA 4F84A 2V3CC 4W5HA 5EEHA 3BE4A 3T5DA 1G4AE 3OG9A 2QTNA 3I2HA 1L3CA 2FTKE 3PEVA 1XQ9A 5JG7A 3U40A 3LI2A 1VBMA 1M66A 4CNQA 5IT4A 5E1BA 4MP6A 2E4AA 4NWIA 2I54A 3C6XA 3LYHA 1EJ6A 5F3DA 4POOA 4JJ4A 3HB9A 3ABQB 4NQRA 1YQUA 1NFQA 1U8UA 1RHQA 4NL4H 3WMXA 2EVWX 5G1OA 3WYAA 1DJMA 3QY0A 3PQ7A 1GNLA 2YYZA 1YCDA 2VYNA 2J45A 4HF7A 1THTA 4PC7A 4TYMA 3UMSA 4OY3A 1ZVVA 1HXHA 2XUGA 5DBOA 2UAGA 4F4UA 3EGDA 4HYQA 1M67A 3V9PA 4M1QA 3QVJA 3AI2A 4FYVA 3KT6A 4B3SB 2QTLA 2O59A 2JAQA 1VZ2A 2L0XA 4FBGA 2N46A 4R7GA 5LP6C 1KI9A 1R0WA 5I7VA 1KEUA 1O4VA 4MVJE 5G4KB 2AKAB 1HDYA 4P34A 3V48A 2HCRA 2SCUA 5BMVF 2BDTA 4PXSA 1ISPA 1W2HA 1BRMA 3KQUA 2CXTA 5KINB 1IY9A 2D5AA 1Z3IX 1SNYA 5LOVF 1UDRA 2DBQA 3RSHA 1EGQA 3UVEA 1W4LA 2H54A 2Q3DA 4LKRA 3PXXA 1GUBA 2PMWB 3BHJA 3RJTA 3QH4A 1OHHD 5AVKA 4WOBA 1B2RA 1C3OA 1GDHA 1UXJA 2I1VB 1U7PA 2Y76A 3C85A 2VZ8A 3IRUA 3N74A 2PT5A 4PZYA 5CFZA 4M8SA 4LKOA 5KNBA 2P4EA 4RVUA 4V0SA 5DH9A 1EYZA 2IUSA 3DZDA 1XC7A 1X7WB 4X1KB 1F8YA 1J8DA 1FS6A 5TX7A 4M37A 1H2BA 2OD7A 5H02A 1HQDA 5AVVA 1K8XB 4RK0A 3TSOA 1HMPA 1J25A 3M70A 4FC7A 4BGUA 3LYAA 2J6BA 4EBBA 2Q3MA 1UPUA 4KE8A 2GZ2A 3TB6A 3LY8A 2AI1A 1TO2E 3RUFA 4C7MA 5HS4A 4MQUA 4DT1B 2WUVA 4MWTA 4RD0A 3HZRA 4E12A 4MQ6A 1V9CA 5BQOA 2QRVA 3NGLA 2J5RA 2ZGVA 1NTRA 2QQEA 1OX6A 1OLUB 4C4PA 5K4HA 3K9BA 2NVOA 1C30A 2DR3A 3ROZA 2EDAA 3HJNA 3V3TA 5IKOA 1JQKA 1XN4A 2J3LA 3EF3A 3NNDA 3E2PA 1QP4A 3LWZA 4ZIRB 5DW0A 4MWEA 5UKDA 3GOHA 2GCIA 4B3IA 1CJUC 4HWOA 4QWMA 4W8GA 3UFXB 3DV2A 2GPWA 1R8SA 1KMCA 1NVWQ 4B17A 3UHFA 4PE5B 1EVJA 3S2IA 2GCPA 3UYLA 1RAAA 2IVZA 1WHTA 2JIZD 4KG7A 3RC9A 4KUEA 4RAOA 4D0NA 3LRXA 3KB1A 3QUTA 5BMOA 5LP1A 1DQPA 2MSDB 1MO3A 3WAGA 4FKZA 3RU7A 1TKBA 4E07A 1AKNA 4AJ9A 2DR0A 3ZD7A 2HIMA 2HRDA 4MRVA 4OKSA 1MXHA 4WK0B 9MHTA 3P9CA 3DDHA 1XDSA 2XUPA 3D59A 4Z4GA 1JEAA 3PRKE 1HFEL 1GNTA 2WMYA 3BHNA 2B99A 4OF4A 4Z4QA 1Z7YA 2A92A 2N3ZA 2BAGA 2WE7A 4RTLA 1P5FA 2Z4SA 4IUYA 1VM6A 1BQEA 1X1CA 5EZSA 2LCFA 4OB7A 3VJRA 1AF4A 5JCJA 2Z9BA 4EW3A 2BI7A 1UBSB 4UNSA 3X1ZA 4E5UA 3Q0IA 1WETA 5LBTA 3E5HA 1FDVA 1VCNA 3W05A 1C1XA 2IK8A 4PYJA 1X8JA 3L7NA 4PFQA 3GJQA 4YASA 4EABA 2MU1A 2QD4A 4JGBA 4BDSA 4HXFB 5C7LO 1DTWA 1UMCA 4KP7A 4DRYA 3TRIA 1Z0ZA 3CCFA 2O3SA 3TDMA 3TUJC 4C05A 2F3PA 3LBNA 4K3VA 3O8NA 4YREA 3NUGA 3SZ3A 1KQNA 2W43A 4Y2HA 2CDCA 2CMFA 5ALYA 3T1VA 4BNNA 5C7IO 4G1EB 3F5SA 2I4TA 3UHPA 2D3WA 3ESRA 1ZQ9A 1JU9A 4QUGA 4E2ZA 3W90A 3A36A 3F5FA 2P9GA 2ID7A 5I7WA 2JGEA 1Y42X 3RAGA 3COJA 2X4GA 3LQ2A 4FN5A 2EQ5A 4TYNA 4BXOB 3D6MA 4LVCA 2JI7A 3ITNA 2EC5A 3PQ8A 4HWKA 3R7DA 4Z5XA 2JDIA 2F4NA 4HUQA 5MFPA 2P9QA 3RODA 1PX2A 4OHKA 4LN1A 5REQB 2HBRA 3VJKA 3ZW7A 1QQAA 3TZHA 4EF4A 1CY8A 4OV6B 1JR3E 4JEMA 4LJKA 4NQZA 1GRVA 3RYHA 3ZX4A 1H8HD 1TECE 1VDZA 2AFRA 4KGVA 1QGYA 5H0IA 3E0QA 4TKVA 2IHNA 2C95A 2AOUB 1NVGA 1BHO1 1TLTA 3ICVA 3KJZA 4UW9A 1N5DA 1UC5B 4YAKA 1N57A 1KEEB 4FCTA 4IGFA 3VVMA 4D7AA 5DNCA 5K8UA 1MO2A 4OK3A 3GB9A 2R8BA 1DX4A 3IMGA 3PR1A 5AW5A 3D4NA 4IINA 5LQNA 2O1WA 1EP3B 2BKXA 4C4SA 1U0BB 4R0VA 5T4HA 3ZK7A 1WULS 5H59A 1M1XB 2FEPA 2RGCA 3DWFA 3LY7A 5FOTA 3RSFA 2B8TA 2QL9A 4C4OA 3I72A 3S3TA 4JCOA 5CM9C 2ONZA 5E6RB 4J7UA 5DWDA 1XQYA 1L7NA 3PQDA 3PXGA 4M9ZA 4WZ6A 4I1VA 1RQRA 3W0LB 5HCNA 4XX0A 4KWTA 4C5AA 3JQGB 4Q4LA 3NBKA 1Y4DE 3C2QA 4AJLA 4B8YA 2PN1A 4OQFA 4DHEA 1JAXA 1YR1A 1W87A 3SFZA 1V95A 3O8QA 1UOEA 3DE6X 4B3CA 2PUBA 2GPJA 1DL5A 1TQ2A 1U2TA 4ITUA 4CIAA 3FHOA 2QE7D 4ICIA 2QPLA 2FPMA 3LBAA 1JQ3A 3P0JA 1RZRA 1Y6RA 2JASA 2UVDA 1V4BA 2C31A 2CNWA 3ED1A 2GZDA 1KWGA 1YVPA 5K99A 3AVPA 3SQDA 4RNDB 4P0PB 4DANA 5FF9A 2P5YA 4I1IA 4DF3A 2ON6A 1BMDA 5EYPB 3Q7SA 3FPKA 3NHFA 4PQEA 2HTFA 3C8UA 3ENWA 4OYHA 2K6GA 5K4AA 1S7GA 2J7KA 3AVOA 5EFZA 4B7ZA 2DFDA 4OHFA 2P40A 1QYIA 1JHPA 5SZJA 1O94C 2JKZA 3DF9A 1O89A 1WB5A 1XDDA 3NHKA 3T54A 3WK7A 1NR5A 1NC1A 3UHAA 1OXSC 1DI0A 4K6OA 4NLLA 2XZOA 5JATA 2BFCA 3KL2A 1RKUA 4LY6A 4KCGA 5J2UF 1JT9A 3VYWA 1PO7A 2P75A 5EMLA 2B0CA 4ZOQI 2V6FA 3I9MA 2VZ9A 3UA4A 4HGPA 4JVOA 1WUJS 1Z8HA 4FOPA 2I2DA 3B6ZA 5JFOA 5AMXA 5A4DA 3WWPA 3LX4A 1GCOA 4H16A 3LQ1A 3RYFA 3WBJA 4B3FX 1EVQA 4RSHA 3OQOA 4EF6A 4TS4A 3STVA 2FPGB 1SBNE 4JH0A 4ZP1A 2ZIZA 3VSDA 3KT3A 1V8PA 2DBYA 1J6UA 2FPLA 5AVUA 5AUOB 4FP9A 1KGSA 1CR6A 1JPJA 1Q19A 4F9FA 5AUNB 2H57A 1RMTA 4DBLE 5F5XA 5SYAA 2HCBA 1FNMA 1W2GA 3L4EA 4YRFA 2M6LA 4EVQA 4F6CA 4MW1A 1OWLA 4KAJA 4GC5A 4KPUB 2H1CA 3LBFA 2G63A 2VJYA 1ZRMA 2XTMA 2GJKA 3E1KA 1AG9A 2ZITA 1Z68A 4FNOA 2PE5A 2E5LB 1LWNA 5FBWB 5EP1A 1J49A 3KC2A 1IBSA 1E4YA 2IYPA 5AXCA 1M1ZA 4F1WA 2YNMA 1RYDA 2WJPA 3DKPA 3TM4A 1AKMA 2PRKA 1VCOA 2DM6A 2P67A 3RADC 4RQBA 1RAFA 4BKOA 3TQTA 4G89A 3A3OA 2JHCA 4YH1A 2DSNA 4HI0E 4O33A 2VYCA 4GMKA 3RBAA 4X8HA 3L8GA 3S6JA 2PSSA 3EC2A 5BORA 3MTIA 5LU9A 4XEUA 5EIOA 4BFTA 5BQ5A 4AJ4A 4HRXA 2R66A 3T7AA 2E2WA 3WJAA 5JR3A 4MUAA 4O6VA 4UMEA 1T9CA 2HXGA 1YR8A 3DZGA 3ZJUA 1Z4IA 4JHLA 3P8ZA 2BIFA 4ZDWA 1J33A 1WIWA 2GBIA 1YBVA 3I5YA 2CV0A 3O73A 1O1YA 1P5ZB 1AS0A 2PKYX 4R16A 2EJWA 1OPRA 4D46A 1DCMA 2ZUEA 5KUTA 4FSDA 1WDTA 4BB5A 2D8AA 1XK7A 4BC0A 1Z25A 2VZEA 3D54D 2ACEA 5ALHA 3TM5A 4MDFA 1QIKA 2D0DA 3WIEA 2C5EA 4MICA 3HFSA 1VMEA 3FETA 2HBQA 1SBCA 1PQPA 3VYRB 2X5XA 3VVLA 4RNCA 5CLLA 1SXGA 2PZAA 3ZYZA 4DREA 2ZT7A 4HLNA 3UATA 4D8UA 5K3FA 5IAJA 2ECQA 3HKBB 1OPXA 4CU5A 1N2IA 4LV8B 2EGUA 4CODB 2IEDA 4H2DA 4KQKA 2HSEA 3SQXA 1L4YA 2RKWA 3CH7A 2RCNA 1RHUA 2BEUB 1I4TD 4WA7A 2M6KA 2Y05A 4QPJC 2OSBA 5D7NA 5SYMA 4CEJB 1ODSA 1L5OA 1J9GA 1QC5A 4V3BA 2BI4A 4B2IA 4YAGA 3A4YA 3F98A 2CT8A 1W5SA 4JJ6A 3KHSA 1U2QA 4I8XA 4AG6A 4Q4AB 3DTVB 4NE7A 1QAMA 1HTBA 2AN4A 4JVLA 3ADKA 4YVFA 1QG4A 2RK4A 3LLUA 4F5DA 1O3YA 1HYQA 4NBVA 4IDBA 4U00A 4PGAA 4W5JA 1M0WA 4L76A 2H7YA 2E85A 4KQXA 4OSOA 4UASA 3I2GA 5MGBA 4XM1A 1B6GA 1RI3A 4IO0A 1JN0A 3D3WA 3AHCA 4TXLA 5HSGA 2YZ7A 5H1YA 4EVRA 4C78A 2G06A 1J0EA 4M8IA 4EBFA 2VXYA 3OO0A 1J8QA 2ATXA 2X41A 3JTEA 2IRWA 4WBNA 2A67A 2H2FA 4OAOA 1MIOA 3SJUA 3SMQA 4ONEA 2P35A 2QLTA 6AT1A 1AF7A 3A1FA 1T8WA 4QYIA 1P1IA 2Y93A 4XGNA 1AV6A 2ZIAA 3OD5A 3TFWA 2VUUA 1XEFA 3IULA 4OQQA 1A4UA 2FPXA 4H59A 1BYIA 1CDEA 3E5MA 5U1PA 4M76B 3DBLB 3EBLA 4TKLA 1XK6A 2GLTA 3OKPA 1AKQA 2AJ8A 5JALA 4ND8B 3T3NA 2BMEA 4B8WA 3LK7A 3EEOA 2GXUA 1L7OA 5BSVA 1ADJA 1N0UA 3QLVA 1VKOA 2NV0A 4KC0A 1SVMA 1D4AA 1A04A 1O9GA 4DJ5X 1M76A 3L18A 1WF3A 5HM8A 2F8MA 5B2EA 4R3WA 1ADGA 4S24A 1NBOA 2JJMA 1B8NA 2P30A 3OQBA 1DKUA 3CR8A 1J2RA 3B3QA 3H4VA 4Y6QA 3U3ZA 4CETA 2O4UX 1WQ4A 1ZGAA 4JSRA 4KR9A 2INGX 2WAYA 4EMUA 721PA 5BSGA 2WUWE 8ATCA 1M6YA 1SELA 4W4TA 1EM8A 3F1KA 2FXIA 2C4KA 3G89A 3NP7A 4L3WA 3QF4A 3ZQ6A 4C4AA 1DE0A 4P2BA 2HLPA 2GN2A 4D9KA 1PYOA 1I4LD 2JFQA 3U4MA 1QKIA 1FNDA 2CCJA 2DUJA 2PHZA 2I3GA 3AUJB 1E6CA 2I66A 3A3KA 3GG9A 3MEQA 3L1JA 3RT1A 3B6JA 1L4LA 3Q8LA 4I9HA 3G1TA 3ORRA 3PR3A 4ETIA 2R97A 1HH4A 3AEUB 4N4AA 3DLTA 3RUHA 1YS2X 1IH8A 4HQ0A 1T35A 1OFHA 1Z29A 2RC6A 4QOFA 3T9FA 4DDMA 5CVJA 1MV8A 1GTL1 3VKHA 5AM2A 4LY3A 3NOQA 5KNLA 2PBLA 1TO1E 2HKIA 4D6YA 1BIFA 2P27A 1MGOA 3ISVA 2C84A 3NC0C 4LGCA 4CCWA 1M1NB 3HWX1 3K8YA 5FBZA 5H83A 3IESA 4MMYB 3E84A 1UMBA 2VHCA 4WBXC 3U1VA 1W36C 4NCKA 3PFBA 3CINA 3FNGA 3T7JA 4PG4A 4QL3A 5ADVA 3V2IA 1RQGA 5DHUA 3MPOA 2YOHA 4MLDA 1OAOC 5KKCA 3FBGA 2ZAMA 2W6MA 3UM9A 3VU3A 2IBSA 3TLAA 3GVHA 4FS8A 4IP0A 2ZYIA 4Z7QB 1ZXLA 3A2MA 3PLRA 3NBYC 4OVKA 4PS1A 4DB2A 5CXXA 1U4NA 4IX9A 5AO9A 3RS5A 2NO6A 3O8CA 4CEIB 2YWRA 2XQJA 4KLCA 4MW9A 3DLBA 2H1SA 1EWYA 3CLTC 4XASA 5DM2A 1VPVA 4C9BA 3KKKA 3K0SA 1KAQA 3BDAA 4PG5A 4BWFB 4PN3A 5JAOA 2X19A 1BU8A 3OE4A 3OPMA 3TQFA 2WYVA 1FYEA 4IQ4A 2X8WA 3FLMA 2B4KA 1XDUA 2QRQA 1US8B 1X1EA 5TS2A 4ECAA 3SEAA 3IIIA 1T3GA 3FA2A 5BW4A 2VDOB 3KXKA 3ZGOA 3FPAA 1RRFA 3WGKA 1KY4A 3NXSA 4CEHB 1TNDA 1E0SA 5AOVA 3T3GA 1UPCA 1Q7CA 4IIGA 2VHQA 1JG6A 4D99A 3A2KA 1GQRA 1CNMA 1THMA 2WD7A 4FVTA 1Q0LA 5D3QA 5BSEA 2O8DB 2VK4A 1MH1A 2A9KA 3C1AA 3NBMA 4RK5A 1PS9A 1SD5A 4CIBA 1FFYA 1TUGA 4XQ9A 2QGZA 1DV2A 4YI3A 4BIIA 4BMOB 4YMHA 1QQBA 5HF8A 4U9HS 3ZGNA 1DAFA 1BXRA 1POXA 4EA6A 1Y4ZA 4MQFB 2TMGA 3JYOA 3QXJA 1VTKA 1OIWA 1ND6A 5LYYA 4CR7A 1Y34E 1U0GA 1HBJA 1M2HA 2NG1A 1QYVA 3ODGA 4NIMA 3IUJA 5E9QA 1WDWB 4C4YA 3VX4A 2Q2WA 4YGXB 3ICQB 1GILA 3B9RA 3ZU4A 3LT0A 1IXZA 4YCDA 2H8GA 1ZC3A 2MYPA 3ENNA 1TAUA 3N8GA 1M2VA 1Q6YA 1TUBB 3NPAA 3QNUA 3OZXA 4NI5A 4HWSA 2BCGY 4Q9DA 3IVAA 2I99A 4TOIA 4QZVA 4YJ2A 1CSEE 2NUBA 3G3EA 3MJDA 4I5EA 4EMTA 4AJ1A 2NO5A 4RVNA 3VOBA 1PUIA 3NB0A 4YYZA 3A9CA 3ELYA 5DHQA 3VHLB 2C0CA 4DYHA 4P36A 4JC0A 1RNLA 3WL4A 2J0SA 1WBJB 2NYVA 3HACA 5H82A 1DWUA 1H2FA 3AESB 2D74A 4TV9F 3EEIA 1GUYA 3GWZA 4XQGA 1UZMA 2FQ1A 2EIHA 4M1KA 4H0NA 4Q4CA 4ZJPA 5ECDA 4JLUA 4C7OB 3ZHUA 3PA6A 4A9AA 3IQZA 3CH6A 2P0AA 3BICA 1RLMA 2REOA 3PYXA 2P5TB 1MX3A 4HDSB 3A32A 3IPYA 3E27A 4N7MA 3ONVA 3RV3A 5BR8B 2GEUA 4EY3A 3NYRA 2BFFB 3BL6A 4UOQA 2QZJA 3KR2A 3A6HA 5K3SA 5DNWA 3FNQA 4BRZA 4MRMA 5ARCA 3ROGA 1EUZA 10MHA 5EVJA 4DIDA 4FI3C 1KL7A 4Q15A 1NPDA 5IYZB 3CZQA 4Q1FA 1IN8A 1WY5A 4GBED 5SZKB 4RHFA 1YA6A 2ONKA 1DFGA 1EJ0A 4RMNA 1W0JD 1KDPA 3L7YA 2AZDA 4O2AB 3VTFA 2Y1DA 1KQFA 1X1BA 3UXHA 3C7TA 5HJEA 3RVDA 5K8VA 5F3WB 4Z0NA 1CUVA 4QBTA 3UGQA 1ES9A 1FMTA 4CV1A 5K3BA 1EAMA 2FJPA 2BKVA 1K97A 5IDYA 3W5BA 1PJRA 1JDBB 5L3VA 3KDSE 5K1ZA 4N8EA 3IDZA 4EFMA 4ZCPA 1U65A 2I8AA 2QYOA 3HYCA 3NYWA 4GAEA 1B43A 1IATA 3SE7A 2GERA 2GJ4A 4BJ3A 2Q3EA 4FFVA 1G3UA 3P9RA 4B43A 2O8EA 3ZY2A 5EZYB 1Z63A 2OESA 2R4UA 2C82A 4LV5B 3EG9A 3C5CA 4GYYA 5JAHA 3VZBA 4QXPA 4MHTA 2I4LA 4FGLA 4QE3A 5CG1A 5I4KA 3TQHA 3I58A 3WWZA 3TXXA 3G7NA 3D1VA 5FPSA 4K3UA 3GROA 1YZKA 4M1MA 3RVOA 2Q0SA 3QP9A 4QFCA 3U62A 4YMTA 1N2CA 5B1YA 2BJHA 4OSPA 3X0DA 1JDSA 2R65A 3CO5A 1SPXA 1NBAA 2OFWA 2LDBA 3LKVA 1DKQA 1DCKA 3OQPA 3DVQX 2I1WA 3L40A 4IH9A 1PJ2A 2I8LA 3RRZA 1NW5A 2GN9A 3WMWA 3T9EA 1XQXA 2ZB2A 1FXUA 3BMXA 3WY9A 2Q5FA 2O1XA 2VJLA 1E18A 4QVKA 4A2WA 1BFUA 5AFSA 4AY6A 2AHOA 5B7NA 4FEYA 1ESMA 2OCBA 2YV3A 3NRBA 5DJ5A 3BRSA 3H87A 3UK6A 2NTEA 2HBZA 2WTMA 3AR8A 5E3IA 1DS6A 1H22A 1L5MA 4EX7A 5BNWA 1W2WB 4OHYA 8MHTA 3R7SA 1LBQA 1KHTA 3BIXA 1GPUA 3UV6A 1TADA 1Z62A 2CBXA 3PDCA 1X1QA 3PWTA 4URHA 4WTOA 2YMMA 3V33A 1P19A 2AX3A 2P6MA 4B4VA 2ZBPA 1MJGM 3BB3A 7GPBA 3QVGA 4GBGA 4MYHA 3K96A 4RK4A 2PX2A 1MF7A 2CHFA 3KJXA 3BJZA 1UPTA 1I10A 4BJ1A 3OQNA 1WVIA 5FFNA 4L02A 4M7RA 1U0JA 4K88A 2IY9A 2ZRLA 1V1MA 1JIQA 2BFWA 4DCGA 3FMIA 1SPBS 4RCVA 2RMKA 3KYCB 3MWYW 2WD9A 4G37A 4RSGA 1PF7E 1R0SA 4FT2A 3I01A 3SYNA 5A9RA 4JC8A 2WJ3A 5BUSA 2FMKA 2ZJ2A 4UM9D 5KPDA 1JR4A 2ZKIA 4JQZA 2X4LA 3HUTA 3I6IA 1S4QA 3V4LA 3DGEC 5AK0A 3UQZA 1JEQB 1DEOA 3VZSA 2ANBA 2I33A 2PRIA 1T5IA 1Z37A 2HAEA 1N6HA 1FVXA 2WAMA 3E70C 2JCBA 1T6XA 3P32A 4LOHA 4UEKA 4W9NC 3UOGA 5B64A 3ZJYA 2BM1A 4OQDA 1YE3A 5AHWA 4U6QA 2XQGA 4IDQA 3RROA 3CH4B 2MMGA 4YYEA 1PR6A 3CNHA 1DPFA 2LIVA 3H11B 2X7XA 4ZJYA 2DYKA 2OUIA 1Z5NA 1GPYA 4BZPA 4AICA 4V0QA 1YS6A 3RFUA 2C2MA 2BKEA 2OPHA 1L3IA 3CZCA 4YJ3F 4ZYXA 4E32A 1K5GA 2ZDQA 2VEOA 3FPHA 3PCTA 4ML3A 3KZMA 2HO5A 1GPLA 4P8RA 4QXRA 3BXXA 4NDAA 3VNVA 2DFNA 1G0NA 1NVKA 3LCCA 4TTRA 5GJWC 1F2UA 1YJXA 3CO0S 4EKYA 2HJWA 3VFDA 4MUYA 1NX6A 4I50F 1U0OC 4JT9A 3ZWWA 1EGHA 4YV1A 5IKMA 1ID8A 1TFUA 1VQ1A 4EVSA 3BXEA 1TT5A 4FC6A 5EUCA 4WFIA 5IKPA 2VPXA 3ABRB 3KP1A 5BOSA 4Q1BA 5H9VA 4EKIA 2BVNA 3G0IA 2Z5GA 3B6IA 3IAFA 4HAYA 2VNJA 2RE8A 1XCOA 1FNNA 2Y66A 3U3KA 2AG1A 1V0JA 3C4QA 5FUVA 3U49A 3QYAA 2FP3A 5DI9A 2XV1A 3RARA 3RHZA 1W4BA 3GRPA 3EISA 5AVYA 3NHZA 4Z1OA 3SHQA 3LGXA 3ZDFA 5A5GA 4QQ8A 3T5MA 3DMFA 4PGFA 4Y2UA 1DOHA 4LYJA 3DXZA 1DBVO 2AOWA 2VHVA 1SUWA 5F4BA 1L4BA 5LD2C 4ZYYA 4S1VA 1XJ0A 5LMUB 4P98A 1C7RA 1TQ6A 3BMNA 4L6AA 4F3KA 3LTNC 1XU4A 2W8BB 2QIPA 3PUJA 1NX9A 1RIFA 5NULA 3W2GA 3LY9A 1FDSA 1SBYA 4CT4B 3UMYA 1FFBA 1T4CB 3HEAA 4O4IF 3AETA 4NNOA 4UUMA 4GLLA 1ULAA 2W90A 4IJUA 3UAGA 4C89A 2QZZA 4EJ6A 3R6DA 1YO6A 4DSNA 4WESB 3MWLA 1S2OA 3SQOA 5DBGA 1ZR4A 5CDFA 4C6RA 3PYMA 1A7UA 1X3LA 3V4FA 1W581 4DJJA 5FLXA 1QVRA 3BF7A 5JNLA 1N2OA 4JZKA 3TLBA 1YVDA 3AU9A 1M8KA 2P9JA 4HQFA 3QFHA 2F00A 1UKVY 2IYLD 1T4MA 1IJFA 2MR6A 1W6RA 4W7HA 4YP6A 3LPCA 4LJ9A 1DC6A 3P0FA 3PRJA 2QS9A 4L8FA 4AWAA 5EIBC 2OGWA 3WDKA 1C2TA 3BCRA 4KAFA 2XQFA 2ISCA 4AG5A 1XSEA 4QXMA 1GYQA 1KYIA 3X2SA 1L6RA 3ABSB 2ZR9A 3CPJB 3MTEA 2E89A 3RRXA 4BMXA 1JEYA 2O23A 3EFOB 1E96A 1KDZA 2PX8A 2IBMA 1K7FB 3DAFA 3CSUA 3TPZA 5JO0A 2WJGA 1D2HA 1NE7A 3KOMA 2LWIA 1ZUIA 4TZ0A 2VCHA 3OEHA 1FX0B 1YZQA 2QW0X 3IAXA 3TAUA 5BPHA 4BKPA 1M8JA 1WXQA 1GKKA 3B20A 3M5PA 1R5OA 3OTGA 4LNHA 3GLHA 3K5HA 3M6IA 3QPUA 1X7XA 1KMQA 1L5WA 3QI7A 2PMBA 5JD4A 1SUAA 1ZIXA 1WHSB 1L4NA 4KU4A 4NOKA 2RD2A 2Y4NA 5FFMA 3ZH9B 4DIMA 2IWRA 5H16A 1RRCA 1T4GA 1ZNQO 2F8LA 5B30A 3WLKX 3IIJA 4OQEA 2M6SA 5LB2A 3VPDA 2KQUA 1RZVA 5KOYA 1E3JA 3ANNA 2C04A 4CUZA 2I65A 5ADUS 3G5LA 5CFRA 4ZCRA 1TYEB 4L8VA 5IKXA 4RSRA 1XAIA 4U7HA 3SX0A 4OCZA 2H00A 2A1TR 5KSPA 2XITA 1ILWA 4EJSB 1E6WA 1UDBA 2H0QA 5EESA 1AOXA 4NVRA 5SY6A 2X0EA 3V1NA 3WGUA 2CZGA 1OKKA 1G6OA 2QAIA 3C3YA 3L4BC 3RTDA 3KQNA 2A58A 4GR4A 2ETXA 2O4CA 3MAAC 4L8YA 4UVHA 4TKMA 4WERA 1ESCA 1SJ9A 2Y0BA 3N2GB 4KIUA 3BXZA 2A1UB 4TQUS 1RC1A 1O57A 4D56A 3ZDRA 5B6PA 1WPQA 2ICAA 3FCSB 5ALMA 4RQUA 4EDHA 1KEPA 2WIGA 3LA6A 1BFKA 2Y4OA 5EZ5A 4YDQA 3IL2A 1ZN7A 3PXEA 1L8OA 2JA1A 2QRNA 3FWNA 1OOEA 4ZEWA 5HIMA 1GITA 4TGLA 4EI8A 1E6UA 2ZTMA 3PHBE 1YZLA 5CTAA 2ZCVA 4P4UA 1TM2A 5DCLA 2C7RA 1Z0JA 4XM0A 3WWOA 3AG6A 4BFZA 5EHZA 3EZYA 4C4TA 4UNNA 1QPZA 1TD1A 1OU4A 1I3LA 2VP4A 5LKRA 4D41A 3W7VA 4MCHA 3HUUA 4ER7A 4YRKA 1YUNA 2HGZA 1S2MA 1XEWY 2VSNA 5JD3A 3FIJA 3WFIA 3PQEA 2PUDA 2MMCA 2X58A 3B8EA 2ODWA 2IIPA 3EZNA 4GLFA 4IQ8A 2XDQA 1KH2A 2EX1A 2GK3A 3NCHA 3T7TA 5BMVB 3INNA 3ELUA 3PSAA 2QBYB 2AKEA 1JLLB 2AQIA 2FSVA 4CMIA 2WU0A 2G5CA 2Y68A 3K92A 1SG0A 3I9KA 5DF1A 4FOLA 3IQHX 5JEDA 3U5ZB 1I1QB 2Y0DA 4FT4A 2YUTA 3QEMB 1B2LA 4J90A 1U6JA 3N70A 3T3IA 1R37A 3KALA 1FP6A 3I1IA 3W9BA 3CEJA 3I32A 1E66A 2XA9A 4RD1A 3T5PA 3CLHA 3FDZB 5FPYA 3KLNA 1J24A 2D1QA 3SIPA 3ZI0A 5BV7A 5C81A 1VLVA 1G20A 5AJYA 3YASA 3Q6MA 1T10A 3NKLA 4FYIA 3RT7A 5TDHA 3SDBA 4JVSB 1GEGA 4GBJA 1W94A 3BGWA 1WMBA 1KJ8A 1NW4A 2V6GA 3LPMA 4PZAA 3WRWA 5BN3B 2WFMA 1A1VA 5LVAA 2Q1YA 3GMTA 1FRZA 1NUQA 3RU9A 3SJAA 2WUDA 3W3AD 3EPLA 1X80A 3THYB 2OCYC 3ZVMA 4DDTA 1LI7A 3K0AB 5K3OA 2J3MA 3EVGA 1CKEA 4EECA 1MTOA 3L43A 2KBFA 3FAZA 1VYUA 3H8WA 3L05A 3L84A 4ZARA 3O90A 3BGDA 4OL0A 3RAJA 1GLGA 1IUOA 3IDOA 1W96A 5FD8A 4JI4B 1P4AA 3KXLA 4PR0A 1ODLA 4I19A 4J6EA 2CXNA 5J40A 2DPGA 3ZHCA 2VJDA 2XWQA 4MJXA 2HQBA 1QR2A 4BGEA 5KMGB 2G9NA 3LFUA 2C00A 3K7EA 5BV8A 2AUTA 3KVNA 4Y9UA 1FJGB 7ADHA 4KSBA 1TEHA 2OCLA 2CDNA 4HGZA 4XTRA 2VA8A 5CB4F 3EGXA 4R71A 4C07A 1QFXA 3L49A 3NHSA 4EARA 1VKHA 1SXJC 1ZJJA 3A1DA 3A7EA 4L0DA 4PPQA 4H6WA 3OJLA 5DEOA 3SLKA 4D92A 4HNVA 3KCNA 3H9CA 3OT5A 2NYUA 5A7FA 4OQYA 2Y1XA 4TSFA 5CT5A 4L57A 1GZ4A 3BVPA 2HUPA 5TT1A 3JQCA 1K4YA 1U0FA 2AT1A 2QEQA 5BWCA 3O75A 1AGPA 1BOOA 2DQSA 4I3HA 1KF0A 1NVUQ 2QROA 5JTTA 2RAFA 1FU8A 4RO0A 5CDHA 5MN5A 4Y1EA 3VSCA 4OYRA 1XWWA 2X6RA 4HNHA 1R5BA 4LYYA 2G28A 3ANSA 3FPEA 3U4GA 3OIYA 1ATIA 2ZWVA 5DHSA 4ARUA 1Z22A 4MGYR 1F5NA 1XZEA 4NBSA 1E5XA 4GRDA 2ZXFA 1FP7A 3A3NA 3HJUA 4MS3B 2JZNA 1PR2A 3LK6A 4JC4A 2LCQA 2FPIB 3UYKA 1OC2A 2SHKA 3QPDA 2YYYA 1AQJA 4MQEA 3ZS8A 1FS4A 2EBFX 2Q8NA 4RTNA 1IFXA 1V8DA 1J70A 4IDHA 5C8ZA 5CA1B 4DQXA 3RJZA 5C1DA 3ZTYA 3S99A 1YCFA 1U99A 1N9GA 4LXTA 4MKIA 1TO6A 3GFBA 1NJFA 1RM3A 4ND7A 3BSWA 1OBCA 2HCTA 1CRZA 5M04A 4MGHA 4F06A 2ODAA 1UFRA 3JQEA 1JQ5A 3N86A 3R7BA 2QNRA 3AMVA 1FLVA 1YTLA 5HUHA