4E0BA

2.17 angstrom resolution crystal structure of malate dehydrogenase from vibrio vulnificus cmcp6
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
311
structure length
305
Chain Sequence
NAMKVAVIGAAGGIGQALALLLKNRLPAGSDLALYDIAPVTPGVAADLSHIPTHVSIKGYAGEDPTPALEGADVVLISAGVARADLFNVNAGIVKSLAERIAVVCPNACIGIITNPVNTTVPIAAEVLKKAGVYDKRKLFGVTTLDVIRSETFVAELKGQDPGEVRVPVIGGHSGVTILPLLSQVEGVEFSDEEIAALTKRIQNAGTEVVEAKAGGGSATLSMGQAACRFGLALVKALQGEEVIEYAYVEGNGEHASFFAQPVKLGKEGVEEILPYGELSDFEKAALDGMLETLNSDIQIGVDFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Malate dehydrogenase
publication title 2.17 Angstrom resolution crystal structure of malate dehydrogenase from Vibrio vulnificus CMCP6
rcsb
source organism Vibrio vulnificus
total genus 104
structure length 305
sequence length 311
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4e0bA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4e0bA02
2DTXA 3HWRA 2AG5A 4R9SA 1XG5A 3OA0A 4L74A 1FK8A 1QYVA 3E1KA 1DIHA 2Y1EA 2CF6A 5L7TA 2ZK7A 4XDZA 2UAGA 1QP8A 3WIEA 3AU9A 1SBYA 4DQUA 3C7AA 1LDBA 1H9BA 4NPCA 4W9NA 2Q4EA 5TNXA 2BGMA 2OMEA 3MJTA 4E2ZA 1U7TA 2Z95A 2VWPA 3HUDA 3ZWMA 4CQLB 1KIFA 3DTTA 2GYYA 2O3UA 2J6IA 4AJNA 4QSMA 1O5IA 3N58A 2O4UX 1WW8A 1OC2A 4GH5A 4R4JA 1K3TA 4WEOA 4OKNA 4D41A 4DBZA 3LT1A 3OA2A 5ITVA 1PJLA 3EUWA 3OM9A 1HE3A 2W4QA 1UXIA 5FEUA 5JAQA 3HQ4O 2YJZA 1E3IA 2D0IA 4BO3A 1EDOA 2PV7A 3BTVA 1NNUA 4Q39A 1GZ4A 4EW6A 3VH2A 3GEGA 1OZAA 3VPSA 3H8VA 5IF3A 1BXGA 2OOSA 2IDZA 3ZWCA 1ZUD1 1F12A 4FSHA 5MGBA 1ZEMA 1BTOA 2Q4BA 3DFUA 3FWNA 1YB4A 4W9NC 3TNLA 3LDHA 4IIVA 4HUJA 1MLDA 1U1IA 2E82A 4B7XA 3OH8A 1ZK3A 3PYMA 4ZHSA 2QW8A 1Y8RB 3B70A 3HB5X 3PQFA 3GLQA 2NTNA 1DAOA 1H93A 4AL4A 3DTYA 1T1RA 3PHIA 5TC4A 2OZPA 4JCOA 3ZV4A 4YJHB 4ILKA 4UVDA 4W4TA 4BO6A 4Q3CA 5ER9A 4WKGA 1Q1NA 5DP2A 3VH3A 3GZNA 4AJOA 5JBIA 2Y1CA 1E77A 4RLSA 4U8GA 3GG2A 2I66A 1NQ5A 1PJ4A 1NASA 3AI1A 4BKRA 5CP8A 3JQAA 1HYGA 1PIWA 4NJOA 5I9NA 4XR9A 2HJRA 5CAEA 3KO8A 2EF1A 5TQVA 1MFZA 1IHXA 4QTZA 4YXFA 4GBJA 3GNQA 3W1VA 1I8TA 1MGOA 3WDSA 4NBTA 2B4RO 2VNSA 4M1QA 1CRWG 1E7SA 5KJ6A 3ANMA 1V0JA 3JQDA 1HKUA 1Y8QB 5GY7A 3PRJA 3GFGA 9LDBA 2VYVD 3CINA 3GVIA 3GUCA 1QG6A 1BDBA 4LMPA 3VPXA 3WFIA 3D5TA 1HT0A 2SCUA 5BSFA 2GZ1A 4CQLA 2J5KA 4IXTA 4B8WA 4R3WA 1JKFA 1DIRA 3ZWBA 5JC1A 1K6JA 4D3DA 3O8QB 3PFFA 3FPCA 1AHIA 1Q7BA 4ZQFA 2OXIA 4A73A 1SMKA 1ZJZA 3JSAA 2G17A 3F1KA 4ALKA 4DWVA 3BIOA 1B16A 4BKPA 2B4QA 1J6UA 2D8AA 1R4NB 2PKQP 4JX8A 1JVBA 5JCXA 1UZNA 4XB1A 5F3RA 2GLXA 4GWGA 4HKTA 3COSA 1GAEO 2BFPA 3RU9A 4FC7A 5ADHA 1YH3A 2BFAA 2OP1A 3PJDA 3ANNA 4ZA2A 2O50A 3E82A 2X8LA 4AJLA 4NFYA 5JY1A 5KCZA 4XZ3A 4XYGA 4BGEA 1IPFA 2Y66A 2D3TA 1NHGA 3DZKA 3PTZA 5IZ4A 2OHXA 4Z3KA 3NT4A 4DLAA 5K0ZA 2VRCD 1NQAO 1RYEA 1H2BA 4YA6A 2NQTA 3MTJA 1GPJA 3IDSA 1Y8RA 3HZZA 1T26A 3VDQA 4PG4A 1XQ1A 4EUEA 1PS0A 1VLLA 3CMCO 3GEMA 2FN7A 4LCEA 1WAMA 1AUPA 1GADO 1LQTA 2IRWA 3M2PA 4NIMA 3BHJA 2C54A 2PGJA 2GRAA 5KJCA 3S1LA 4GL4A 5L53A 4KUEA 3K2EA 3FRJA 4K1LA 3VAZA 1V8BA 4WE3A 3LC2O 3JYQA 4RPGA 4ND5A 3PQDA 2V6FA 2DFDA 1X7DA 1CDOA 3K30A 3STHA 1JN0A 2JFFA 3Q3CA 3AW9A 3ZI0A 1P77A 3V1UA 4N5LA 4L8VA 3JV7A 3TJRA 2OUIA 4Y6PA 5TJ9A 1CQJA 3QVXA 5DCUA 2E49A 3UAGA 1JAYA 3WSWA 3RASA 4GLOA 2VWHA 2YQ5A 1VRWA 2IZ0A 1ENOA 3MOIA 3FNEA 1Y8QA 1HSOA 4DMMA 9LDTA 2CDAA 2OGUA 4NMHA 1NPDA 2PK3A 3H2SA 4MKXA 2GCGA 4FOSA 1YL7A 1T2DA 2HAEA 3JQ6A 3K2BA 3NDIA 3NX4A 4LK3A 1EUCA 1YDEA 3D3EA 2Y0DA 3O8QA 4Y6RA 3F47A 2GN8A 2ILTA 4JN6B 1JWBB 2C59A 3QV1A 3DAFA 4GQAA 3HG7A 4RPLA 4ZRMA 3P7MA 1A4IA 3K8ZA 1R4NA 1RM3A 3FCOA 2B4TO 5L3ZA 2Q3EA 2YDYA 1I24A 2Q1WA 2NVUB 5T64A 4LW8A 3VVCA 1EVZA 1GQ2A 3QVWA 4NG5A 4D79A 4QO8A 3H2ZA 1D4FA 1E7MA 3GT0A 4CM5A 3JD4A 3F3SA 3RD5A 3S2FA 4D42A 3OECA 1CF2O 1B2LA 4PLVA 4B7UA 3MCVA 4BNKA 3KYBA 4BUCA 2D59A 3GH3A 3BMCB 2VZ9A 2VUUA 3H3FA 4MVJH 5TX7A 3H9QA 4Q3BA 1BXZA 5AXCA 2DU8A 2O3TA 2EGHA 1JA9A 1H0KA 2J5RA 3FTNA 4JQCA 1SNYA 1LRJA 4L73A 1O94A 1K0UA 1I3KA 4K28A 2WJPA 4BVAA 3LC7O 4BNHA 1R15A 4EBFA 1DAPA 4JP3A 1GEEA 1GR0A 1XELA 3MJ4A 1VPDA 3U09A 2P9CA 1NFQA 3E9NA 5CPBA 4ND4A 3RUHA 4D43A 2BRUA 3UHAA 3FR8A 2JFHA 3L9XA 1ZBQA 1J0XO 4RORA 4RZIA 4DVJA 5L45A 4XGKA 3S8MA 3VTZA 3PJEA 3SLKA 4J2HA 4MP8A 4KDFA 3WBBA 4Y67A 1H6AA 3A14A 5AVOA 1Y5RA 1E7YA 3LT2A 4M86A 2Q46A 1B7GO 1WZEA 1FDSA 4BQPA 5A3JA 3ZV5A 2FSSA 1LSUA 1OMOA 3R3JA 3M6IA 2VT2A 4TRRA 3S55A 5C7OO 3ZWVA 2Y99A 1I3MA 2AG8A 4BO2A 1EBFA 4CMBA 4PIVA 4G81A 4S3MA 2OBNA 2HK7A 3EAGA 1PQUA 4IINA 3ON5A 3PLRA 5IXYA 2UYYA 4I1IA 2QRLA 2Q1UA 1J49A 2FY8A 2WMDA 3ZU3A 1P31A 4IBOA 3W6ZA 3PP8A 1IUKA 5KJ1A 5TRTA 3AUUA 3PFWO 4IDEA 1I3NA 1NYTA 1LNQA 1T2AA 4FJ1A 2BFOA 4DPLA 4FFNA 3KSZO 1DRVA 2NVUA 1YWGO 4TVBA 3LT4A 4ZU3A 4CV0A 4OXKA 4M54A 1GYQA 3AI3A 3OIFA 4IDGA 2H6EA 3PHJA 4MVJM 5F5LA 2BD0A 3CPSA 1UP7A 4PRLA 5KJEA 3EK2A 5CFZA 3CUKA 4CLOA 3ZHZA 4Z9FA 1WDLA 5GZ6A 1WDKA 2BGLA 4RV9A 5L7YA 1GUZA 4OXNA 3AI2A 3BMCA 4BGIA 5IXSA 1GD1O 3NEPX 1YXMA 4IJUA 1ZO8A 2GNAA 2I9PA 2IYPA 2WDZA 3SJ7A 5KVSA 2GGSA 4UVIA 2Y1GA 3WGYA 3JQFA 2RAFA 4BNMA 2JHGA 5JMPA 2YHIA 3DL2A 1PJBA 2O48X 3ETDA 4YT5A 4Z9YA 1G6KA 4WOJA 4P38A 3JYOA 3M1AA 5ENDA 4EEXA 1OI7A 3I9LA 2FRDA 2I67A 4LSWA 4C7KA 4YT2A 3I3OA 4NBRA 3SC4A 2D4AA 2FMUA 4L9RA 1T4BA 1IB6A 3NGLA 1R0KA 4LVUA 3TWOA 1XQ6A 1JKJA 2ZYDA 4OO3A 4RDIA 1NTOA 1ADCA 3AY6A 4MOWA 1W4ZA 1I33A 4AVYA 4NBUA 3ZV3A 1DEHA 1HYHA 2X5OA 4CM7A 3WMXA 5LDHA 4WPGA 4RLHA 4OHUA 3VZQA 5T57A 3OMLA 5TT0A 1E5QA 2IZZA 3ZDFA 4CLXA 1U28A 4C7JA 2EJWA 2DBVO 3JQFC 1SZJG 4OKIA 1V3UA 3DBRB 3OP4A 1Q0HA 1G0OA 3ST7A 5L7WA 5JYDA 2P9EA 5JDIA 1QV6A 2PZKA 3LF1A 2I65A 3U9LA 3ZGYA 1LDYA 3JYLA 1VI2A 4OJNA 5TJHA 2FZWA 3VZRA 3L4BA 4RVSA 4DA9A 1C3VA 3V2UA 3EVTA 1ML3A 4A10A 3CZRA 4E5KA 1D3AA 1JAXA 3DB2A 3WXBA 4BIIA 4EUHA 1LI4A 4MVJA 2YUTA 4PZEA 3AOGA 3WYEA 1ISJA 4WASA 2Y93A 4XQGA 4A2CA 1Y6JA 2J3HA 1EUDA 3TOZA 3V8BA 2X0RA 4BS9A 3F4BA 2EW2A 5BSGA 1C1XA 1KEPA 5KKCA 1PGNA 5JO0A 2V6MA 3LF2A 3B6ZA 1A27A 1E7RA 4JBHA 4FJ0A 2GSDA 1W0CA 4RPKA 4J2OA 1B3BA 2BH9A 4XD2A 3DFZA 3HHPA 2X7HA 5DCWA 4Z6KA 1LTHR 4GGOA 4II3A 5EESA 2C5AA 2ZB4A 4CMKA 4HFMA 2H1SA 4OOEA 3QVTA 4TZKA 1GQQA 4NZ9A 3L4BC 1TVEA 5L40A 4NFHA 1KETA 1BRMA 4JBGA 4R5HA 4TRNA 3CE6A 4BO4A 1I32A 4JJGA 4KQXA 2ZTUA 3LK7A 1YKFA 5A9SA 1HEUA 4YYZA 2GZ2A 1DHRA 3KXDA 1NWCA 3PDJA 4NBVA 4JJFA 4UREA 1UP6A 3L4SO 4KUGA 1XDWA 5CDGA 1EZ4A 1TA4A 2P5YA 3DWFA 1PJTA 4TKMA 2DQ4A 4XJTA 1E7QA 4IGEA 1MX3A 4WECA 3NRCA 4PFJA 2AE1A 4MIOA 3OJOA 2OORA 3P2OA 2NU7A 2E4AA 4TRJA 5EN4A 3ZHYA 2Y67A 4FPXA 5F5NA 4GMFA 3PHHA 3VOSA 2HK8A 3RKUA 4PGFA 4DYDA 2D5AA 2O3SA 3DBVO 5KOIA 5IG2A 1LDMA 3PIIA 4TZTA 3GGGA 3JQAD 1X15A 1O95A 1VC2A 3PIDA 4YACA 2P2SA 1YB5A 1DC6A 4CQMB 2YFHA 3GRKA 1RPNA 1Y5MA 2HKIA 3T7CA 3NTRA 3HDHA 2NTJA 1YQDA 1ZJYA 1UAYA 3KEOA 1EQUA 3MEQA 4XEHA 1PJSA 2DUUA 4E5PA 1NFFA 6LDHA 1U3UA 4F46A 2Z1NA 2JCXA 3WWZA 1A7KA 4KUHA 1MC4A 5I7SA 3ICCA 1R0LA 2X0IA 2ZKLA 3KB6A 2WE8A 2VQ3A 4XIJA 5DF1A 4Z3DA 3RJ9A 1CYDA 4R9RA 3ETEA 4OQYA 5L95A 1PR3A 5EQFA 4IDAA 1WPQA 1LRKA 4YRAA 5FWNA 2B69A 1TI7A 2TMGA 3G1UA 4JP2A 4XDYA 3GQVA 3CXRA 5I7VA 3C85A 4D0SA 5HTOA 1AHHA 2WTBA 3GAZA 2PZJA 4E12A 5HRUA 4CLDA 1HDCA 1PJ3A 5LDGA 3WIDA 5B4VA 1P0FA 1IPEA 1LQUA 3C7CB 3DHYA 2A92A 3V5NA 2DM6A 2C07A 4EJMA 4W82A 3QWIA 4NDNE 4PG6A 4JJIA 3I4FA 2DUWA 4IM7A 4O0LA 5IDWA 2X0JA 2HLPA 4YJFB 3UUWA 3ZH2A 1UJMA 3K31A 1M66A 1PWXA 2GN6A 4NH4A 3UF0A 1EMDA 3GNTA 3P19A 3UGKA 2DFVA 3PJGA 4B8ZA 3D1LA 3AOEA 5F1OA 3NTQA 3RIHA 3GHYA 3TF5A 1GUYA 3DMTA 3BXXA 4IDCA 2G82A 5CPFA 4E2WA 1ZK2A 2IZ1A 3SXPA 4J4TA 2PH5A 4Z0HO 3B1KA 4UEOA 1FJHA 2B35A 4RF4A 5CHEA 2ZTVA 4EI2A 1Z82A 3KUXA 4YQYA 2HUNA 1GV1A 1NBOA 1P3DA 1Z7BA 1ID1A 1XR3A 2E6UX 3AK4A 3ADOA 4WK6A 3I9OA 1U2GA 5HBRA 3PQEA 3UCEA 4E32A 4PLFA 1DPGA 1M67A 4IJVA 3JQCA 4ALJA 3ITDA 4I5EA 1PWZA 4HNHA 3V1TC 4NBWA 1V6AA 1VM6A 3GGOA 5CDUA 5L9AA 4OH1A 5JAMA 2XAAA 1PS9A 4CLEA 3VPGA 1KOLA 1P9LA 1BG6A 1VL0A 3BMQB 3FI9A 1SAYA 3D4OA 4EZBA 2VHYA 7ADHA 1L7DA 1R12A 3K96A 4N54A 3ZW9A 3AOEC 3SVTA 4XYLA 3O03A 4UUNA 2V6BA 4CR7A 3DMTC 2PD3A 1NQTA 3NJ4A 2FR1A 4WCDA 2Z5LA 4RGBA 3RFXA 4NFSA 1ZH8A 3R6DA 3EVNA 2B5WA 2VZ8A 1V35A 3BAZA 2X58A 3DOJA 1ULUA 1NX6A 1RM5A 1HTBA 5JPIA 1SC6A 3GDOA 1C1DB 3H9JA 4BO5A 4ID9A 1KEUA 2Y0CA 2GDZA 3QVOA 4WNIA 5KKAA 5A4DA 1GCOA 3ZV6A 5TGDA 3E6AA 3QQPA 3WLEA 3P2YA 2ZQYA 5G4LA 2RH4A 1I2BA 2VWQA 2A9FA 2Y05A 1BDMA 1ISIA 3HDJA 1EUZA 5THQA 1VJ1A 1PQWA 4O6VA 3B1FA 1LX6A 5A9TA 3H9EO 4YJFA 4PRKA 3QW2A 2VTDA 4GVLA 2HCTA 3LYLA 4G5HA 2ZCUA 5EIOA 3QA9A 1Y9AA 3PWKA 1MP0A 3DBHB 3ZN2A 3BHMA 5G2OA 3FBGA 1TEHA 2JJYA 1LSSA 1GZ6A 1EQ2A 4OSOA 1PEDA 4DXHA 3D7LA 4I9UA 3TL3A 3HNPA 4CMIB 2JD1A 4GMGA 4OQZA 3A4VA 3LZ6A 2J5QA 1N8KA 4R01A 2WWRA 1QORA 4RO0A 4QX6A 2JFGA 3H7AA 4CL3A 1KS9A 3OICA 4J1SA 4OYRA 3LU1A 1I01A 1WLYA 3RFTA 3ETGA 4FN4A 1DIAA 5L4NA 4CMHA 2C0CA 2HMWA 2DPHA 3TSCA 3RUAA 1ENZA 1NPYA 3JD0A 4AJ2A 3W6UA 4DIFA 5EJ2A 3OIGA 4Q3DA 5GZ1A 3AY3A 2F1KA 2QQ5A 1F8GA 3QWAA 4FFMA 1U3VA 3BMQA 4GX2A 4CLRB 5G0SA 4BKUA 4YAKA 5T67A 1W73A 2DKNA 2F00A 4DMLA 5A02A 2HMSA 5G4KB 3GY0A 3NKLA 1XA0A 3EDMA 4GWKA 2QG4A 4MVJI 3I9NA 2WSBA 4XX0A 4I9NA 4FIZA 4R54A 2VCYA 1BVRA 2ZTLA 4BNTA 2AEFA 3KLPX 4CM8B 1X7HA 1XIVA 1Y9EA 1W6UA 3QHAA 2ZYAA 1GDHA 2OFPA 4DPKA 3SJUA 1NVMB 4NI5A 4NK5A 3VZPA 1C1DA 1HLDA 4J1NA 2VHZA 4BO9A 4BNGA 4HY3A 3X2FA 3U5TA 4K6FA 2VT3A 2YFQA 5GMOA 4DC0A 4R1SA 3W4JA 3GVCA 5BR7A 1AN9A 5IN4A 2PA3A 1B8UA 2QHXA 1LDEA 3NV9A 3S2IA 1Q2XA 3AWDA 4HWKA 4E2XA 5ILGA 3BHIA 3IKVA 1H5QA 4FQ8A 3FSRA 5JS6A 4P22A 4NQZA 4B4OA 1YB1A 2NNLD 1G1AA 2W8ZA 4RVFA 3VDRA 1Q0QA 4UEKA 3LSYA 2PNFA 4YJHA 2FWMX 1JWAB 3PYLA 1XKQA 2Y1DA 3GPIA 3Q11A 3DBHA 4NHEA 4X54A 5ENVA 4W7IA 2O4CA 1T24A 2GASA 3RUCA 3PXXA 5DP1A 3ZWPA 4D7AA 5IJZA 1GV0A 3GR6A 1QXSA 3I83A 2HRBA 4L0QA 2C2YA 4CL8A 1DJNA 1GYRA 2NM0A 1OBFO 4CMIA 1GTMA 2JHFA 1KVUA 3HE3A 4BMSA 2UUPA 2DAPA 2P4QA 3GEDA 4UVHA 3OJEA 2IE0A 4WEQA 4Q3AA 1B14A 3D4NA 3CSDA 2V65A 3D64A 3DONA 2VHXA 4PLGA 3DZFA 4ZN6A 3WSVA 4W6ZA 2Y68A 1P1IA 4TRMA 4WUVA 3PJFA 1NM5A 1YQXA 5A06A 5C5IA 1HSZA 3ENKA 3ULKA 1NVTA 6ADHA 3GC6A 1VKNA 4BGVA 3RROA 2X0NA 1VE9A 1DOHA 1MXHA 4J9VA 1YO6A 3FTPA 3E5RA 4IMPA 1XHLA 4YR9A 4CLRA 1CJCA 3Q6IA 3TZ6A 3GMSA 4RPHA 1A71A 1R6DA 1TT7A 2PWZA 4MKZA 2NACA 5ICSA 3ROMA 5KNLA 3E03A 4N5NA 1KYQA 1ZK0A 3B1JA 2JAPA 4O1MA 3C1AA 2W2LD 4ITUA 1M6HA 1HDOA 2D1YA 4MP6A 1DLIA 1P74A 4AJJA 5C37A 3X2EA 8LDHA 1R4MB 3AJRA 3E48A 2YHUA 3RUEA 1WNTA 3RKRA 1P1FA 4YAJA 1DFGA 1SCUA 2XF8A 3PI7A 4YAGA 3LQFA 2Q50A 5C3MA 4CMJA 3KETA 2C7GA 2O3JA 4L75A 4PG8A 1RKXA 3INGA 4MVJD 2AMFA 3VKVA 3FNHA 4YVFA 4LCJA 3JCZA 4O63O 1ZIDA 3F4LA 1O8CA 2EP7A 1IL0A 3ZHBA 3A1NA 1WZIA 1P1HA 4XKJA 1R0SA 1YRLA 2DBQA 2AA3A 2PGDA 3ROQA 1NR1A 2X5JO 3K9QO 1H94A 4H7PA 5DNAA 3RJ5A 4WCFB 2A35A 3P5SA 5F21A 5LCXA 1UXKA 1KVRA 2CVQA 5A3VA 4RVUA 4CLHA 2DTEA 3S2GA 5A5EA 4TQGA 2HSDA 4FJ2A 4XQEA 1QKIA 2X9GA 3WGOA 1LU9A 4CJXA 3T4EA 1LSJA 1SEPA 2ZIZA 3U0BA 2TMDA 2LDXA 4MP3A 4UUPA 2CSUA 3ZCXA 4TSKA 3JD3A 4AJPA 4AJEA 3IQDB 4YJDA 4YT4A 1ZCJA 2PH3A 4HP8A 3OIDA 3I4CA 3WGQA 1OOEA 4BNNA 4RF2A 2Q1SA 1DRWA 1PL6A 1FF9A 1VL6A 4EYEA 1RM0A 5DULA 4B4VA 3IC5A 1LLCA 4GVXA 4XJSA 5A5FA 1R66A 4XR4A 5JNLA 1UR5A 4MVJP 3E18A 3TL2A 1T2EA 4R41A 2QYSA 3IP3A 4JGBA 3IUSA 3WQRA 3WNVA 4CMAA 1A5ZA 3ZWOA 3PZBA 4F45A 3O9ZA 1ZKMA 5JAZA 4E2YA 4J4BA 5IZCA 4MVJE 4YCAA 3TZKA 4N18A 3GGPA 1YJ8A 1LC0A 1PSDA 4HX5A 5DOVA 2WEKA 2P68A 4BB6A 3TPCA 4CR8A 1SB9A 3H9UA 1RM4A 1R4MA 1ZMTA 3PDUA 4YRDA 2DC1A 4YT8A 1C14A 3TZQA 5U9CA 4FR5A 4MVJG 3WGZA 3WGTA 4PLZA 2CVOA 1PTJA 4WGGA 4XGIA 4Z9XA 1DC3A 3QP9A 1ZSYA 2BMAA 1P45A 1P1KA 1DRUA 2D2IA 3OFSA 2DPGA 4A7PA 4TVOA 4UAGA 4H3VA 2PKRA 4J7UA 1HDZA 1CETA 3GVHA 3WBFA 5DOZA 5KVVA 5H83A 2G1UA 3SLGA 3ZWYA 2XXBA 5K9ZA 1HYEA 2BLLA 4J4HA 1KVSA 1E3EA 1ZZEA 2FSVA 3EGOA 5JC8A 4LN1A 4XRRA 3WQSB 5IZCC 1NFRA 4WCFA 2GN9A 3AFMA 4RVHA 4J7XA 4R68A 4M49A 2Q2QA 1B0AA 5H82A 4BO8A 2ZB7A 3HB4X 2ZJ0A 5COBA 2FOIA 3IP1A 4FBGA 3CZMA 2VRCA 4QFCA 1ULSA 4ESOA 2X86A 1N2SA 3GA0A 3RUDA 1ZW1A 2NQ8A 3RSHA 4HADA 5DZSA 1DBVO 3TZCA 1T2CA 1YVEI 1P33A 3NT5A 3EYWA 3ROPA 1HF3A 4LRSB 2EW8A 2OO5A 4B3JA 3KTDA 4JROA 3Q2KA 4AJHA 2R2GA 4AJKA 2VYNA 1UZMA 3RU7A 4CM9A 4R3NA 1PZFA 2E37A 2C20A 1T25A 4BNVA 3DAPA 5L4LA 1YL5A 2FR8A 2X23A 4HFJA 2G76A 3S2EA 1CWUA 4YWJA 2CUKA 4B4WA 4CPDA 4DQXA 3KSDO 4WCFC 4YRBA 1U8FO 4XQ9A 5L51A 5JFOA 3I6QA 4AFNA 3AM5A 5TLSA 5KWEA 4CV1A 1N1EA 2AQ8A 2XOXA 2PGLA 3BZUA 4E13A 4NU5A 1KERA 4PLPA 4TKLA 3W8EA 2NUAA 1ADFA 1F14A 3I6IA 3QE3A 4J7CA 1YONA 1PX0A 3PVZA 2Q45A 2ZQZA 2CDBA 4IZIA 2JAHA 1KEVA 1ZK1A 3D0OA 1QLHA 5JMWA 3G1TA 4GAEA 4IQ8A 1WP4A 4DREA 2HK9A 4E5MA 1I10A 1S6YA 3RC9A 5CDYA 3WOHA 3UXYA 5KTKA 5I8WA 3L6DA 2H63A 3WYBA 5T6BA 2ZJ1A 2YV1A 3LVFO 4R1TA 4ND3A 2JKVA 2PZMA 1ARZA 4FW8A 4BKOA 4D3FA 2FPPA 3OEYA 1HWYA 4GKVA 5G0TA 1DHTA 3L6EA 3IL2A 3ZU5A 3ZWWA 4XYBA 1QYDA 3PHLA 4J3FA 3M2TA 1E0DA 1VSUA 4E4YA 1K6IA 1FXSA 3H5RA 1WDMA 2C2XA 1G0NA 1UP4A 3VTFA 4CV3A 5KJFA 3NYWA 1M75A 4Z0PA 2Q49A 1K5HA 3GPDG 4FOOA 4ZQEA 2A94A 1IYZA 2V6GA 3R3SA 1N1GA 4G65A 1E3SA 4RJTA 1AGNA 2GF2A 2Q2WA 5ES3A 2AHRA 3OQ6A 4A0SA 2PD4A 4E5YA 4BMNA 2JL1A 1ZEJA 3GK3A 1E1LA 3L6OO 1ONNA 4ALLA 3IKTA 1LDNA 2X4GA 4IS2A 3G49A 3I23A 1EE9A 3GG9A 4FD3A 1CQIA 3JD2A 3SBOA 1E1NA 1ZMOA 2BI7A 4KTTE 1PZGA 3WNQA 1CEQA 3WS7A 2BF7A 1ONPA 3VKUA 4EJ0A 2DBRA 2EKQA 2WYWA 2VOEA 5JY6A 4MKRA 3CKYA 4BNFA 2Z1MA 4EEZA 3PLNA 3Q0EA 2Y1OA 1Z75A 3H5NA 4IJWA 4MJLA 3UH1A 3ABIA 3ITKA 1HDGO 7MDHA 3OHSX 4CM4B 2PR2A 5EL0A 3UCXA 3NTOA 4LISA 2NU6A 1UAGA 3GF4A 1JU9A 2OP0A 4BQRA 4YEDA 4BMVA 1ZK4A 3A06A 1BVUA 2WM3A 1YE3A 1KVQA 4OAQA 2B5VA 2VNAA 3DBRA 4FCCA 4I5DA 3ZU4A 1KY4A 3TDKA 1UXGA 2YYYA 3WQQA 4D45A 5CG2A 4P8RA 4R1UA 1BWSA 4DC1A 4WLOA 2AXQA 4QO7A 1RWBA 3LLVA 4IY1A 3OETA 3O26A 1N9GB 4ALMA 2IODA 4YB8A 3RI3A 4BV8A 2RIRA 1DFIA 2AW5A 4WLEA 3EY4A 4WJZA 1B3RA 1JQBA 1WVGA 2UV8A 3H6KA 1GPDG 1YBMA 1Z7EA 4J6FA 1DC4A 1I2CA 2NSDA 3WTBA 2CFCA 1E7WA 3OSUA 1F8FA 2NV6A 3QJ5A 4RF5A 1HDRA 4A03A 4W99A 4U0JA 3HADA 3WGGA 1IHYA 3RWBA 4DIBA 3UCFA 2VHVA 3TRIA 4L76A 4JBIA 5G0VA 3FNFA 4DPMA 4A5OA 3D3WB 4OSPA 2O23A 2WD8A 2HMTA 4WNCA 3BA1A 1OC4A 4J16A 2AQHA 1RYDA 4A27A 3RVDA 2IYOA 2YV3A 3HDQA 3U4HA 4EDFA 3MOGA 2H5LA 5F1PA 4PLYA 3RC1A 4OM8A 4IIUA 4GPD1 2PY6A 2I6TA 5BNTA 1I30A 1PGOA 5IN5A 3W4KA 3GN1A 5BNIA 1XYGA 3RQSA 5DN9A 3FD8A 4UUMA 1I0ZA 3EMKA 3UVEA 4MVJF 3L77A 4PVDA 3WG9A 4B79A 4M55A 2P9GA 4U6QA 5HS6A 2GR9A 5B4TA 1BGVA 3WJ7A 1BW9B 2EP5A 3DOCA 1DIBA 1FDUA 3TFOA 1UDAA 5AYVA 3EZLA 5A03A 1QMGA 4JK3A 5I8ZA 2YV2A 1U4SA 3WICA 4CM4A 3I1JA 3R0IA 5GZ3A 1W8DA 2PD6A 2HJSA 3ADPA 2J8ZA 4J1TA 3C8MA 4MDHA 4FGSA 5KIAA 3U4IA 1BSVA 1EVIA 4CMEA 3FN4A 4KTVE 3UFXA 4FB5A 4PLHA 1CIVA 4BO7A 1K89A 3ZNPA 2OBYA 1JKIA 4I5FA 3RAJA 4CQMA 3AFNA 4RVDA 3GZNB 4XRGA 1LLQA 1N9GA 5JCJA 3DO5A 1E6WA 1SPXA 1LRLA 5IAAA 4IXWA 2H9IA 2X6TA 3H3JA 5AXDA 1F0YA 2EERA 1X14A 4Q9NA 1A4UA 4K26A 1NR7A 2EJVA 2O7QA 4E31A 4GGPA 5I7EA 4TWRA 2RBEA 4KOAA 4DRYA 1L1FA 3GDGA 2DT5A 4Q3EA 4BV9A 3VPHA 1UDBA 5I9LA 1EK6A 1I5RA 1O6ZA 4ZICA 2AEJA 1X13A 5TF4A 3HDYA 5COAA 1PJ2A 2X9VA 4BNUA 1I3LA 4CMEC 3INTA 1DB3A 3GNSA 1Z73A 3D3WA 1LEHA 3UOGA 1E6EA 1TB4A 3Q1LA 4LSMA 4UVGA 1IZ0A 3DZHA 1YOVB 1EFKA 4XCVA 3VH1A 3EHEA 2QZZA 2QRJA 4F6LA 2OL4A 1F17A 1GZ3A 1O0SA 4R51A 4DLBA 2QX7A 1HZZA 5DCYA 3N7UA 2PTGA 2EHDA 3NT2A 3EC7A 1PZEA 3SEFA 4B4UA 2I3GA 1JVSA 2NWQA 1QR6A 4IUYA 3A28A 2G5CA 2FZEA 1H2HA 2EV9A 4IQGA 3WB9A 2W90A 4HBGA 3I9JA 4CM1A 1E92A 4DIOA 3M1LA 5KVQA 5DDIP 1LBEA 1YL6A 4ZD6A 2RH8A 3GUYA 3G0OA 1ZFNA 2O7SA 3MJEA 2ZB8A 4WLNA 3WYCA 4PZDA 2GZ3A 1BW9A 1DC5A 1N7GA 3KVOA 1AXGA 2QIOA 1NP3A 5K6AA 2BI8A 4RL6A 2CMDA 3DZIA 3ASVA 5HS4A 2VUTA 1X0XA 4J90A 3VVBA 2P91A 2CDCA 1VKOA 1KEWA 1HETA 4GSLA 3E9MA 3CIFA 3PYXA 4PVCA 2VTEA 5C7IO 4P4LA 1A72A 3JQ9A 2UUOA 2JD0A 3ZZNA 5JO9A 4E21A 1LSOA 3OF2A 5FI5A 2BHLA 3L0DA 3A9WA 3CEAA 1LLUA 3OEWA 2FP4A 3C24A 1MA0A 4Y98A 4LMRA 4C4OA 1WWKA 1HXHA 4FFPA 1SOVA 1Q7GA 4BNYA 3BTSA 1DJQA 2AQKA 4R1NA 4GX1A 5EPOA 1ZNQO 3DQPA 3LT0A 4PG5A 2FPIA 2G0TA 3DR3A 4DTIA 3NDJA 1R37A 3O38A 1H6DA 1NWHA 4L4SA 2J3KA 4K9DA 5K6AC 4FFRA 1NHWA 3PGJA 5BT9A 5T8KA 3ICPA 3GDFA 4WLVA 3G17A 4R69A 4PCVA 3GVXA 2WE7A 1KC1A 5G0UA 3W8DA 2VZ0A 2ZATA 5DBGA 5MDHA 5IDQA 4FC6A 1A7AA 3E9QA 3IJPA 3ZHXA 3AUAA 3C1TA 3FF4A 2XXJA 4INAA 3JQ9C 2X22A 3HSKA 3OQ1A 3DZBA 4GI2A 4TROA 3RBVA 1YOVA 3FBTA 4QQRA 4ROSA 5BSEA 2R6JA 5CEJA 3JQ7B 3OJLA 1GL3A 2QRKA 5BSHA 2VUSA 1E5LA 1DDOA 3U62A 3MTGA 3T7EA 3Q2IA 3UICA 4FS3A 4UUOA 1OAAA 2O3RA 2I99A 1U3WA 3QWHA 3F5QA 5B1YA 1FDVA 4ALNA 4QFDA 2NTVA 3W4IA 3HJAA 1E1MA 5ER6A 3AY7A 4GX0A 5T8KC 4ZQGA 4R16A 2BELA 3KSUA 3FNGA 3KYCB 4IS3A 3UN1A 4BNLA 5HWSA 5TIIA 3AM4A 3HFGA 3WR5A 1C0LA 3E5MA 1P1JA 1ENYA 1NVGA 4LVCA 3KEQA 3TN7A 3W8FA 1LDGA 4IDDA 3WLFA 3JYNA 2HMUA 3PGXA 1HLPA 4B3HA 3ZWAA 4PG7A 1BMDA 1XSEA 5U4QA 3ROKA 3DC2A 3DDNA 4HNGA 1HDYA 1YDWA 1N5DA 4U0KA 5AOVA 3HFSA 4AJ4A 3QVSA 5CEFA 2RCYA 4J9UE 1T1SA 4RQUA 5G0WA 3L07A 3F46A 3PK0A 2Q1TA 2EKLA 4BGUA 2XPCA 1VJ0A 4IQ0A 2VYND 4IJKA 2QYTA 4CM9D 5DBIA 5B12A 1UZLA 4HFNA 5JDCA 4L4RA 3Q9UA 4II2A 1QLJA 1H6CA 2VRBA 4MINA 4XYMA 2POQX 3RCBA 4KWHA 1EVJA 1BXKA 5G4KA 4CR6A 3AUSA 3DZGA 1GEGA 3GVPA 4DL9A 1U2DA 4MIEA 2W2KB 5EQDA 3IIEA 1Z45A 3JTMA 4J91A 2RHRA 3U4CA 4I08A 4CM8A 5ITWA 4NR0A 4GX5A 3MJVA 4YQZA 5DT9A 4LGVA 3DMYA 4I9HA 4E33A 3BTOA 1HL3A 2FPGA 4O5OA 1D1SA 3H4VA 4AJ1A 1VSVA 3PZRA 5IDYA 2J3JA 3DAGA 4IGFA 3WGHA 5JYEA 3ANLA 3E8XA 5CG1A 2DVMA 2X5KO 2LDBA 2IXAA 1MXFA 5JDCC 4OMUA 1RJWA 1MG0A 2FHSA 4FGWA 1DIGA 3JQ7A 2QZ9A 3JQ8B 4CUZA 1XLTA 4M8SA 5EERA 1ZVMA 3PPIA 1Z6ZA 2O3QA 2NLOA 4PZCA 1HE2A 3ZNNA 1EFLA 3F6YA 1M2WA 4YBZA 4D3SA 1QYCA 1PR9A 1XU7A 2C5EA 2DBZA 3MJCA 2ZB3A 1N7HA 3T4XA 1KC3A 3IJRA 2DTDA 3NAQA 3WGIA 3MZ0A 1B15A 3QIVA 2YW9A 1Y7TA 3HN7A 4G2NA 3KYCA 1JW9B 4IDFA 1KY5A 4RQTA 3OJFA 5KVCA 1LXCA 5THKA 1K2WA 5AXAA 3QRWA 2GUGA 2BKAA 4PLTA 2VN8A 3PHGA 2I76A 4B3IA 4CLOB 3AUTA 3FPLA 3NJ8A 4E5NA 4XQCA 1P0CA 1ZXLA 2C82A 4HV4A 3VZSA 4F3YA 5AQ1A 4BNZA 1NAHA 2Y0EA 3I9KA 2WYUA 4XGNA 1U4OA 4CV2A 3DEYX 1EDZA 3CH6A 3TQHA 2W98A 1LUAA 4ND1A 2PZLA 2D5CA 1PGJA 1HZJA 2YHIB 2X1HA 4J49A 1WMAA 2EIHA 2FR0A 3KV3O 3RFVA 1YJQA 3MWDB 4RCVA 3QSGA 2HMVA 3RC2A 3WFJA 2HU2A 3ZWNA 4XB2A 1EEHA 4J0FA 3V2GA 1DFHA 1X7GA 5H81A 3UKOA 1PJCA 2GD1O 4ALIA 4NU6A 3MWEB 2UDPA 3GHHA 3JD1A 3RBZA 4XYEA 4N7RA 5JW6A 3HN2A 5L4SA 3V2HA 1J5PA 3KZVA 2PLAA 5F1KA 4BHTA 4GLLA 3TOXA 3ZU2A 1CERA 4GKBA 4GSKA 2Q2VA 3ONDA 5FYDA 5HM8A 2W2KA 2O2YA 3U3XA 1ISHA 1ISFA 3DBLB 1JTVA 1I2ZA 5FF9A 1PS8A 2ZYGA 3BYZA 2VYVA 3K5PA 3KLMX 3NGXA 1MUUA 2C7VA 3CMMA 5BQFA 3IMFA 4DUPA 1O9BA 3LLSA 4CM3A 2AEMA 4I5GA 4UULA 2WYVA 1DO8A 4F6CA 2NADA 1A9ZA 4URFA 1BHSA 2CD9A 1WXDA 3FHLA 3ONEA 3ASUA 4JIGA 3EW7A 3IOYA 1E3LA 2X9NA 1F06A 4KMSA 4ND2A 3KM0A 3RUIA 1MG5A 3JQ8A 3ZNQA 1UUFA 2GN4A 5U1PA 4CUJA 3K92A 3H9GA 4OOFA 1Z74A 1IZ9A 4IZHA 4Y9DA 1MV8A 4CMCA 3DHNA 3OQBA 5C7LO 2NVWA 1KBZA 2GERA 3D5QA 2BFMA 3QY9A 5IFLA 1UH5A 2DLDA 3VC7A 3PEFA 3G79A 4RPJA 4XIYA 1X0VA 3VH4A 1HE5A 4J43A 5TS3A 3B20A 3GFBA 1L7EA 1C1XB 8ADHA 1B8VA 2EXXA 1EVYA 3WWYA 3WMWA 2VHWA 4E6PA 1PGQA 5CDSA 1LJ8A 5T5QA 4KDEA 5IDXA 1ZSNA 3U4DA 3BTUA 4BNXA 4M87A 2EKPA 2CVZA 2B37A 1AE1A 4U5QA 1FDWA 4NJMB 5DBFA 1C0PA 1P1RA 1GCUA 5A9SB 1H9AA 3O4RA 3FR7A 4ZGWA 1E6UA 4FFOA 3GMDA 1TLTA 4Z0TA 5CDTA 4EGFA 4E3ZA 1PU2A 1PL7A 3ENNA 3AU8A 2YY7A 1NXQA 4BNJA 3N74A 4AJIA 4FDAA 1U9JA 2HO5A 1C0KA 1IULA 1Q0LA 4YJGB 1ORRA 1ZSVA 5I9MA 1V3TA 1EE2A 4NK4A 3SX2A 1TT5B 4ZRNA 3JYPA 2YZ7A 1MFPA 3WJAA 1Y81A 3DBLA 4WLFA 4XWYA 1GFSA 4CQMD 4P4GA 2WD7B 1QYWA 4KQWA 4OIMA 4TMFA 5J23A 4MIYA 1GYPA 1HE4A 1T2FA 1LC3A 4PN3A 3PWSA 2E48A 1S7CA 5JCJD 1PZHA 1YQGA 4L4XA 1AXEA 3RC7A 3BMNB 1ISMA 1VL8A 1MC5A 4JLWA 1FDTA 2CZCA 1XU9A 4P4NA 4D44A 3RBXA 3Q9NA 4NNJA 1JDJA 2AQIA 2W2LA 4BNWA 4E0BA 4BOYA 1PGPA 1U5CA 1JLLA 1V9LA 3JQGB 4ZVVA 4CM6A 2YQ4A 5FFFA 1U3TA 1N92A 3QLJA 4UEJA 1X1TA 2AE2A 4RVGA 1ONOA 5JAIA 2B83A 2VOJA 2IXBA 5EINA 2Q99A 4AICA 1T4DA 3G3EA 3DZJA 4QXMA 2I3AA 2CF5A 1ADGA 1IOLA 1U5AA 2HQ1A 2IEBA 4CMGA 1ZXBA 4OGWA 2HRZA 2CY0A 4CODB 3NUGA 1UXJA 4IDBA 3L9WA 4D0RA 3JQEA 3UW3A 4H16A 2J3IA 3C1OA 4J0EA 1M6WA 5JDIC 1ADBA 3F9IA 3KBOA 1DLJA 3IUPA 4ONEA 4PLWA 4BB5A 3I5MA 4HXYA 4RF3A 1GY8A 1DSSG 2B0JA 2RHCA 2NU8A 4DLLA 4DGSA 1YBVA 3TFQA 1X1EA 1YS4A 3QWFA 2NU9A 4AG3A 1ENPA 4NJMA 1I36A 3GOHA 4PLCA 4ZJUA 1OFGA 3QWBA 3DXFA 4YDRA 3ZW8A 2JCVA 1LLDA 4BL5A 3K6JA 1E3JA 1QRRA 4ZQHA 4J1QA 1EBUA 1XCBA 3H5AA 4BO1A 4YAIA 4DYVA 5CEEA 5EMHA 3EZYA 1SO8A 2ET6A 4ZQBA 5AXBA 3MJSA 4YJGA 1D7OA 5A04A 3C3XA 4JNKA 3VHRA 2EG9A 2V7PA 3BMOB 4KWIA 5ICMA 1M76A 1TT5A 3KOUA 3IAHA 3ORFA 1H6BA 2WD7A 3IS3A 3WX0A 1VJTA 2GPTA 3F1LA 3JQBA 5FI3A 5BNFA 1UDCA 4EUFA 1E1KA 3KRTA 1E3WB 3KYDB 1XGKA 3BMNA 3K73O 4KP7A 1Y1PA 1U7HA 2JD2A 2CNBA 1GUFA 3GN2A 2I5PO 3WTCA 5A1TA 1IY8A 4DBVO 1MB4A 2GO1A 1NQOA 4Y8VA 3JQGA 3H65A 1ISGA 1Q7CA 3DHEA 2EEZA 4WOKA 2EWMA 4QEDA 3SC6A 3OJ0A 4MPDA 4U7WA 5COQA 1B8PA 1PL8A 4D46A 2A4KA 2B36A 1EK5A 3FWZA 4KZPA 2P5UA 4IMRA 3V1YA 3GAFA 4QT0A 3OBBA 1QV7A 5ILOA 4JXKA 4YTEA 3TZHA 3U49A 3D4PA 3F5SA 4R5MA 3ZWXA 4U6SA 1U8XX 4QUKA 3JQBC 3R1IA 4RDHA 4O59O 4DQVA 1K6XA 1J4AA 1PJQA 1YBAA 5HA5A 2P4HX 1A9YA 1R16A 2YDXA 4CUKA 5A9RA 5JSFA 1SOWA 3AM3A 3RUFA 2IEDA 4I8XA 4B7CA 3PWZA 3CTMA 4OL9A 2O2SA 4Q3NA 3DOOA 2JCYA 2R00A 4HFRA 4E30A 1BXGB 4UVEA 4Y6SA 2NVBA 5JLAA 4BNIA 1WMBA 2UVDA 3NDRA 5TT1A 5B37A 3VPFA 1DXYA 1PQPA 2ZTMA 5B4UA 4A26A 1V3VA 2BGKA 4FFLA 3GZ4A 3LC1O 1XEAA 4XA8A 5TSDA 1D1TA 1GU7A 2HDHA 4OXYA 4YAEA 5JE8A 4MO2A 1XWFA 1YGYA 2PFGA 1SB8A 4K6CA 4N5MA 1KVTA 4LRTB 1QYXA 1TXGA 2C29D 3C7DB 4BKQA 4EJ6A 5LC1A 1O89A 2PKQO 3INRA 5I7FA 3KHUA 3ZNOA 1IE3A 1NAIA 3ONFA 4IPTA 4S1VA 4W7HA 5A05A 3I9MA 1C0IA 1HDXA 2EGGA 1SEVA 4H15A 3BMOA 1NPTO 3GRPA 4M89A 4EITA 4BO0A 4RZHA 2VWGA 5JXWA 4YPOA 4QECA 2R00C 1UXHA 1GQYA 2Y1FA 4WLUA 1P44A 3JQAB 1FMCA 1E3WA 1LA2A 1D8AA 3KYDA 1B26A 2ZCVA 3I52A 1QSGA 1HRDA
chains in the Genus database with same CATH superfamily
2BF4A 2AG5A 3FYTA 2Q9BA 4HL6A 4TMKA 4L74A 4OQMA 3VYTB 1PFGA 1DIHA 1PSZA 2FUNB 1UOEA 2Y1EA 4LYGA 4RGQA 4MUEA 1GPBA 2WJ3A 5BV0A 3EQ9A 1HQYE 5EE0A 3FH0A 3T3MB 1GDDA 3AU9A 3LX8A 1OH7A 4HAVA 1WJGA 1ZLXA 3A26A 4W9NA 1L4MA 1U0SY 2BGMA 2P2YA 1SQGA 1MQAA 1EZ1A 2Z95A 4IYRA 3HUDA 1WW2A 3CT6A 4CI0B 2QW1A 5KOJA 2O3UA 4KCGA 1AF4A 5FLKA 5HK8A 4UM7A 3CUUA 2FETA 5CBKA 1OC2A 3EGXB 1I80A 4IH9A 3NV7A 4LDAA 5H0IA 1M2OA 1I4EB 2QMUA 1Y4ZA 4OBEA 2AF3C 4UHFA 1PJLA 1N4AA 3GBSA 5LYJB 1U7UA 2W4QA 2TECE 1UXIA 3BH7A 5GM2A 3L4KA 2IQ5A 3BM5A 1IBRA 3HQ4O 4WCVA 2AKEA 4ME6A 1UC4B 2D0IA 2YIJA 2PV7A 2CYBA 3BTVA 4JGGA 2WFLA 4V1CA 4X6XA 1GZ4A 1YS2X 2ODPA 5G1NA 3TW6A 3VH2A 4E51A 5JZOA 1CZHA 3CRVA 3MM4A 3H8VA 1BXGA 4JIMA 4AWBA 4G9EA 1JR4A 4JLVA 1ZUD1 3ZWCA 1XTBA 2CBXA 1ZEMA 4JWTA 4LDPA 3DFUA 3I9V6 4N6GA 4UUBA 5D6OA 1CJBA 1AS3A 5CK4A 1F3LA 1RAAA 2E82A 3QXXA 2FUG1 4B7XA 3K9WA 5CVVA 3KEMA 4WXHA 1JDSA 1LF0A 3FOAA 5REQA 3PYMA 2GZHA 1GPKA 2QW8A 3B70A 5B7QA 1BEUB 1SVSA 1H2RS 3GLQA 2NTNA 4UQLA 3O4JA 3RVBA 1Q20A 3AUKA 3PHIA 3BJZA 1VHLA 4KLRA 1XMXA 1RQ7A 1XZQA 4ECEA 3ZV4A 1U6KA 1WKBA 4ILKA 4M9UA 1RWNA 2IVFA 4UVDA 4BPRA 4BO6A 1DQPA 2ZDGA 3WGMA 2QIPA 2WLSA 1Q1NA 1TIPA 5DP2A 1G20A 3DMRA 4CGZA 1TKBA 3GZNA 4IFTA 4OK6A 3WVNA 4YUAA 4OGGA 3ZK9A 1NW5A 3CRZA 4KXWA 1PJ4A 3NFYA 1TM2A 1QOZA 1W1IA 2JH3A 4L8WB 2FLVA 3PUZA 5IJ0B 1GHTA 1Z4IA 2VRNA 5TMDA 2V7GA 4YMTA 4CTKA 5L6MB 1MFZA 4YXFA 4X62B 1VBMA 1NJSA 2WNSA 2Y2UA 4KO2S 3SYLA 1MIOB 1E18A 4NVRA 5HTKA 4CNBA 4RKWA 1QKJA 4JI5B 2RKWA 4M1QA 1CRWG 2ZXFA 3QG1A 1G2PA 1TCCA 1UL1X 4G0UA 2YCBA 1EJ0A 1HKUA 4JEUA 4ZJZA 4AMBA 2IYSA 3GVIA 1IN7A 1R2QA 1OKKD 2IU6A 2AFIE 4FHZA 4LMPA 5AJYA 3U7QA 3VPXA 2JEYA 1GDTA 4EF6A 1HT0A 4UOEA 1JJ7A 2GZ1A 2F9MA 4ZYLA 4FEEA 1DIRA 2WHPB 1IM8A 4CW7A 4D3DA 1EUCB 4F92B 2IK8A 4ZQFA 1GL9B 1SCJA 1JPUA 1JHVA 1P2DA 2WP8J 3G85A 1KEEA 3F1KA 3A1UA 5G53C 4YJ2F 3RAGA 3BIOA 3DOIA 1E5VA 4BKPA 2B4QA 2PKQP 3HBFA 1V4VA 1Z37A 2CLOB 3BRQA 3I32A 3O2QB 1ULHA 3GYBA 4L4ZA 4QBTA 4V03A 3X3HA 3KLOA 1JQ3A 4XB1A 5DHUA 4L3OA 5GJCA 3K9GA 2WTMA 4GWGA 1QO7A 2R6AA 1GAEO 2BFPA 2QMYA 3RU9A 3I5YA 5ALIA 1LV7A 1YH3A 4AIRA 3DO6A 3KKOA 2O50A 3R7FA 2CXOA 5FPQA 4U7FA 5JY1A 5KCZA 3LYHA 2Z2JA 4BGEA 3AF3A 2WVJA 3EVCA 3EWSA 3R40A 1JE1A 3I12A 3SR0A 2D3TA 1MNQA 1T8WA 1DUSA 3D02A 4OP2A 1G66A 4EAAA 1MW9X 4N3BA 2JFPA 2E21A 4Z3KA 3BWBA 1L7MA 4KE7A 1NQAO 3DP9A 2ZRBA 3ND8A 3PKIA 1FNNA 1H2BA 3BG5A 4H1WA 1GPJA 4QDXA 1Y3HA 3FHCB 3N8IA 2J0UB 3HZZA 3OE1A 3CNQS 2BKXA 3QJGA 4I46A 3P9IA 3CMCO 1VLLA 1AXRA 2VS1A 4LCEA 3OPYI 3ZE2B 1ACLA 1GADO 1LQTA 2M32A 3CF2A 4WDRA 3EZ2A 5BQ5A 4NIMA 1ZITA 2C54A 4AP5A 2GRAA 2I7DA 4ZOQI 5JAPA 1ODFA 4GL4A 4N01A 4GPZA 4QYXA 1NYRA 2WAAA 4KUEA 4NXMB 1QQAA 3VAAA 1YS7A 2B3TA 4I8DA 1Q0PA 3D7MA 1K9SA 2J67A 4WE3A 1JEQA 2MR5A 3LC2O 3NBMA 3OE7D 2NSYA 4ND5A 3CLRD 2V6FA 2H4YA 4TLEA 2C3OA 3GJSA 3R0JA 1X7DA 2DPLA 1MZPA 3JVIA 3VU3A 1CKEA 3E70C 4FW9A 4GR4A 3RHFA 2SKEA 1GNRA 3QV2A 3WWCA 1QE3A 2IDJA 1AQUA 2CKMA 3V1UA 1QP4A 3E9CA 1C7RA 2NXCA 5JSHA 4L8VA 4U2KA 2OA0A 1YZFA 3TJRA 3VYWA 1Z5NA 5KS2A 2WSYB 4KQHA 1T9BA 3T5CA 3O73A 1F38A 4AZ0A 5IFKA 1OB2A 2QRVA 2ZIUB 3FROA 4J76A 1AU9A 4NOKA 3TIIA 3KJFA 3WSWA 1NURA 3RASA 2DSTA 2GBCA 2IY9A 4GKKB 2G9QA 2IZ0A 3KUCA 2WM8A 2J1LA 3ESQA 3ACBA 4RE6A 1NW8A 3QG5A 2PJRA 1Q1GA 1KRHA 4BNDA 5BWBA 4MYSA 4H6WA 4A0FA 5KTOA 5BV2P 4I66A 3ZX5A 2FPSA 2ZWVA 3LCJA 1X7ZB 1QK4A 4HNTA 3KB2A 4QM7A 3E23A 1DX6A 1II9A 1CVIA 3CLUC 5K3SA 2GCGA 4DMCA 4S35A 1P91A 2XAUA 1XRQA 3JQ6A 2B6HA 3P96A 1XP5A 5CR9A 4LK3A 1PWHA 2GCNA 1KQPA 1QH8B 1YKGA 1V9CA 2X8JA 3FFAA 3DCNA 2WF6A 3FTCA 5CH5A 3VU0A 4D56A 2C59A 2QB5A 3QV1A 1LQ2A 4GQAA 2PUAA 3HG7A 1W5EA 1NMSA 3FVWA 5GIOE 1V1MA 3GT4A 1WA5A 4PYJA 2PUGA 1F8XA 3FCOA 1AZSC 3ZDZB 4PRYA 3EARA 2NPOA 4QZVA 2CD7A 1QTRA 1KU0A 1I24A 4YHHB 1VL1A 1BU8A 2Q1WA 2NVUB 4EYSA 2ZAOA 5IYZB 3DYVA 4CI9A 1RBMA 1ATZA 4LW8A 1LBIA 1V7QA 3VVCA 3QVWA 1VPEA 3O74A 3QVGA 3KQUA 4QO8A 1K9VF 1RVV1 4LOKA 2Y6VA 2ATXA 3GT0A 3JARB 5EUQB 3JD4A 4O4HF 4D42A 4G8CA 1VCIA 3CZPA 2VAPA 2I55A 4Q00A 4B7UA 4LYYA 4RTJA 1AF7A 2ICAA 3KYBA 4RENA 3I8XA 3GH3A 3SQNA 4ZVQA 4N47A 2RC6A 1FDRA 1Q2UA 2VZ9A 1MPXA 1FU8A 2PUTA 3KKNA 1SUSA 2VUUA 3KUDA 4KMMA 4AKSA 4B3XA 4CKBA 3IT1A 4Q3BA 1BXZA 5AXCA 2FVXA 4MCJA 2XUPA 2J5RA 1HYQA 3D1JA 2QX6A 3DE3X 1L7XA 3I6BA 3N8DA 4H7FA 5ALOA 1LRJA 4L73A 1N2CE 4DQLA 2WJPA 2ECKA 3CW8X 1IBKB 4J07A 3AVTA 1MW8X 4PONA 3CRNA 1Z0JA 1DAPA 3IXLA 4JP3A 1B0ZA 4S12A 4DZTA 2LE0A 3HPQA 4HEHA 1M6VB 1XELA 3R3ZA 2YIMA 3IILA 3R5TA 4JB2A 3E9NA 1WX1A 4M7PA 4PN7A 3RUHA 2XMBA 4XLTA 2O8FA 3EFHA 1V7PC 4KDRA 5K0LA 3QHQA 1WMFA 4KAXA 3NNSA 4DIDA 3E4DA 4XGKA 4TLDA 1E1CB 1R6UA 3SLKA 3FCXA 3W9YA 4G67A 1W19A 2XMPA 4DTCA 4MAMA 2QQ0A 4JI8B 1C8KA 3P45A 3IUBA 4GMXA 3WBBA 5A4FS 2A58A 1M34B 3CXUA 4KW7A 4FM9A 3A14A 1CSEE 3C6KA 2OV6A 1LGYA 2W6MA 4UEQA 4CRWB 8MHTA 2CMFA 3RS9A 1NMYA 2AJCA 1B7GO 1M5TA 1WZEA 3LNCA 3AEUB 4BQPA 5A3JA 4XWKA 4IIFA 5CYGA 2FSSA 4NC9A 5HPYB 2ZUWA 1O94C 3ZWVA 4X7BA 3IVCA 1EBFA 4UXJA 4CMBA 1TJ4A 3KWLA 1OUMA 1PNVA 3MERA 3OM1A 2WRZA 3EAGA 2WKWA 2ZIAA 3FLMA 3PVSA 1RXSA 2G08A 1D0IA 1HGXA 4X8LA 2F3QA 5BW5A 5AW5A 4J0KA 1EWKA 1NP7A 1KEKA 3DPSA 3L1VA 1YF3A 1J49A 2BRUC 2YH2A 3LC0A 3L8CA 3V9AA 3PIRA 3C98A 3V3TA 3PDWA 1RZRA 1IG0A 3SS7X 1ECJA 2OV1A 3G9QA 3MT7A 4IDEA 5E9AA 1LNQA 1XHFA 2QMEA 3FUCA 2ADOA 3RK0A 2RHLA 4TVBA 1XTKA 2WHQA 3CB4A 3OE4A 1HFEL 4OXKA 4CV0A 4EI9A 5EJ7A 1ULTA 2VDLB 1PKXA 1EUDB 3PHJA 3EPPA 1H5UA 5DTEA 1GXSA 1UP7A 4LJSA 5AKZA 3C6XA 2V7XA 5J2UF 4C4RA 3FY4A 1WQ1R 3MIIA 5DTMA 4JP1A 821PA 4CLOA 1FFEA 4EUNA 3MWYW 4A8JA 4B7AA 4IWXA 2XBLA 2DLNA 2GZSA 3C8UA 3GFOA 1VP3A 2PS3A 3H1FA 3NYIA 5GZ6A 4DZRA 1YVDA 3MTQA 1TPYA 1O6GA 1OGYA 2PT9A 4URWR 4OXNA 3UFBA 5LQNA 3CVUA 4V3CA 3MLBA 2C4NA 1N6HA 1GD1O 2PR7A 3BICA 3E0QA 2QSUA 1LW6E 4NL4H 4BO7A 3ERCA 3KHSA 3SXJA 2WDZA 1RWMA 3TYXA 4JQOA 3LX6A 1ND6A 1NONA 2Y1GA 2OBBA 3JQFA 2RAFA 2JHGA 3W04A 5A6SA 3CUYA 2C2KA 1YA8A 3DL2A 3Q3GE 2UUAB 2JCGA 5K4HA 2RI6A 4LXQA 4FX5A 1A7JA 4BZXA 3OMXA 2GPNA 1AGYA 2P2LA 4MO9A 4EEXA 5K4AA 4C7KA 5AVTA 3I3OA 5B58C 4DWWA 2Y71A 3LUPA 4NBRA 3EIUA 3O8OA 4WVFA 2UVPA 4YECA 5LP1A 4BY9E 3KFXA 1GGEA 1KFJB 4MYUA 4L9RA 2JF0A 1IB6A 4RY2A 4RLQA 1MO4A 4LZWA 3FFTA 4RCYA 1MRSA 2PMDA 1JKJA 1U1EA 3WAGA 2PSDA 2X9LA 4EG0A 4MOWA 4F6RA 2QUZA 1B76A 4AVYA 1I33A 1GZDA 1XX6A 5D5PA 5ENZA 3EQZA 3QPCA 3IOCA 4DLVA 3AHJA 5BN4A 1JIVA 4V0SA 2JJ2D 4OHUA 2P5SA 3LP8A 4NOMA 4P92A 1F2TA 3W5IA 3ZDFA 2XRMA 4BP1A 1T91A 4D6XA 2EJWA 2PZEA 4F2WA 3GJQA 3F9CA 2R79A 3HVKA 1V3UA 1L3IA 4OKIA 1UT5A 3WLNA 5DW0A 1W0KA 2JEZA 4TWIA 4B3SB 1G0OA 2GF9A 5JYDA 2MWMA 1R00A 3FHOA 1SVWA 3WFZA 1AKVA 3LF1A 1GLGA 1PR4A 3U9LA 3VAYA 2VCEA 3VBCA 1JJIA 1GSOA 1VI2A 2WA1A 1T0JB 4JVLA 4OJNA 4U9HS 4YWHA 3MBOA 5H7XA 4QUDA 3TPFA 4AZWA 5KYWB 1YUNA 4O4IF 2MSDB 3SSNA 4DA9A 2ZIWB 3AR8A 2REOA 4QU0A 1Z4NA 5EKXA 2FKAA 5AM3A 1WSBA 5FLXA 2ZRAA 1VE3A 1VYHA 1J5EB 1X8XA 3DB2A 5A4IS 3HUTA 1LI4A 1MDFA 2PKXA 3N3BC 2YUTA 4PZEA 4Q48A 2C83A 4PCAA 3BXEA 3D8SA 1ISJA 4XSGA 5J3JA 4EPTA 4KLZA 2ZBFA 4JR0A 5K45A 4EGJA 4AECA 3TOZA 2VDVE 3DE0X 3F4BA 2EW2A 4L22A 1C1XA 2I6SA 3ESZA 1RP7A 3L46A 2PSJA 2V6MA 4HNRA 5JO0A 1TTTA 1RZ3A 3TRFA 2QVBA 3II6X 2XZTA 3WLKX 4B5LA 2GK3A 3USES 1UFQA 5IJWA 2W6CX 4XD2A 3DFZA 3HHPA 4DJ5X 1ECPA 2XYGA 4GGOA 1DJOA 1NMZA 1A1VA 4PICA 4CCAA 3KZXA 2EJTA 4P2GA 3TEJA 2N75A 3H42B 5ALKA 4HDMA 2O2ZA 1SUCA 3FCYA 1M1UA 2JZNA 4JB8A 4I1VA 4TZKA 4DLTA 5AW4A 2F3UA 4OX9B 3L4BC 1GN8A 1VHJA 4RPCA 1KETA 4ZAZA 1BRMA 4G0MA 4L0CA 4JBGA 1VJCA 4JXXA 1I32A 2KW5A 4DAEA 5CBPA 3FJOA 5CLFA 1SXQA 4I1PA 1GNTA 3W2TA 5EE5B 3AUXA 1BQ3A 1DHRA 1XEWY 3PDJA 5J5AA 3WWOA 4JJFA 2I78A 4CF5A 3L4SO 2WD9A 4KUGA 4F72A 1EZ4A 2VVTA 3SS9X 5FOQA 4QATA 4A1FA 4PF1A 2VZLA 3QBDA 1LK0A 1ZX1A 1E7QA 1D5WA 2J4CA 2O2HA 3NHRA 4IGEA 4I1RA 1AZLA 4Q7EA 3SYRA 1KDYA 3NKVA 4KFRA 3HKBA 1P7WA 2EL9A 3TRJA 1M1YA 3VJKA 1QVAA 3JY6A 5BN3B 2DX7A 4TRJA 2FE4A 2P9HA 3ZUGA 1RKVA 4X93A 2EW1A 3WLOA 2ADFA 1NN5A 5F5NA 4GMFA 2WMNB 3VPDA 4OUDA 2X8WA 3KR0A 4REQB 4I2NA 4JP8A 2XQGA 3LJKA 5J59A 2VPYA 2EZ8A 5F12A 1YS6A 5GJVC 1XCLA 4CBVA 4MQ4A 1V43A 1ND5A 1LDMA 1IN4A 1EK2A 1P2FA 1TC2A 3DO8A 3PIIA 3QMVA 1X15A 4LBYA 2G0NA 1IY0A 1EWYA 4LZNA 4QDZA 3AIKA 5BYKA 2RB4A 5EUMA 3PIDA 3NTUA 5GAJA 2P2SA 1GRQA 3M6LA 5EC8A 4B34A 2H2GA 2XUGA 3NANA 3L93A 2HKIA 1JYFA 3T7CA 5IM4A 1S2OA 1L4GA 2NTJA 1POXA 1QE5A 3CVXA 3GDWA 3PNPA 1CPYA 4AMUA 4O33A 3E5HA 3GXBA 3ZJYA 5K3FB 2OORC 5IKOA 4K0KB 4OU4A 1QWSA 2F1JA 1YHYA 2P0AA 2ZRCA 6LDHA 3D6HA 2VEDA 1E2MA 4H77A 6REQB 2ZVQX 2H48A 2SHKA 3NHFA 5KSPA 3DLHA 2CDNA 3TNJA 3RIMA 4KUHA 1MC4A 5I7SA 4XIJA 4WZAA 4Z3DA 4C6TB 4JJAA 2WE8A 5DYYA 5LMCA 2HOQA 1EA5A 5JRDS 3MLEA 3F6SA 4KXFB 3L8HA 1NVWQ 3K1JA 4ZXPA 1SBIA 1WPQA 1UBCA 2SECE 4V0NA 4P81A 3A6ZA 4D9HA 5A7HA 1IHPA 4JT2A 4OHZA 3G1UA 1O95C 4IHAA 4XDYA 1GGVA 3VR6D 5I7VA 3GLRA 4BFSA 3LFUA 4OQNA 5H59A 1AHHA 2HXSA 1NQUA 3GAZA 3PC6A 1W29A 2VDWA 1SG9A 5JVDB 4PZUA 5LQKA 1HDCA 1PJ3A 2NT4A 5JCOA 2HREA 2JGDB 2ZR9A 4GDMA 5CHYA 2J08A 2V45A 5IW8A 1Q95A 4PQEA 1U0NA 1O5TA 1X6VA 1CC1S 2C07A 5BR1A 1R4ZA 4EJMA 2P6RA 4UBMA 4RFVA 4KQCA 1C0EA 3HYLA 2LCQA 2W37A 2X0JA 5IDWA 2P2ZA 6PFKA 1HNWB 1TYDE 3M83A 5EWLB 1I6LA 1QP0A 2HH9A 1R3UA 3AKDA 4I4LA 3V1LA 3M6FA 3EFBA 1KZ1A 3HLKA 2QM3A 3P19A 3PJGA 3HCNA 1J8DA 4J0IA 4PAWA 3ZY4A 4B8ZA 3ZYZA 3PTAA 1UJBA 5IAEA 3ZCPA 2A84A 3BFKA 3NTQA 1C9DB 1AHNA 2HV8A 5FA8A 5IJ9B 5JD4A 1GUYA 1RQNA 3DMTA 4ZT2A 3SHVA 1Z4JA 1G6Q1 1ZK2A 1JFFA 2PU5A 4M1TA 1FQJA 4OHPA 4YUZA 4RPIA 2DY0A 1FJHA 3TX6A 2FMFA 4LMAA 1TQ4A 1K2VN 3LXRA 1JU3A 3ND9A 2HUNA 1GV1A 4N41A 3TQOA 4L6CA 4WV3A 1NDHA 5EXSA 2E6UX 1VL5A 1QAOA 1V25A 2G80A 4AJ9A 2PX8A 1R8SA 3A70A 3I9OA 1C30A 4FWBA 4PNPA 3W06A 2VTBB 4PLFA 2CHQA 2MR6A 4EZEA 1WXIA 3WWDA 4IZOA 2YXBA 4DV0B 1DPGA 4Q1BA 4F60A 3ITDA 2JAOA 4F7WA 5L6LB 1IEVA 1PWZA 4FMCB 3ZE6A 1J9EA 3DL0A 4HNHA 4OIFA 1HUQA 4ND8B 3DEKA 4NBWA 2O0LA 4ZJYA 4B83A 4M0UA 4XD7D 4ZI7B 5CDUA 1PI3A 4ER5A 3EZFA 2BDTA 5C0OE 3KKKA 3S2ZA 1R1DA 3C3JA 1PT5A 3D4OA 2VHYA 3FMOB 7ADHA 2R97A 3KAKA 1R12A 4KGZA 1EEXB 4JZKA 4AU1A 3ZW9A 1C7JA 3AOEC 5LIRA 3SVTA 3N2GA 3QUQA 3UNXA 2X42A 3QLUA 2V6BA 4X00A 3LHIA 2PLWA 3OIUA 5FEMA 1WMEA 2ZYIA 3HV2A 3DMHA 4RNDB 1EAMA 2NAFA 3FYUC 5BPFA 2D5LA 2YNMC 1LJLA 3KKPA 2Z5LA 1NUUA 2KI5A 1KU6A 1QHHB 1ZH8A 3R6DA 1JNYA 1QAMA 1BMFA 1DMRA 1KR5A 1V35A 2YJ6A 3A6JA 3BAZA 5AVJA 3VSCA 4DGQA 4Z4GA 5KNCH 3RYTC 4MEJA 2X58A 4FB4A 2FEOA 1FCJA 1CVLA 1G3MA 5HOQA 4C7OA 4QUJA 1SC6A 2V0CA 1TCBA 5L3RA 3UG6A 4KPYA 1G16A 4D8TA 1JX6A 4W5OA 4P0PB 3QVOA 4W8OA 4BC0A 4W1QA 2OGSA 3C3AA 2GM9A 3KV1A 4D9NA 3FOZA 4Z4QA 3UIEA 3PKJA 3ZZUA 5FWDA 5TGDA 3UT6A 2ZQYA 3JASB 3D8NA 2IGBA 5G4LA 4E46A 5I01A 2FVYA 1R50A 3D2LA 2DBYA 2YHSA 2QZJA 3ASYA 4NS1A 4OAPA 1A5SB 5K6TA 2A9FA 2Y05A 1WTAA 1P9NA 2JAWA 3O1JC 5J1TB 4PSDA 3I0MA 4CT0A 3RB8A 5JH7F 1FFYA 3IE2A 1KF0A 1GUAA 3LNTA 3BFPA 1CR2A 1NUAA 1PQWA 1QZUA 3DZ8A 4HRXA 1KH2A 3PQ6A 4ENSA 3A11A 6CHYA 1JFSA 3MQ2A 2VTDA 5F76A 3TNDA 2AOWA 5TQJA 1WUKS 4EHDA 2HCTA 4NMXB 4LHWA 4TWZA 3VR6A 4BU0A 4FHFA 3BXHA 2EJCA 1NRIA 1Y9AA 4H2DA 1MP0A 2HJWA 3AH8A 3ZN2A 3IR7A 3AVOA 3A58B 4P3XA 2ONJA 3FBGA 3TK1A 1XTQA 5AO9A 1EQ2A 1MQ8B 1K68A 1SG0A 3GRRA 3KAPA 1PEDA 4ZVUA 2OSBA 5JR3A 1T5SA 4W63A 5TB5A 4TV9F 2HDOA 3O8DA 2XNCA 2JD1A 2PS9A 3IAXA 1JG6A 3L7AA 4GMGA 4D3ZA 5IKEA 4EYQA 1SY7A 3KOMA 4HNAA 4RO0A 1GTG1 1KTIA 1ZCBA 3ABOB 4J1SA 5EZQA 2O2GA 1I01A 2R25B 2VJPA 5AKXA 3RFTA 3P4XA 2B8WA 4R7TA 1DIAA 4HWGA 3VKWA 1BCRB 4TL8A 5L4NA 2HMWA 1T8TA 3JD0A 2C0PA 1WCV1 2IZ6A 3OOSA 5EJ2A 3OIGA 4DIFA 4G23A 1U0EA 1WM1A 2FEKA 4FZ3A 3OOYA 4LJAA 2QQ5A 4KAJA 3X0DA 1C3EA 3QWAA 3CUTA 4FFMA 3WGUA 6Q21A 2JK0A 1U9YA 2G40A 2ZJOA 5C5CA 1FFSA 2GZDA 2ZZMA 4Q4CA 3PD0A 5A02A 1QVVA 4HDQB 2BEWB 5CA1F 1MO5A 1X92A 3BULA 3GY0A 3EDMA 3NIBA 4C1BA 1F4LA 1T3SA 2QG4A 5A5GA 4OK5A 4I9NA 4LE2A 4EMSA 4BAZA 4R54A 3V1KA 2VCYA 4OQXA 4Y2RA 1JNXX 2ZTLA 3KLPX 4NONA 4Y3UA 1XC7A 2OB1A 3WGKA 4BVFA 4YPVA 1X7HA 5KOHB 1QFSA 1YU6A 2IUFA 4RV5A 2Q9AA 4XUGB 2QPTA 1A8HA 3FKQA 3G9XA 4XIIA 5HJ7A 4O4HA 1G98A 2C97A 3NVMB 1A8IA 1BHQ1 1YZQA 3VR4H 4LF9B 4G26A 3DVSX 4OTZA 2RGUA 1HLDA 2HTEA 2IA5A 3GT3A 2HA5A 2RGNC 4J1NA 1HMPA 1RZRD 1ORTA 5EHGA 2VHZA 3FVQA 2AX4A 4N03A 4K6FA 3HJHA 2VT3A 2FSHA 4OQFA 3R9IA 2H1RA 2OXFA 4U63A 5CM8B 3EGDA 3RRBA 1X7YA 3JS5A 3OCVA 5LJLA 4DC0A 3F3YA 4OBXA 4N7MA 1YZKA 3HA3A 3QE4A 2PA3A 3E3MA 3UJBA 3DDWA 1BZYA 3ASZA 2QHXA 1E8MA 3MT8A 4Q5IA 3NV9A 3U3DA 2Q5EA 4X20B 1ZAKA 1Q2XA 3AWDA 4QPCA 3V8MA 2I4IA 2ZT8A 3LFHA 2GVNA 2X6RA 1T8PA 4QDJA 3ESBA 1E9DA 3BHIA 3IKVA 5EKUA 2X5NA 4M0FA 5YASA 1H5QA 5JS6A 1H1DA 4P22A 5J2TF 4NQZA 2NV0A 2O8DA 3P9QA 1YB1A 4D25A 2N46A 4RHXA 3VDRA 2VC2B 3DJYA 4WBSA 2EF0A 4LDJA 1M83A 2PNFA 4YJHA 4C3ZA 2FWMX 3H9CA 1GSAA 1JWAB 2IEIA 4X54A 2R1UA 2H59A 2I8LA 3UJPA 2O4CA 4PAOA 3Q1KA 3I62A 2X7JA 3KQOA 5FTLA 5IJZA 4KQIA 2ODQA 1DXHA 4M0KA 4K5QA 2VFAA 1ZPDA 3ZBTA 2JGEA 3HKEA 4DDHA 2JAXA 1D2HA 3IPXA 4CL8A 2MT9A 1OBFO 1VBNA 1GTMA 4UNSA 4CMIA 3F4KA 2IW1A 1KVUA 3TNFA 2FNAA 3EZ6A 1JLRA 4DV6B 1RPZA 4UVHA 2ZWAA 1U8ZA 2IXFA 4WNAA 3JVVA 4WEQA 2I6GA 1HFWA 4GXNA 1E8NA 5EJ8A 1TF7A 3N87A 5AW2A 4PLGA 3D6JA 4ZN6A 3F2IA 4G1MB 4W6ZA 2Y68A 3OD1A 4G0QA 5AI5A 1W4RA 1DKMA 2PZFA 4YONB 3UPUA 3NW9A 4TT8A 3ENKA 1QC5B 2XHEA 1P3JA 2EQBA 2X3FA 4Z1OA 6ADHA 1VKNA 1CNMA 4K2AA 5KNCA 2YYZA 2P3QA 2JKYA 1ZNWA 3C39A 2Z0MA 4XVUA 1XHLA 1GA6A 3CCCA 1J2JA 4GLBA 4YRJA 2WSMA 3PG5A 4ZCMA 4DV3B 3GMSA 4R8SA 3IO3A 4RA9A 3R75A 1OT5A 1PR2A 3K0FA 2OQIA 4L4UA 4DNXA 2FMKA 1R6DA 1TT7A 1VQ1A 2HK6A 2PWZA 4ZMRA 3VPBA 4K03A 3ROMA 5KNLA 1W0KD 2AJDA 3I1YA 1RNLA 3D2BA 3MAAC 2X9QA 2QPLA 1ZK0A 3B1JA 4O1IA 3TTYA 2W00A 2YZMA 3CLTC 3ILYA 2JLCA 1M6HA 2GBPA 2C2WA 1JLSA 1QQTA 1SN7A 3AF1A 3ANYB 3CW2A 1OWMA 3P2IA 1HDOA 4Q93A 4RE5A 1N5IA 1KSJA 4IIJF 1E58A 3ZDQA 4DLSA 1P74A 3MXOA 4M1SA 5CLQA 5FA5A 1P2GA 3UMBA 1ZJ5A 5F2KA 4N8SA 1V5FA 3QUTA 1WNTA 3RUEA 4TMXA 1E9SA 4FYVA 3LYAA 3PI7A 1L3BA 4YAGA 1BKYA 1ZOSA 4B3BA 3QLEA 3KJHA 3KYIB 4BECA 2C7GA 4FEAA 3AEQB 4ETWA 3I42A 4M7OA 5AM1A 2F8LA 3ZBQA 3RM3A 3E53A 3FNHA 3RS7A 1Q7RA 2LPMA 1T0HB 3JCZA 4KL8S 5AKGA 3NNNA 1MN6A 5BW6B 2EP7A 5EY5B 3ZIDA 2QN7A 1UCFA 4PGMA 3A1NA 3NETA 2A86A 2RG1A 2VHTA 3QE0A 4XKJA 4DCJA 2VQFB 3CSUA 1YRLA 2BTEA 2WNHA 2DBQA 1CUCA 2EKDA 3KD2A 2Z2IA 5CLIA 3TX2A 1R5BA 1RLJA 3K9QO 5DNAA 1Q16A 4H35A 1JDBB 1O03A 1PJRA 4IRUB 5F21A 5LCXA 1QOQB 1UXKA 4QEKA 5FQOA 1T9DA 4YUYA 2IHZA 1VE7A 3R3XA 1NYLA 3LA6A 4RVUA 4TL6A 5H9VA 3MAGA 4EFKA 3HCDA 2ZVJA 1TZCA 4FJ2A 1PVDA 2CYAA 1QKIA 2P8SA 2YWRA 4FT4A 2WAXA 2Z09A 4M1OA 1D2CA 3DHVA 4X44A 2CJYA 2GT1A 2TMDA 3EMBA 4ANFA 3TXXA 2C9YA 1KSGA 4MP3A 1YDMA 4V0KA 4YLEA 4UUPA 1EXDA 2CSUA 3AKCA 3GLKA 4S2UA 3HWSA 3DDUA 3NC4A 4NCHA 4AJPA 5CXQA 3IQDB 2XB6A 4TM8A 2JRCA 2XQFA 1ZCJA 2VHCA 2PH3A 4QOJA 1PHRA 3OIDA 4FVTA 5DIZA 3OJCA 1IFXA 3O3NB 4K3VA 3LRXA 2Q1SA 4I4NA 5DHSA 1Z6YA 5BRJA 1PL6A 4FGUA 3PV0A 4CG1A 3UTCA 5DULA 3FCEA 2Q0XA 2ECQA 1J97A 4TTJA 4ARBA 2VAMA 1OFVA 4MARA 1R66A 4XR4A 5DI3A 1L4HA 3B38A 2C95A 3G2KA 1QHXA 1TUBA 3CE9A 4U7GA 3TL2A 4A0QA 4GPIB 1XL0A 2Q3BA 2GKGA 1PN3A 3GEPA 4CIDA 1U4NA 3HNOA 4G3XA 3NHLA 4MI3A 3KQTA 3ZWOA 3O91A 1FUYB 3R7BA 1GA4A 2WMOB 3EJ6A 4F45A 3BXOA 3U44A 3BSSA 1Q1ZA 1N2HA 1UPUA 4L0DA 4MTLA 1YSCA 1J90A 4D3XA 4DQ0A 2PAFA 5JAZA 4PGHA 1Y6RA 2Y4OA 3IESA 4Q3KA 4TS4A 3MJFA 2SNIE 4HS4A 4YCAA 4N76A 3N86A 1Z5PA 4G8DA 3G5TA 3GGPA 1LC0A 3N5KA 2ZRLA 4B6SA 2P35A 5DOVA 3LHFA 2I7VA 3PNKA 4LPKA 1SB9A 1K7CA 1R4MA 2LXNA 1JDUA 2YXNA 4YRDA 3ZEAA 2XKKA 4UAJA 1QV9A 1U8YA 2XCRB 3AR3A 3GAAA 4QKQA 4FR5A 5U9CA 1YR9A 2E4UA 4MCIA 1KO8A 4M8NE 3O75A 4PLZA 1SVOA 2IHYA 3S27A 3HY3A 4Z9XA 3QX3A 3QP9A 3GJ5A 1QRTA 1EHYA 2RGGA 2BMAA 1P45A 1ZRNA 3AL3A 3HP4A 4CFZA 4JNCA 3ED1A 5C31A 5EIXA 1VP9A 4TVOA 4NG4A 5ARBA 2H0AA 3OPNA 1DG1G 1OJLA 2UYOA 3EZNA 1NF2A 3BWMA 2XOEA 1CRZA 1CETA 1HDZA 1DDGA 3FAZA 3GVHA 3FYCA 2WPNA 4CEHB 2D5IA 3VZCA 3Q72A 1XN1A 5H83A 3SLGA 4Q4AA 2R8OA 1IIBA 5J63A 4AK9A 4YCCA 1KKUA 3B82A 4TTVA 3L8MA 3QX7A 1KVSA 1MD9A 4Q1AA 1HG1A 2O2DA 4R98A 4BTLA 2XYPA 3WQSB 3P71T 4R31A 3WLPA 3AFMA 3QKSA 2R47A 4YP1A 1Z06A 5AKJA 3EWNA 1I1HA 3UPTA 1B0AA 4LHSA 5H82A 1HR0B 3JX9A 2F8TA 5JYBA 4DV2B 2ZJ0A 1FRNA 1WD7A 2FFAA 5FLYA 2FUCA 4UHJA 2FJPA 3OQJA 4NU8X 2VRCA 4QBKA 4CXMA 4WADA 5DHFA 1JSRA 4LTMA 4ESOA 1G7RA 1XZJA 1N2SA 3AO0B 3NMUF 2NQ8A 5LN1A 2B99A 1GNLA 1PTJC 3WRVA 3FOBA 1HPLA 5HF9A 1T2CA 2HN9A 4FQ5A 1V39A 2XF2A 5AESA 3DKKA 3KAQA 2YJGA 3CX8A 2AHOA 2DEUA 4C2BA 5HQJA 2EW8A 2OO5A 4CDMA 1F6WA 5FBHA 4PSVA 5HG0A 4R2MA 4JROA 4Z4HA 1MKYA 4HH1A 2R2GA 4KVZA 5J5CA 3L02A 1M72A 2ZWPA 4NXNB 1PZFA 2PMFA 2C20A 1T25A 1NBME 3DAPA 3SICE 3JAWB 3ES9A 5L4LA 2JLUA 2J0SA 4D9MA 3R2JA 5P21A 1FW6A 2HEIA 4K9PA 4AW9A 1SK9A 1IUPA 5L51A 3I6QA 3D8HA 3EF1A 4BJ6A 4CV1A 1N1EA 2AQ8A 2XOXA 2Z8YM 2PGLA 1ACJA 4G0WA 2ZRJA 5D6NA 2C2BA 4J75A 3V4SA 3VQTA 3ZLUA 4DCPA 4NU5A 1Z2CA 2Z4SA 4AURA 4W8GA 5IDVA 2F4NA 1KZGB 1ZDMA 3I6IA 2UXDB 4J7CA 1YONA 4TTQA 2CJWA 2Q45A 1CJMA 2W6QA 1S4QA 2GK4A 2ZJ7A 1JG7A 2GKOA 3DV0A 3OU7A 4IZIA 2JAHA 1ZK1A 2BFWA 3D0OA 5JEDA 1J8FA 5IEBA 1FP1D 4UTZA 3BF7A 3LGSA 3PC7A 1I10A 1S6YA 3DKIA 2AJ8A 2NXJA 5JIBA 5KTKA 2JVJA 1N2GA 3PE4A 5SYAA 1G6OA 3AESB 4O2BB 3GV0A 1J8QA 4J29A 4GEGA 3WYBA 4BP8A 3SHQA 2K7FA 5IBRA 4BVBA 4ND3A 2JKVA 4EP1A 1ARZA 1VJDA 1BYIA 2QVYX 3V2IA 3NWJA 3K0KA 1DO2A 5EIEA 1B73A 1FP4A 1U81A 3CHYA 3PHLA 4YMWA 4ZYTA 5FHRA 1BMFD 4J3FA 2A7QA 3FTQA 4LY9A 1VSUA 1SZDA 3RYCA 4KXQA 1K6IA 2I29A 3THWA 2IPLA 1EGVB 3W2IA 3H5RA 3K70B 2C2XA 3VTFA 5KJFA 2HGSA 3I5XA 1CHNA 4B2YA 2VXBA 3V48A 3GPDG 3BRCA 4FOOA 2QI9F 5SYMA 1J2YA 1N1GA 4WY2A 2GLTA 1KYZA 3VR2A 3GMTA 3O4GA 4I2VA 5ES3A 4P7FA 4DLNA 3K9FC 2IHBA 3W34A 4ZOLA 4E5YA 3GLFE 5E4JA 1DU4A 1L7VC 4P5DA 2CUZA 1G64A 3CN7A 3AEKA 3L6OO 1ONNA 2XUIA 3RG2A 5DI9A 3TW8A 4BFLA 2DHEA 4YCLA 5K0EA 1H2EA 3H0CA 3Q12A 3HCFA 1KWKA 1EE9A 4PC2A 3G8AA 2WB4A 4HK4A 2JASA 3HBJA 3UJ8A 3WNQA 1QX3A 1GFWA 2JJMA 2QRPA 5CT4A 4MR8A 1FPMA 1Y4UA 3QFRA 5AM0A 3O0DA 2VOEA 4CF4A 4MKRA 2HTFA 2Z1MA 3ESDA 4KIGA 4PM4A 2W0SA 3DE2X 1Z75A 1YRQA 3KDSE 3NVAA 1DBPA 4IJWA 4QA9A 3QYPA 1VDZA 4MJLA 4R2XA 4EPVA 3ZDEA 3ITKA 1ZQ1A 4LRUA 4N1AA 7MDHA 3VNUA 3OHSX 1FFXA 4QFBA 2ZE7A 3GLVA 2PR2A 5EL0A 1UMDA 1YB2A 3ABSB 5HZMA 4LISA 3RQIA 1UAGA 3GF4A 3I0ZA 1WUTA 3V8EA 4JDPA 4BMVA 1NVAA 4F9TA 5MGNA 1U99A 1PG5A 1U02A 4Z0NA 3A4IA 2APJA 1VJ5A 3DBRA 5AKYA 1KY4A 1RJ9B 4DHEA 5IUNC 3BBLA 1Y37A 4HAYA 4LF5B 2XMRA 4NEQA 4R1UA 1SCIA 3VI4B 1B00A 1R8YA 2QZSA 4LI3X 3AP2A 1L5NA 3BGDA 4DC1A 4WLOA 2AXQA 4QO7A 3SSAA 1NC3A 5FUQA 3MJHA 3CZ4A 1L8AA 1LWNA 4N9QA 4PAMA 3Q7IA 1WETA 5ALHA 2X76A 1JHUA 2CJXA 5HNKA 5KMGB 4YB8A 3SZLA 3QKRB 3UWDA 1IZYA 2O8VA 1LB1B 5JNUA 3SHWA 3GZJA 4HQRA 3SX0A 5ALVA 4QXRA 2EFJA 2GEFA 3LFTA 1OXMA 2P7IA 1SKBA 2AKYA 2EVWX 1B3RA 1JQBA 1WVGA 1HO3A 3COWA 1EA7A 1T3TA 5F3DA 3U2QA 4J6FA 5HKOA 5J4KA 1DC4A 1I7QB 2OXRA 4BUZA 1L5VA 1PD0A 1TNDA 3H2HA 3QJ5A 5F78A 3V4PB 4RF5A 4I14A 5A2QA 1YZUA 2GA9A 1XZCA 2YYAA 4RMGA 4OU5A 4WXMA 3WGGA 4KVGA 1WHSB 3UCFA 4GGMX 2C1ZA 3TRIA 3I58A 2H4HA 4L76A 4LBZA 4FYPA 1RQ2A 4HQ0A 4R0MA 2X2PA 5G0VA 4X66B 4R6XA 1NMEA 2C9OA 2HMAA 1HY3A 3MMZA 4Q7LA 1RYYA 4TPKA 2O23A 1II8B 4MUNA 5K3CA 3QUSA 1A9RA 5JISA 2AUTA 4WNCA 3TBKA 3N8KA 1N2OA 3BA1A 4XWAA 4C6RA 4CNQA 3ZE9A 4J16A 3V4VB 3PD7A 3RVDA 2XIQA 3ETJA 1N3YA 3HDQA 4OHVA 2UYHA 2FWPA 4LOLA 3UATA 2H5LA 1Y9ZA 2CXHA 2O20A 4O08A 2QS9A