4E7OA

Crystal structure of receiver domain of putative narl family response regulator spr1814 from streptococcus pneumoniae
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
130
structure length
130
Chain Sequence
HMKVLVAEDQSMLRDAMCQLLTLQPDVESVLQAKNGQEAIQLLEKESVDIAILDVEMPVKTGLEVLEWIRSEKLETKVVVVTTFKRAGYFERAVKAGVDAYVLKERSIADLMQTLHTVLEGRKEYSPELM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Response regulator
publication title Crystal structure of receiver domain of putative NarL family response regulator spr1814 from Streptococcus pneumoniae in the absence and presence of the phosphoryl analog beryllofluoride.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 47
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4e7oA00
3JPWA 3H5TA 4Z4HA 1MIHA 2A9OA 1ABFA 1RXEA 1BDJA 1ISRA 5CNKA 3TD9A 3CHYA 3OO1A 3I45A 1QMPA 3NHMA 3KS9A 1EWVA 1ZESA 4IRXA 4MR7A 2FXIA 1DC7A 2MSKA 2PUCA 2X7XA 1Z25A 1L5ZA 1YIOA 2GWRA 1QPZA 4RY8A 5TQJA 4F12A 4YGXB 2IPMA 2JBAA 3EODA 3P9YA 5JNRA 4LDZA 4JOQA 1BAPA 4FE7A 1QQAA 3LUAA 1PEYA 2PMCA 1VKRA 3CU5A 3H5LA 4LE1A 5IUNC 3FFWA 5D2CA 2WMYA 3KLOA 4KMRA 5JNVA 1QP4A 1U2PA 4KPYA 4TN5A 2HJ9A 4ZYLA 1CHNA 3UKJA 1AB6A 3GBVA 2MYTA 1P6QA 3T95A 4N41A 2NUBA 1F4VA 3BILA 4JP1A 2HPHA 1K66A 4HNSA 4OTZA 3RVMA 2FVYA 4TLLB 5KI6A 2NT3A 2A9QA 2PAFA 3N0WA 3O2SB 3QEMB 4RK4A 4RS3A 1GUBA 3F7NA 3K4HA 2PJUA 5BR1A 2E4UA 3A3KA 2CHEA 5F64A 2NZVG 4NCBA 3H5OA 3H1EA 1P8AA 3JPYA 1EFAA 2TMYA 1BA2A 2QXYA 4EYQA 4YCSA 1C4WA 4F3TA 4RXUA 5DLEA 2PUFA 2R47A 1SRRA 4D6XA 3H5WA 2R25B 1D1PA 4MQFA 4KREA 1USIA 2QSJA 2ZWMA 3JS5A 1JWLA 4GPAA 2JVKA 4Z9AA 3ROFA 2FEKA 3BRQA 1NXOA 2PUAA 4NCAA 3QEMA 2FMKA 5CNIA 3DGEC 1Z12A 3RQIA 2VYCA 2IOYA 2DRIA 3Q9SA 1FFGA 1Z26A 2AYZA 4WWHA 4LX8A 3SQNA 2A9RA 4M88A 3RVQA 5HSGA 2P9HA 2YHAA 4MAAA 1JDNA 1HEYA 3RVKA 5GOTA 4PE5B 5CNMA 5IULC 2FQYA 2XDYA 2QW1A 3KKEA 5IEJA 1LJUA 4D6YA 1DBPA 4Q7EA 3LUFA 5HQJA 1YTUA 2GI4A 4G0OA 3IP9A 2OQRA 1DZ3A 4XAQA 1Y1LA 3UK0A 3GYBA 4Z99A 2PUDA 3QLVA 1S8NA 2E4XA 1JH9A 4KQ9A 1NXPA 1ZHHA 3DBIA 4G0XA 3FMVA 2JVJA 4Z4IA 2A9PA 4F06A 5KC8A 3MM4A 2CHFA 4H3HB 1JHZA 3Q7TA 4XLTA 4MGEA 1W25A 1U2QA 4ETMA 3EJWA 4ETNA 3IDOA 5JNWA 1FQWA 4MS3B 2JB9A 4NICA 4JB0A 4WT7A 3G1WA 1ZGZA 3NNSA 5CNJA 3RVNA 2FQWA 4IF4A 3HM9A 3HK2A 2R48A 3LKBA 1MVOA 4EUKA 2WJAA 3IPCA 3O2QB 2FW0A 2E4WA 4RKQA 1FFWA 3GWGA 4N03A 3ILHA 4EY3A 1OXKB 5ED4A 3A0RB 4RY9A 4G0ZA 2E4VA 4QICA 1LK0A 4B09A 2JK1A 1JL3A 2OENG 1A0OA 4MPTA 3GV0A 5TQ0B 3O75A 4IGAA 3GBPA 3R0JA 2FTKE 1PEAA 3EQZA 3BRSA 1R8JA 2HQRA 4KNYA 1SXIA 2VK2A 1P2FA 3TO5A 3CLKA 1U0SY 1GUDA 1SD5A 2WY2D 4L4UA 4Y9TA 4WXEA 4RK0A 4KQCA 3OMXA 4MYRA 1F51E 5JS1A 3OMWA 5IUKC 4MS1B 2JVIA 4EYOA 3IPAA 5JNTA 4W5QA 4Z9BA 4Q6WA 2JRLA 2R4QA 5TQ0A 3O21A 2RGYA 4DADA 3QLTA 3M6MD 1YS6A 3RVPA 5BRJA 4S05A 1M5UA 4OLBA 1FFSA 1QO0D 5TQ2B 4LE0A 3OLVA 1QP7A 4F8JA 1M2FA 3MIZA 4P98A 2LIVA 3MQ4A 3QLUA 1JLKA 2GBPA 1LJLA 1A04A 1P6UA 3T38A 1J56A 1JYEA 1XHFA 4O1HA 2HQBA 3DGFC 1I3CA 4MS1A 2WJWA 3JVIA 4MR8B 4ZPJA 3CFYA 2PUGA 3D8UA 1ZH2A 4ZMSA 4WZZA 2FMHA 3NBMA 2LPMA 3LMKA 4EVRA 3GT7A 2L19A 3KSMA 4LRQA 3HDGA 5KC9A 5TQ2A 4E7PA 4RXMA 1XHEA 4F11A 1YK0A 4JB2A 4PICA 3L49A 3MMNA 4YR7A 2PLNA 4TMYA 2YHBA 4JASB 3C6QA 1SXHA 3HUUA 3Q15C 3SG0A 1QKKA 1TVMA 3GA5A 4YV7A 4MR8A 3CTPA 3O2JA 1ZN2A 5E3JA 4PEVA 3LUDA 1QP0A 2FKAA 3L6UA 4MQEB 3O1JC 4KK3A 1JX6A 3O1HB 4LDAA 1RZRD 4UHKA 4G0YA 2LP4Y 2IYNA 4FB4A 3OO0A 3NNNA 1ABEA 3OLYA 1YK1A 1PNTA 4QPJC 1DC8A 3FFXA 3HS3A 3I42A 1CYEA 2QV0A 4RV5A 1JFVA 1Z15A 1NTRA 3MYYA 5IX8A 1D4ZA 1YVUA 1VPWA 4WUTA 1KMIY 3HZHA 3RVSA 3EQ2A 5KQGA 3LTEA 4G86A 4MQEA 3RH0A 1DCFA 1NY5A 3HUTA 2FMFA 6CHYA 4Z0NA 2PL9A 5DCLA 3S99A 3HV2A 1USGA 4RDCA 3HSYA 4RK5A 5GQSA 4OLAA 5HKOA 1JDPA 1BDHA 2AYXA 3H1GA 7ABPA 1EWKA 1OXBB 2KYRA 3NHZA 3N6VA 4MLCA 4EGSA 4G97A 4HNRA 3HVRA 3N0RA 1M5TA 2B1JA 4MLDA 4YLEA 3T6KA 3KJXA 3LFTA 2F8SA 3JVDA 2QVGA 3RVJA 5EWMB 4H3KB 1E6MA 3A10A 4ML3A 1D1QA 4RSMA 4RXTA 2W42A 3HJFA 3CZCA 5JS2A 3O1IC 3F73A 4G0QA 1QO0A 1DBWA 4KVFA 1MB3A 3TB6A 5HM6A 1DRJA 1U04A 5T3YA 1NXXA 4O5AA 5KQLA 4DQDA 4WXMA 1YMVA 3G85A 4PYRA 3LKVA 3SNKA 4CBVA 1UDRA 4PZ0A 3OQOA 4MS3A 3EULA 4NQRA 5C5CA 1TLFA 1KRXA 1QNLA 5DGCA 2M1ZA 4YWHA 4N0PA 6ABPA 4MRMB 3OLXA 2MYPA 5KQPA 4N76A 3LUCA 1ISSA 5TPWB 3IP7A 1FSPA 3M9XA 3T8YA 2GX6A 4W5TA 3DLBA 2FLWA 1JYFA 1QQBA 3IP5A 4EVQA 3H5IA 5IC5A 2ZAYA 4RK1A 3DLHA 3DZDA 1BVHA 3HEBA 2PUBA 3TMYA 2GKGA 1JF8A 4YS6A 9ABPA 3ILYA 2FQXA 5FBHA 4GNRA 2J48A 1EAYA 4JA2A 1URPA 1T34A 2RJOA 1E6LA 1NXVA 1TMYA 3BREA 3W9SA 1LBIA 5JNSA 3Q41A 3KYIB 2N9UA 3FDFA 4MRMA 5BQ3A 5DTEA 5CHYA 5TPWA 3NNDA 5TPZD 2PE5A 1RPJA 4H60A 3IP6A 1RZRA 3KYJB 3F6CA 2F8TA 3D02A 4W5RA 5ABPA 3RVOA 2FEPA 5KQMA 5JNUA 4IMJB 1MAVA 5EWJB 5T7BA 4HNQA 4MS4B 1BDIA 2RDMA 3H6GA 4Q6BA 3LUKA 1NATA 3OQMA 1AB5A 1Z17A 3OLZA 4MR9B 4Z4EA 5B3JC 1TJYA 1W9HA 3KCNA 1MB0A 4LE2A 4W5NA 1K68A 2FLKA 4ZMRA 2IPNA 4P1ZA 8ABPA 5FWXB 4YP9A 1JFTA 3JY6A 4E7OA 1E2BA 3HXMA 4EVSA 3H1FA 2Q5CA 4MQFB 3UUGA 3CRNA 4KZKA 5EWJA 3TX6A 4MS4A 4RK6A 1DCMA 1ZH4A 3LUHA 2ID7A 5EWLB 4MR9A 5FWYB 2HSGA 4KFCA 1VLZA 1ZVVA 3HO1A 4LZLA 3RVRA 4ETIA 2V0NA 2WRZA 2CWDA 3CG0A 4YRZA 5FWXA 1Z18A 2WWVD 4EYGA 4QYMA 1DRKA 1RXIA 4XXHA 4KK4A 3I5AA 3QK7A 2ID9A 4IMIB 1PHRA 1DG9A 1TM2A 3LOPA 4OATA 2MYNA 3N8IA 4Z4CA 2LUOA 5IEBA 2NT4A 1XWWA 1ZITA 2P4UA 5TE9A 3C3MA 3Q7SA 4JAVC 3VNBA 3M9WA 2PKXA 1B00A 3H5VA 4UHJA 3H75A 4HYEA 2B4AA 4G0MA 4L85A 5EWLA 5KWSA 2M98A 1GCGA 5FWYA 1Z13A 3E61A 1C0EA 3LUGA 4KRFA 2PL1A 3RVLA 5BRAA 3URMA 4S04A 2BGGA 3O74A 3E3MA 1GCAA 2HQOA 2FMIA 2QR3A 1Z2EA 4EYKA 1D5WA 3QX9A 3QLUC 3OQNA 2JCGA 2I6FA 1EHCA 1ZDMA 1RNLA 3MA0A 4RZSA 3JTEA 1ZAYA 3N75A 3N53A 1NXSA 3QELB 1A2OA 4RY0A 3I09A 3EDCA 3K9CA 4O1IA 3VNAA 4G0PA 4Z4FA 4KV7A 3EGCA 2E4ZA 2QVCA 3GL9A 1NXTA 3BBLA 1DJMA 3FFTA 1YMUA 3GRCA 4IILA 2H0AA 3LUJA 1L5YA 1ZGGA 1APBA 3KLNA 3SAJA 1SXGA 2FN8A 4OG2A 3CZ5A 3OLWA 1H9CA 2L2QA 2L18A 1PNRA 1GLGA 3KTOA 3OM1A 2E4YA 3C3WA 2L17A 1JBEA 2H3HA 3OM0A 1U8TA 4RU1A 3ROTA 5TPZA 1KGSA 2IPAB 1ZY2A 1VRVA 3CKMA 1E6KA 1WETA 3KG2A 3KHTA 3QELA 1YS7A 2O20A 2IKSA 4RWEA 3SM9A 4ZJPA 2VUHB 3C3KA 2QZJA 1PUXA 4D74A 3CG4A 4YO7A 4NV3A 4RKRA 2WB4A 4TLMB 5IUJC 3FGZA 1Z2DA 3CS3A 3H6HA 2CD7A 2FEWB 2MYUA 4N0QA 5EWMA 2LBPA 3QX8A 5I4CA 3CNBA 1NXWA 3F6PA 4XFKA 4W5OA 3C97A 1JFSA 2IDMA 2MSLA 5B3JA 2VUIB 1DBQA 3EAFA 4XARA 4DN6A 5PNTA 1M2EA 1LBHA 5C5EA 3B2NA 1CEYA 1IIBA 4MR7B 3MF4A 5FBKA 1DCKA 1D2AA 1DP4A 1Z16A 3N0XA 3Q7RA 1KRWA 2RJNA 2NZUG 2IPLA 4XASA 5DKFA 3HDVA 5IBQA 2MSWA 2FSPA 2JBAB 4OBBA 1EWTA 1USKA 3HCWA 3QLVC 4FE4A 4Z4GA 2FN9A 4QYWA 4N47A 2QU7A 3SY8A 3QEKA 4RK7A 3A0UA 2PUEA
chains in the Genus database with same CATH superfamily
5TARA 2IEAA 4L6AA 2Q5OA 3U7FB 1X87A 2J59A 4YRPA 4ZYWA 3A3NA 4HDOB 3JQ8A 4U2CA 3T06B 4BFSA 4CI0B 4OXYA 3GRYA 2I4MA 4GLJA 4PS1A 2QZ4A 4XPIB 5ADUS 3LQ4A 3AIIA 4LI0A 1PWXA 2GPJA 3FB1A 1KFJB 1XRPA 4YJ3F 4JLBA 4PGMA 5BMOA 4I3GA 5IF9A 2HXYA 3IKLA 1Z25A 4L3OA 1QPZA 2YFYA 2YHUA 3MUOA 3V8VA 4UCWA 3EUAA 1FFCA 4H17A 3DMTA 3JU3A 3JWPA 3CT6A 5CH8A 2E5FA 5AOBA 3RFTA 4LYAA 1MXHA 3G5AA 3GXBA 4P3NA 4PX9A 2NW6A 1TKRA 2FZ4A 2QVBA 1VKRA 4BFZA 3DE0X 3W4IA 4P0PB 3IRVA 4PAOA 1EQUA 1KMHB 2VOEA 3KEOA 4XQ9A 1O95C 2SECE 5ALGA 5KYUA 3NHYA 3PXGA 2NYAA 2E89A 3SQLA 5JYDA 3PDJA 3VSBA 2E6KA 4AD8A 5C52B 2GEBA 4LGMA 2LW7A 3HRIA 2HA4A 3ABZA 5AHKA 3RAFC 3I32A 1M66A 2XYPA 4H0FA 4HNSA 1X2EA 3DHNA 1A82A 4UBIA 1DUSA 1I2ZA 1NYTA 1UBCA 1C4OA 5AVSA 4JI7B 3L4BC 4EMTA 5BWLA 2F1RA 1J2RA 1L6IA 4Z9YA 3IDQA 4NBNA 3WLJA 3PK0A 1MEEA 4KQGA 4OOEA 5F64A 3A6EA 1HSOA 3OQJA 4QUDA 2P65A 3OOJA 4ERNA 1UKVY 1MABA 1KAGA 3NHFA 4HVAA 1JEDA 4WGFA 4CV0A 4RXUA 3TSWA 1H2RS 1V8DA 3VKUA 3VH3A 4EG1A 4YAUA 5FTNA 2R47A 3H5WA 5CGZA 1ZSNA 2BF7A 2CGEA 2EYUA 5KU1A 1BFDA 3ROFA 2X8AA 1F3OA 3BFKA 4LHYA 1P2SA 4HTFB 4IFEA 3GLFE 4DC9A 5K05A 3HU1A 1L5KA 4CCSA 1NA5A 3ETNA 2ZUEA 3QWFA 3K09A 1HNNA 4B7UA 1VCNA 4E4TA 4NH0A 3ZI7A 3BA1A 1FFGA 4M0FA 2JJ2A 3DHVA 3LBFA 3B1XA 3ENZA 4FMDF 4BE4A 2IEBA 4EPWA 1OU0A 1L7NA 3NETA 2BRUA 3FRJA 1GVHA 3VI3B 2A0KA 3PFHA 4JJ4A 2HF8A 1WB6A 2VJQA 4R5HA 5JZOA 1E3WA 3KSBC 4C21A 2BKXA 3E9MA 1XJWA 1V8FA 4RESA 4BFVA 3JWIA 1DTWA 4FFLA 4TTIA 3UIEA 4R1LA 5IEJA 1OXUA 1HYEA 1JIKA 4C6SA 3ZDQA 5JCOC 5JYEA 1DNPA 3OPXA 1DX4A 1JEQB 2ZQZA 3H19A 3QVOA 3FYUB 4LKRA 3GP8A 1E6WA 2OQRA 4X9XA 4Y6QA 1NJ8A 2RIPA 3II6X 1QAQA 1XCGB 1SEPA 3AVXA 4WUVA 4F2DA 3CZQA 2E4XA 4UNIA 2I87A 2AX4A 3RIMA 3RTCA 4BPBA 4CR8A 3LY9A 2PKQP 1JW9B 1PJZA 2HA0A 3B1JA 4HMQA 3QX3A 4Z4IA 3LC7O 4WZBA 1SG9A 5FEMA 4X7MA 5JPIA 2PZJA 3QF4B 5IJ0A 1OKKA 3UJPA 5IZCC 3Q7TA 2OC9A 1TPZA 3ADKA 4B2PA 1CJBA 1RXUA 3F46A 2IRWA 4PSVA 1IZ9A 1FQWA 1GNQA 2JB9A 3DWGA 4GR9A 1JR2A 5EJEA 4CM8A 3GYGA 1Z3IX 3U17A 1P39A 5TMPA 3FI9A 1XNJA 3CNEA 4K6CA 1R0ZA 4WK6A 4XVRA 3T99A 4AI6A 5DBGA 1RMTA 1PDWA 1F8FA 4IF4A 2BBOA 3HM9A 4KCGA 4A7PA 3EPRA 3K15A 1V16B 1E89A 1ZKMA 2WJAA 2AKEA 4HL6A 3HGMA 5EKTA 2DHRA 3NB0A 5ITWA 3WR5A 2P6OA 4RY9A 3STVA 1W44A 1NQTA 2YQ4A 1GZ7A 3JTMA 2VHXA 3K2EA 4XGIA 4DCGA 1X1QA 1FLDA 1MH1A 2O1WA 1LK0A 2AQKA 3GROA 4QICA 4I5FA 3I8OA 3L0DA 4L8LA 1YZ3A 3OAAA 4CVNA 3M4NA 2BZ1A 4R1PA 4E33A 2WZDA 1ZK0A 1J5EB 4LYYA 4OHZA 1U8FO 2TMDA 4QXAA 3R0JA 1X8XA 5EXEA 4E5NA 4M9UA 1YJQA 5KUTA 2D00A 2PSDA 4I6EA 4U2GA 5EPUA 1R6BX 4FFBB 1QYXA 4FGSA 3F3KA 2GPAA 3B5EA 1U0SY 2ZRJA 4LW8A 4BGUA 1PQPA 2GSDA 1UQTA 4DJDC 4HWOA 2EU8A 4DR1B 1F51E 3N58A 4FX5A 2IYSA 2PMBA 2DYKA 2O3SA 3DW3X 3DMRA 5E0KB 4NKRA 5A7HA 4FSXA 5AWFC 3GIWA 5JNTA 1NSFA 2WTNA 2B6HA 4EY7A 2ZIFA 4IHQA 2XUFA 4HLDA 3L0ZA 3BL6A 2YCLA 5AW1A 3QLTA 4YRNA 1J8MF 2YDYA 3MCWA 3WRWA 1PVDA 4B2IA 4DHEA 4UTZA 4OP1A 1U31A 1VRCA 1JR4A 2YYAA 1U6JA 5I9TA 1CQJB 4CKEB 5IWAB 4W9MC 3TLJA 3PJDA 3Q8LA 2IHNA 2J3MA 3A28A 3O93A 2H6EA 2IU3A 4PVDA 2C5AA 2HQBA 2V6BA 2P77A 2PKQO 2C00A 3RTEA 1GLNA 2AFVA 2W0MA 4E13A 1TRHA 3DVAA 1SCIA 4PLZA 2E3JA 1VJ5A 4F8YA 5ESWA 1QIEA 5ALFA 3T3HA 2XSZA 4EP1A 3SE0A 4F4IA 1I4TD 1BRMA 2GVDC 2JH8A 2W6IA 3WMFA 4EAQA 5AJZA 4O2LA 5D1NA 1YZQA 3C1AA 3HYLA 3PXAA 4GM4A 5IAEA 1NOKA 1DAIA 2GUWA 1CR4A 3CF0A 1WY7A 1YK0A 1IEWA 4IOLA 4ETWA 4HEJA 3KFVA 1PZXA 2ZYGA 2XDQA 4YEDA 2PT5A 4HRVA 1YF3A 5EUCA 2EC5A 1CF4A 3K6SA 1RBYA 1U5CA 2AQHA 3TH5A 2O5CA 4GP7A 1DEOA 3QI2A 1CFJA 1SVNA 3DBLA 4IINA 5JJIA 3WRXC 4IPTA 3WNDA 3AEQB 4JT2A 3PEUA 2NTVA 4FM9A 1EXWA 2Q3BA 2PYIA 4NYIR 4LDAA 3IT3A 4O4HF 1EH5A 4S2EA 1O0SA 1V47A 4FB4A 3P20A 1J8YF 3DAYA 4MAMA 1AUXA 1QC5A 4BQIA 2FDXA 1TDJA 4P81A 1KC3A 3KZMA 4N12A 2IEIA 4NPHA 3BL8A 4F9GA 1K7SN 2PH5A 4DLNA 2BFDB 1CTQA 5FLYA 3MPUA 2Z6VA 2CW5A 2FWRA 1KY3A 2BZGA 1KJNA 4QHYA 2NP7A 3M9LA 1W88B 2ZVQX 2XIQA 4XWYA 5GM1A 4W5WA 1OLUA 4QSMA 2D0PB 2GHQA 1ZJ4A 2WM8A 4XJTA 3VXKA 1GUAA 1OXSC 1VL6A 1Q1AA 2JEYA 3R5HA 1TTPB 4OAPA 1SBYA 4B6JA 1V11A 1FYXA 4DCTA 3QZUA 4GC5A 4CM9D 4JYMA 2VSNA 1IZ7A 1XXLA 2HBZA 4JBIA 3ENWA 3UW1A 4EKIA 3DT9A 3HA7A 1RJWA 2JIBA 1Z29A 2ZDGA 1OQAA 3DQQA 3FVVA 3N0RA 3D4IA 2BT4A 2QP9X 2QKYA 4G4JA 1NZDA 2WLSA 5JO0A 4YWJA 3NP7A 3MERA 5HQ3A 1KAHA 1THZA 2JGNA 3PRKE 4LGYA 4MVWA 3BD7A 2R6HA 3N39C 3ONVA 5IC6A 3VDRA 5F3DA 4GLOA 1R2QA 4M86A 1GG2A 5AI9A 3IAM1 4FP9A 2V7TA 3QPWA 4NDAA 1S5PA 1ZNYA 2JD1A 3VBCA 5LWQA 1NNUA 1ZC4A 2I9KA 2WT8A 2J5QA 4B74A 5KQLA 1ZWLA 2IX9A 3O82A 4K88A 4LXQA 4DQDA 5LM3A 4XQCA 1K5PA 4A8HA 4DW8A 1X7YA 4W1RA 1KDYA 5KYKA 2YQZA 1J0BA 4KAAA 2QGZA 3CX7A 1RRPA 3FDIA 1UDRA 4PZ0A 2IUTA 3D7NA 3T3DA 1IZ8A 1Q6ZA 3HWWA 1A9YA 4HFJA 4M37A 4QIHA 2M1ZA 2A1TR 4O2AF 2QT9A 4MRMB 1RKBA 1T8UA 1U6IA 1U9IA 3AG6A 3GNSA 2GD2A 3HN6A 4P35A 4R2KA 3WB1A 1AQJA 5LVAA 4W5TA 3S81A 3DONA 1JYFA 2CDCA 2G36A 4TVBA 2GYUA 2Q46A 3IPRA 4GXQA 5KAMA 2AE1A 4GPTA 2ZAYA 2G4CA 3DLHA 4RD6A 3CNNA 3QLEA 5L3VA 3D3JA 3ZHXA 1YOBA 2GKGA 5J1SB 5ICEA 4GBGA 4M2LA 3TUIC 1XEWY 3EVBA 2DJIA 4ABTA 2PH3A 2HTFA 1GKLA 1D09A 1EAYA 2F9MA 1NDUA 2J48A 2ZJ8A 7YASA 4U7DA 2VK4A 4QBFA 4TM7A 3WV4A 4ZEMA 4JYAB 1ZO8A 1NQWA 1W0CA 3UOAB 1DFIA 2JCYA 4PX2A 2PK3A 2O5RA 3OQIA 1ZOIA 1EFTA 2ZSBA 1GTZA 1WMBA 2H3EA 2JL1A 3NDPA 4B6EA 1S2LA 2XOXA 4M6WB 1H4QA 5LIRA 1TYDE 1XR3A 1N3YA 3A32A 2W2MA 3EE6A 4HWKA 3P0FA 1CJMA 4IX1A 2NSLA 4ASUA 3V8PA 2O0JA 2IZ1A 2KPOA 2FRVA 2ZDHA 1V45E 3TJZA 4HZIA 4ZAGA 1HXHA 3V8QA 4E03A 2J9FB 4D25A 4RZHA 5K8CA 1JUDA 4HDKB 5TMEA 1MB0A 3Q9LA 4PFSA 2XUDA 3IQIX 4AC9A 4ZMRA 3W9UA 1Q1GA 1RPTA 4D5EA 2H11A 3FPGA 2D3WA 4PG5A 1FJHA 2GA8A 821PA 1HG0A 2XOKD 1B7GO 4TXMA 5K6AC 1C3XA 2V3VA 3P0EA 3U61B 1EVZA 4YH1A 2QBYA 4QAJA 4EF4A 1ZJWA 1VMDA 1OSNA 3MWYW 4OUDB 4FYJA 1RYFA 2XQIA 2KSQA 2XY4A 5ICCA 4HBGA 1OWMA 3AV0B 2OBLA 1SBIA 2XCIA 3JZDA 3IR6A 5ALYA 1ZVVA 2IP1A 4QARA 5JMOA 1FRVA 3EW7A 3HTXA 5IG2A 4F6CA 4EYGA 1T26A 2OG1A 4HH0A 1SOWA 3A26A 4GKVA 4FGWA 5HF9A 1NVBA 3ORSA 4WK0B 4TYPA 2MYNA 4KN5A 3S0JA 1AS2A 2VDUE 3C2QA 3EGWA 4TLEA 2NLOA 1B8PA 1GR1A 1QH1B 3BAZA 1ZUNB 1TX4B 4P5DA 5B2FA 5K0CA 5CDGA 4BE7B 1E1QD 3K8QA 4L85A 4EJFA 2FZLA 3BGWA 3KPYA 4DLZA 2M6RA 4ENWA 1YR1A 1A97A 1KE1A 3I3SR 1W0KD 2KMLA 1ADBA 3H16A 4TUYB 1EU1A 2C94A 3OQPA 4ZRDA 4M9CA 2NPIA 2PT9A 4BFWA 4PPGA 4C5CA 3MT9A 1DOZA 4AYWA 3ND9A 1MTOA 1W0JA 3SOZA 3EH1A 3BK7A 4E70A 2O19A 5HMLA 4ZOCA 1KIMA 5LZ8A 5IKMA 4NESA 1ZAYA 2EL7A 4IDEA 3UZUA 1S2DA 2H9YA 4FR2A 4QBHA 4Q7QA 2VNAA 3KOYA 4KR2A 3STUA 2KX7A 3UA4A 1YJXA 5CDFA 4X6LA 2OFFA 2WDPA 1SM4A 2WWHA 3L0SA 3H2BA 3P9NA 5GJBA 2ANCA 1JG2A 2VVTA 3GFBA 3SFVA 4QVIA 3GQBA 2X4DA 1AGYA 3AILA 4TTQA 4JGBA 4OG2A 4RQAA 3WADA 3CZ5A 4DIUA 4M3NA 4TTJA 4QQRA 1CY0A 4LXTA 1QLJA 5EXDA 3UK2A 2Q0HA 1U8TA 2GTHA 2XZTA 4ER5A 4ZVVA 5CVCA 1KGSA 3CKMA 3MUNA 2Y8EA 2Z0MA 2PSFA 3O94A 3R5XA 4R68A 2GBFA 1R3UA 3ORYA 3MMXA 1MN6A 4G5OA 3H5AA 2ERXA 4J6FA 4QQ8A 3SM9A 1EVYA 3VKVA 3RBXA 2NTYC 4YAWA 2RHHA 4TKUB 3OZGA 3WNZA 4EUSA 4J7CA 1FB5A 3HEAA 1NJ6A 4I8IA 3J81A 4LOLA 1KVTA 2BDTA 1IY1A 2PQ0A 3I2JA 3I30X 1IK4A 1H6AA 4BE9A 1T2CA 2QG9A 4WFKA 2JD0A 5KSOA 2JIPA 1QO7A 3NDRA 3FROA 3PHBE 5CX1B 4EO7A 1IUOA 3ZGOA 3NVMB 5H70A 4PPFA 1ZNZA 3TQFA 1W5AA 3DAHA 5FI3A 3RS2A 3R4CA 4Q93A 5IJ9A 1Z8HA 2C5EA 4JCOA 1J8VA 1EA5A 2SHKA 5IDVA 3BMOA 1LBHA 1QFJA 3ONWA 2FE1A 3ANYB 3FFAA 4YV2A 4D8UA 2F3TA 2G9QA 5C7YA 1VP3A 2JIDA 3CJRA 1CDOA 1DP4A 1U2DA 1ORVA 2QX9A 4BNXA 1DV2A 4CUJA 1Y6JA 4ZCIA 5HKKD 1LF0A 4Z1MA 3JQBC 2P75A 2P91A 2XMDA 2FSPA 2JBAB 3EIQA 3TTSA 4LISA 4YIHA 3EF3A 5DPMA 5I7RA 1T6BY 2H4XA 3EASA 5L3SB 2HMYB 4QDTA 4GGOA 4JMPA 1FDVA 2QRMA 5T57A 4L5YA 3V42A 4RPHA 1XN4A 2E87A 4IZIA 1C2TA 2HHJA 1XA4A 3K70C 4S0ZA 3CBGA 2ZE8A 1L9XA 5KKAA 4KWTA 2W2KB 3DM9B 4KG7A 2NU6A 3OO1A 4PX3A 4EKEA 5GZ6A 1OFUX 3QFTA 3ZVNA 4CTKA 1DAHA 4RL4A 3TG8A 1A2KC 1P81A 3EGDB 4HPXB 4MRNA 4FUTA 4ENTA 2F17A 3MINB 1YIOA 2IVZA 3IQZA 4UMVA 3URKA 2N46A 5ED0A 2XNSA 2LR0A 2HW8A 5EKUA 2UVQA 5EIEA 1Z88A 4LDZA 3RFVA 3I73A 4JI1B 5LMCA 3G0IA 4MJ7A 4MUMA 4RABA 2H7XA 4OFBA 1JG3A 5D2CA 1VCHA 1XEFA 1JGTA 3LD9A 5JNVA 3U16A 1W96A 2QN8A 2VSFA 3PCTA 4M83A 1K9SA 1HNWB 4Z4QA 5AUQA 1JDTA 3G68A 4R8SA 1CJKC 3GJ4A 3IP3A 3MS2A 4QLBA 4FW9A 4WASA 3W77A 1OHHD 2WV9A 2Q49A 3AM5A 3DEKA 3MCVA 4AZSA 4AN4A 2FVYA 4E15A 1T3TA 1LZLA 1OXVA 3BQMB 4PAGA 2HFJA 4JWKA 3KPUA 4HVLA 1WA5A 4YCDA 3F78A 4B47A 1A98A 3FPLA 1ZBQA 3A3KA 1N8SA 2VBCA 4XB6B 4YPOA 4MVJG 1H1LA 4N5MA 3EDMA 3AU8A 4EZBA 4N8SA 2CJYA 2JHPA 1EB9A 5IJAA 2JFQA 4FYVA 5DN6A 5E6SB 4F3TA 1XPOA 1GSHA 3LKDA 1YR8A 1DKUA 3AFGA 1KO8A 3EVDA 4IEFB 4U2FA 4D6XA 3Q8MA 1D1PA 4KREA 4UE2A 2CC2A 2QSJA 3PPWA 3HXPA 2JASA 3B6ZA 3B3GA 2UYYA 3C6BA 5HR5A 1HGXA 1MR3F 1Z0IA 2X86A 3BRQA 4OAOA 4AMYA 1H94A 3M5PA 4EABA 1EUYA 1YBMA 1W36B 1L3IA 2DRIA 5L3QA 5DWDA 4TQ9A 9MHTA 4H4EA 3H65A 1QIJA 2QXUA 5F98A 5DK4A 1DBVO 2IY9A 3QWIA 1OYWA 4LJYA 1OC2A 3QVKA 1JDNA 4G1FA 4IGEA 1Q21A 5LQCA 1JMYA 1LNQA 5U1PA 2X5NA 3Q3JB 4GOKA 4IIHA 2ATCA 2OB1A 2QTGA 3C70A 4P83A 3VU1A 4KACA 2I34A 2E1RA 4MWSA 4FOPA 3U5TA 2QW1A 5KTYA 2C7QA 3G2NA 5LZ9A 1W1WA 1RADA 4J90A 4D74A 4Q7EA 2E48A 2HMSA 3V8BA 4D4GA 4DY6A 4RQBA 1AN9A 3OD5A 2QMUA 4KEAA 4XAQA 1G21B 3A11A 3E3LA 1DRUA 5IAGA 2VZ0A 3UK7A 2ZJBA 4TV8B 2C1ZA 1YTLA 3KC2A 2FPGB 4RDHA 3TNYA 4C4TA 2J0QA 1KMMA 2W6OA 2UUBB 4PTLA 3LXRA 3TS1A 1PFYA 3O0TA 2YXLA 2CXOA 2G09A 3WK8A 3BXXA 1QRUA 4HAYA 4DIFA 5GV8A 2FWJA 4M89A 2ZBFA 4PLGA 3STHA 1BJKA 1I3OA 1I5OA 3I1JA 3ZWVA 4I1VA 1JMVA 4ETNA 2CXUA 3D5QA 5EZQA 3WIVA 3T3NA 4JB0A 3A6GA 1SBCA 4WZAA 1QIDA 1PQYA 3R20A 2PRZA 2Q3LA 4WT7A 3SSOA 4ZDIA 2FKNA 3T52A 4K2HA 1EE2A 4KIGA 2IEYA 1E0KA 1A9OA 4HUQB 3RB8A 1WG8A 3RSZA 3A05A 3IIIA 3CLUC 1ZGCA 1XTKA 1G0OA 2JS7A 4OKSA 4AZ3B 4ES6A 2R85A 3DOHA 4K9NA 2PBRA 4R3UC 2HT1A 4C6HA 5ALZA 3WZLA 4HXYA 2VYVA 3SGLA 4NL4H 3A0RB 3DYVA 1E8NA 1JIXA 1JSCA 2HK9A 5KSPA 2AS0A 2YWDA 1EX9A 2D1FA 1BZYA 2WTEA 2JGKA 4OXRA 4F4FA 4PC1A 5C2JB 4P36A 1J49A 3X44A 1E4EB 2WYWA 3A8TA 4S1TA 3LF1A 3IS3A 3AQIA 4MPTA 4H0CA 3AEZA 4B6PA 3O75A 4IGAA 2PS0A 5GV7A 1TQDA 3HXTA 5HE8A 2FTKE 4J16C 4WZ6A 1MB4A 5DYTA 3SK0A 1PJSA 4TWIA 4JJAA 2C5SA 4YJ3B 2C88A 1WSBA 3DE6X 3W5SA 1NYQA 2NU9A 4LC9A 3UJNA 5IKEA 3V00A 4W4TA 3DFIA 4YCNA 2WY2D 4GL2A 3AUJB 4JI2B 2WAMA 3U4IA 2BGMA 1YQDA 4IHJF 3WG9A 1ST2A 2HI0A 3I8SA 5JS1A 2POCA 3IILA 4DLUA 4GGPA 5DTQA 1P7VA 2VPQA 5LU8A 3Q0TA 3JARA 3KB6A 1UT5A 2R4QA 1IHUA 3U3MA 1XQ6A 2GCIA 2J6IA 3WHPA 2IH5A 1CEEA 1HT2E 1SXQA 4HDMA 1OBVA 3CW2A 3PVCA 4OHFA 3H5RA 4CCAA 3EN0A 1KP2A 1OH8A 3R9XA 4S05A 1U2ZA 4P92A 2Y27A 5DWQA 1Z62A 4LE0A 3GT0A 3PX3A 4EGJA 1QF6A 4CETA 2J87A 2R7NA 3MTDA 2QG6A 4FFDA 5CYOA 3WY9A 2QJWA 3A9SA 4RFLA 3AESA 4L78A 1MB2A 2X76A 1C9KA 4HLUA 1RM5A 3DGFC 1NAIA 3KELA 1I3CA 3N76A 4ECAA 5BWMA 1K6EA 2OFPA 4HF7A 2WFZA 1PTJC 3DOOA 3KYCA 4K0KB 1Y9DA 4RMNA 1AURA 2H5EA 3FTEA 1EEXB 3L6DA 3R3XA 1G19A 4F2WA 4ZAXA 5DT9A 2XOEA 1SQ5A 3B89A 2ZRGA 5FPHA 2F3PA 2XUOA 2FMTA 2JZOA 3INNA 3NM5A 1V7PC 2J3KA 2FJ0A 3JAWB 3OE4A 3WLMA 4UTVA 3E7FA 4YR7A 4D3ZA 2HYDA 2RGAA 3OD1A 1YC5A 4KFRA 5K20A 4MV8A 4WXPA 3RSFA 4AWAA 2WNSA 4PR3A 4LJ5A 4ZQIA 5CB4F 2VT6A 5AQEA 3GA5A 3TCXB 4OA8A 4UVHA 1KMCA 4CKXA 4NNJA 2YR0A 2JGJA 2X4LA 1B23P 1IY8A 1S4QA 3L7MA 1FFBA 3Q6NA 4FMDB 5C34B 1AKWA 4QBKA 5KS2A 2QP3A 4WI1A 2D5BA 3AV3A 4G0YA 4GX0A 2OCIA 2J46A 1WBJB 2QTBA 2W6QA 3NNNA 1R5NA 1N5JA 2HLHA 4CLOA 3VZBA 5FTKA 3DMTC 2NSYA 2SKEA 1KEKA 1D8TA 4JGIA 3NW9A 1ZD9A 1Q1QA 3QWBA 4QWMA 4HQKA 3U0VA 3VYUB 3GB9A 5NLLA 5F33A 1ARZA 3PGVA 1ZA2A 1THMA 2C9CA 5JCZA 3DO6A 5EJFA 1KMIY 3HZHA 3GUZA 1FP4B 1A88A 1EVEA 3Q3EA 3R3VA 3G5LA 4FONA 1F5NA 1SHLA 4FS3A 5TF4A 2XX3A 4WN9B 4DMCA 1CJVC 4DV7B 5TXGA 3IE1A 1PJ2A 3LQKA 1VKNA 1AXGA 3W5IA 2IE0A 3R5JA 3PF8A 4TL8A 4YT2A 1B6RA 2RONA 1YDMA 3O92A 2X3FA 1ZGAA 5BVHB 3PNSA 1U65A 1T0IA 2Y1FA 2ZXEA 1RQLA 5JAUA 1Q44A 5LQRA 1SK8A 1I4WA 3F96A 1KDRA 1SZCA 2ISCA 3ZDZB 5U4QA 4MLCA 1XMSA 4EBBA 2OP1A 2ZJ6A 4M1OA 5ALPA 4BZPA 2W9XA 3ZLVA 1HQDA 2Q5JA 4CKCA 2I67A 4HDSA 2FHPA 4C9BA 3A1VA 5A3RA 2HJWA 5JFGA 1TM4E 1YASA 3HVUA 5FUMA 1C29B 1Y1PA 4JB8A 4QXOA 1KVUA 5HIIA 4BB6A 2A78A 4NAUA 3OTIA 1GU7A 1YHNA 3QE0A 3SSNA 2VG8A 3OPNA 3TOZA 4G0WA 3B6EA 1H1DA 1XZ8A 3F73A 4HUJA 3TZLA 4ALNA 1P3JA 3GJ6A 1ZU4A 4EKYA 4YMHA 1G2OA 3VUEA 3OWHA 2VNHA 2FR1A 4Y1GA 3DV0B 3HG7A 4C30A 2BBTA 1GZHB 3DKIA 2YWHA 1GYRA 1LZKA 3PXCX 3C3XA 2FP4A 2PY6A 4HH1A 3NONA 3B1ZA 4JUIA 2X7JA 3GU3A 2CLIB 4KXYA 1XX6A 5IC4A 2CN1A 4NBTA 3IOYA 1RKVA 4YA6A 4Z6KA 1U3DA 1VL8A 4OHVA 2BV3A 3EH2A 1DB3A 1OPRA 1H9BA 2IHKA 4O2BF 1XSEA 5IC5A 3TSOA 3KWMA 3EPPA 1GM5A 4LC0A 3ZX4A 3G7NA 2VSOA 4JQCA 2Q3FA 2D7CA 3G0CA 3T7KA 4E6PA 9ABPA 1QG2A 4IVRA 4K0RA 4UFOA 1PS9A 1X19A 3TI9A 2TYSB 2OOSA 4KDEA 3ZZ0A 2AKAB 2G6BA 1NFQA 2FRDA 1TMYA 3BE4A 3I2GA 1SUAA 3NOXA 2H1OA 1W4LA 3IBFA 1EP9A 5L4NA 3R0XA 1KEPA 2O2DA 3S7ZA 4D9IA 3RS8A 3W4JA 1JT9A 3PLNA 5AK4A 5D01A 4KNVA 4DDHA 1R5BA 3UW3A 1F7UA 1X8JA 3QVMA 3EIWA 4LYFA 3VDQA 1IUPA 2JJ1D 4TS4A 3H9QA 2G08A 3TEJA 4HDAA 5KVSA 3K72B 5IH3A 3ZE6A 1EK6A 2AOUA 3JCZA 4BNZA 4CI9A 2VXOA 1UF9A 2ZSDA 3RODA 2WWRA 1P4HA 1U4SA 1ML4A 2GKSA 4GSKA 2JANA 4MO2A 5D87A 1VLQA 3UB4A 3LQ2A 1F0YA 4FZ3A 3ICOA 4WOKA 1OH5A 1OFTA 3KJZA 4FYMA 2WWFA 4RF2A 4DA9A 3BH7A 5B7NA 3P4UA 3RSCA 4RTNA 2QF7A 1W9HA 3AVOA 2XE4A 1DJPA 1HEIA 4NARA 1KH1A 3HBMA 4UAJA 6PFKA 3PL5A 1B41A 1AQLA 3CLSC 4WA8A 2QVZX 5FFNA 2DLDA 4WKCA 3WKAA 4BNVA 3D1JA 4MWGA 3VR6D 3C87A 5KINB 2OCDA 1HE5A 1RWXA 3ZWQA 1WHSB 4MGZR 1EAMA 3V55A 1IHOA 1VPLA 1MJFA 3LWZA 4KZKA 3ZCSA 3WIOA 2JPDA 1WAMA 2GN4A 1NJ5A 1KF0A 4A8JC 4FB5A 2PX3A 3OZ7A 2AR0A 4H16A 4TQUS 3B78A 3CIFA 1AHPA 4PLFA 4KFCA 5DHQA 1KPIA 4O4HB 2JLXA 1IY2A 3RVRA 3NORA 3IVCA 3V7WA 3AERB 2CWDA 3PSHA 3BL5A 5I3CA 2H5IA 4E21A 4TTSA 5AW7A 2VRWA 3DYIA 5EJ2A 5BN4A 1I5EA 4QFMA 2XA1A 4CQLB 1NBOA 4CDGA 4ND8A 4YUWA 3MBKA 1AXRA 4QJIA 5J1TB 4HAVA 5J2TF 3N8IA 3GFSA 1RLUA 2O8FA 1BSVA 5KNDH 2WE8A 3VHXB 3WO1A 4K03A 2Y0PA 3IKJA 1RLMA 4BV8A 2LKDA 3UJCA 3QFFA 3W0LB 3ETEA 1AV7A 3LT5A 1E59A 2NZWA 2RGDA 2PUHA 3DWIA 3GCGA 4DMRA 2J31A 3URMA 3U3KA 4KQWA 1ID8A 4JNCA 1M2OA 2Z9BA 4DBLE 5J4VA 5KNBD 1D5WA 4DB4A 2X0DA 1LS6A 1NJFA 3V8NA 2CE2X 4IG4A 2OZKA 4AFNA 4C7OB 3PE3A 2AJ8A 3X2SA 3W3AD 3ZCVA 2G0AA 2R7LA 2Z5FA 3EIUA 1AT1A 3RBVA 2NVOA 5DI9A 2OAEA 1JKIA 3N2KB 4E5VA 3H8WA 2OHFA 2A57A 3AHEA 4RNDB 4XIFA 4U1RA 5KDDA 1YWGO 2QLTA 2HOQA 1EFRA 3C5HA 3CZMA 4G09A 4QPDA 3L1IA 5G4KB 5JAOA 2XF8A 3ABRB 1WPXA 4Q1AA 5ALDA 3FKSA 4DRYA 3DB1A 2LE0A 3WLAA 4ZC1A 5EP3A 1FIUA 1PS0A 3MMZA 2I6UA 4DBVO 4DLLA 1E9BA 3VR5D 3RI3A 2WM9B 4CEIA 3B2EA 3GLHE 1YVPA 1GY8A 2EFHB 4MTLA 3A1FA 1K4KA 4M8LA 3SLGA 3UJDA 1PWEA 5CP8A 3V8EA 2IKSA 1VG0B 4Z7JA 3T9EA 2OGUA 2CDRA 4R9UC 1GNTA 1R18A 3D7MA 3F2VA 1Y3IA 3PEEA 4KDCA 1HDEA 4F5EA 4F60A 3NJ4A 1PUXA 3OZSA 2J0SA 4CTMA 2O2HA 1AJEA 1M75A 4Q12A 4RKRA 4RBNA 2X0KA 4EW3A 3UMGA 4O2AB 4D0GA 2SBTA 2B92A 4MMZB 2J9YB 2VZ9A 1U3WA 4OQXA 3GVPA 2CD7A 3RKSA 1C3LA 1OROA 1RFGE 1RRVA 3RRNA 2Q6LA 5I4CA 5KYWB 2AI1A 4DR7B 4GMHA 1DKOA 2HNKA 3M83A 4LTNA 4NEGA 4NIMA 1CUGA 1F12A 5EC8A 3F49S 1XKTA 3U19A 1EM8B 1M76A 2FMUA 4P4LA 3RBAA 3I9KA 3SKXA 4S1WA 5J40A 2Y77A 3P0IA 4ZT5A 1DLIA 3ZS8A 3MJHA 5DW0A 2D7DA 3WIBA 1KOGA 1XPUA 1JHUA 3DMNA 1Y4SA 1F38A 2GFHA 1DVRA 1GAWA 1GOTA 3AZPA 5C8VA 3E9DA 4BFLA 2SKCA 3B12A 5FQOA 3U3DA 4HX9A 3EFEA 3SR4A 3PFWO 1Y5MA 2X9VA 2QAIA 4UFPA 1I2BA 4U0JA 2RAVA 1G41A 1P4AA 2YWGA 1SD2A 2XZOA 4G85A 4U9HS 3S8MA 1ABFA 1M34E 1BDJA 4PM4A 4E5MA 1MZPA 1L8AA 1XLVA 1L3BA 2XQGA 5HHTA 5JSQA 1LVHA 1EWVA 5KDLA 3ETCA 1N5DA 2QRGA 3HCOA 1GSAA 1SXJC 1UBMS 3J80A 2OGSA 2EW8A 3IOCA 5AI5A 3VR6H 3M49A 3GAZA 3VOTA 2I29A 1S3IA 5B1EA 2XMZA 4EY8A 4D9BA 2EJTA 1TFRA 3L0BA 2AN3A 2C57A 3SC2A 4MV7A 5ALUA 5AHRA 2QSZA 3OPMA 2PMCA 2FU5C 3CU5A 1RI5A 3D8BA 2BJHA 3GJSA 2I9PA 4B6RA 5E9AA 5JARA 2VTBB 1X6VA 1XVVA 2Z8ZA 3TLXA 5IYZF 2P11A 2YZNA 2EEZA 3RREA 3UY4A 3MQ2A 5IM4F 1NVFA 1HPLA 1M7GA 2NYVA 4UBLA 3HFRA 1KFEB 3D3NA 3M6WA 1EX6A 3GBVA 2J9XB 5FR1A 4GKKB 2Q5HA 1FPQA 3N8KA 1SH7A 3JQ9C 4QGGA 1IE3A 4EQ6A 3BILA 2QE7D 2RH4A 3MWGA 4IHKA 4URFA 3RSOA 3I61A 2AOTA 3T1VA 4XD2A 4YX9A 1R6TA 3BQ9A 2VPTA 3ESDA 4OO3A 2CXQA 2PX5A 4KTTE 3V8MA 3AI2A 2D1RA 2FPWA 1YCDA 2YJZA 4CEHB 4IDDA 5HG0A 3PZBA 1SU6A 4UULA 4BRSA 2FX3A 2H59A 2UUOA 4J91A 4Q9NA 1V1MB 1OLSA 3HU2A 4DMGA 4DVJA 4GNKA 1QK5A 2BTEA 1EFAA 3NEYA 2BGRA 3ZDRA 4HLNA 1FFXB 1E7RA 1XTQA 3OIFA 4JEMA 5JAPA 2VO1A 1LBEA 1ISPA 4EAAA 3TEFA 1KQGA 2PQMA 4L28A 3AF6A 2Y4NA 5DEOA 4IDPA 1LI7A 4Q1DA 1KI6B 5G0WA 4UEJA 4B3RB 1UDBA 4FX2A 1CY6A 2J9GA 4FUQA 5HTKA 5LIPA 2FV8A 2I1QA 3ZYCA 4D0LB 4D9FA 2XKJE 3Q9SA 4EB8A 1Z26A 4I2VA 3C45A 4PXSA 3DMDA 2F4NA 3ECCA 3F90A 4MHOA 4R2JA 5FYDA 3ZWPA 4YUAA 1OA0A 4YQZA 1TK3A 3KALA 5E7JA 1R9JA 2CKMA 2I4IA 4MI9A 1W93A 4RAOA 4ZI7A 5CPBA 3RVKA 2QLMA 5BT8A 3UK6A 3A4LA 2O8BA 2PGNA 1EDZA 3IHWA 3DOCA 3C3EA 3DDCA 2GO7A 3SJBA 3TCKA 4F9EA 5AKYA 4C0WA 4NCJA 3WHKA 5IFLA 1JHDA 3IEVA 2J9ZB 3EG9A 1DBPA 1WVIA 4OI2A 3U3OA 3H9UA 1OIVA 1SQ0A 2GDJA 4FDAA 5D5QA 5EESA 3M4XA 3HH8A 2IYAA 4RPCA 1I3KA 4RGBA 2QDXA 3GYBA 3RT9A 1Q1BA 3TMAA 2P1DA 4D3XA 4DFDA 1AZWA 3CXRA 4TKZA 4UM7A 1KI8A 4HWPA 1IC6A 1ZHHA 2EF1A 4G89A 1GR0A 4W82A 3TG2A 2P7HA 1UC4B 5J5CA 1UZUA 2GDZA 1MP0A 4AJ9A 2D0OB 1NOIA 3IALA 3QOWA 5A5EA 3R6TA 5EGSA 3N70A 1T0PA 3SJ7A 4DZRA 5TC4A 2YWEA 4YDQA 4OJYA 2C9ZA 3D6UA 4JL6A 3ZOKA 1HRDA 3AR5A 4K9OA 1HTWA 2GT1A 3LX8A 1XAIA 3JAKB 3CNHA 1LLUA 4I08A 1Q57A 1G5PA 5L6LB 3ONDA 5J58A 1SUCA 5E9WA 5E8RA 1BMQA 3OIVA 2CNLA 1J1IA 4LJ4A 4WQMA 1WZCA 2PXHA 2GZSA 4IIJF 4XYMA 2DFKB 2O1XA 3GJ7A 3JALB 2YJNA 3DM5A 4JL5A 1X7DA 4XDGA 4IGKA 3DLTA 1CRZA 3GVHA 5JS7A 3QEBZ 2RGEA 2Q5FA 3KSZO 4P4GA 3PFNA 3PENA 4NBWA 3VZSA 3ANTA 3D3QA 2E2WA 4JU8A 1WRBA 4V1CB 1C80A 1PJBA 1JLRA 2A5JA 2C7BA 2BBWA 3B51X 1DXQA 4IO1A 3M81A 4KB5A 4KLNA 2Z6QA 1OBCA 3RIEA 5A4JA 3LK7A 1NSYA 3U4GA 5C4MA 4Y2UA 4DQKA 1A0OA 4ALJA 1CX9B 1OT5A 3IA7A 4K8OA 2CV0A 1PGNA 2W2XA 3DH0A 3F5MA 5CW2A 2MINB 4M54A 3RUDA 4B3HA 4RQUA 4G4GA 5G3ZA 3VO2A 5MFPA 3RK0A 2XNDD 1PYOA 1U2RA 4KNYA 4P08A 3L8DA 1W5FA 2DKFA 5IKOA 1CK4A 3LC2O 1AQIA 4LBZA 1MV8A 4FN4A 3BCUA 4YMUA 1U9JA 4CLRA 4HSEA 1FU4A 4PYOA 1XTJA 4L4RA 4BL5A 4PRLA 2JVIA 4P38A 3L4EA 4G9GA 1KI1A 1N32B 5KNBH 3WGVA 2QR5A 1OR8A 2X0IA 3MWEA 1JPUA 1VJTA 2AC4A 3F8TA 4K86A 5JUWA 2PZLA 1XPJA 3O8QA 4OLBA 1XA3A 3W3AH 2HY7A 1KYTA 3KOMA 1BE0A 1U0EA 4K6OA 3LWBA 3L7AA 4I5EA 3ZVRA 1ZICA 2FWAA 4BDSA 1YZGA 4W8OA 5HF8A 1ZRHA 3SDBA 1RI2A 2DFDA 1HG1A 3FWHA 1O0CA 1UT6A 3UAOA 2C2KA 3IYLW 3TXYA 4I8DA 5BV0A 8OHMA 4DMFA 3KSUA 4UTNA 3DDZX 4HWTA 4NNPA 1KZ4A 3AL2A 1GSOA 3BB1A 4RVFA 2AX3A 1NOJA 1MC8A 4IUBS 2VPIA 2EYQA 2Q29A 3S40A 3VR5H 4I4CA 3LDAA 2WD8A 4L16A 1QUFA 4WK4B 2JFWA 3MELA 3M1LA 2DF8A 2YHIB 2FSSA 3E2PA 7REQB 1B4DA 1XCOA 3EA4A 3NX4A 5D7NA 5DF1A 5EIBC 1Q1EA 3JYPA 1NVEA 4GYKA 4CQMB 3KL4A 3HGQA 5IFKA 1Q20A 1Y9ZA 4CIDA 3KSRA 1U9YA 2GM4A 1QKKA 3DNMA 5F3WB 1LLDA 1JYSA 1NNSA 1LJ8A 5E3IA 1XHLA 3BYZA 5LBUA 4BO0A 4DR6B 1ZXXA 1Q1ZA 4IFIA 3L7KA 3ZDXB 3KPWA 2BISA 2GXSA 4E3ZA 1DC4A 1NAHA 2XGSA 4UUBA 3D1LA 1H69A 1FY2A 3COVA 3NBAA 2PEZA 5LB4A 2P8JA 3AKDA 3DMFA 3OO0A 5JAMA 2W4QA 4B4DA 3DULA 4U6SA 2BMVA 2ZATA 1C1HA 1IZ0A 4OGKA 1IH8A 4V1CI 2WJ6A 1TECE 5BYJA 3COPA 5AIBA 3L7DA 5DGHA 2YRXA 1ISHA 5I48A 4GM0A 4DTIA 3FPAA 1P17A 4HNUA 4Y8VA 2F1JA 1GEGA 1J2UA 1E1CA 1FRFS 1TK9A 3AH8A 1DCFA 5AXDA 2AIRA 3L9XA 2WOJA 2YMMA 4YMSA 1VXOA 1KI9A 3X2FA 4LG1A 4GR5A 1BMDA 3WL3A 3CWZA 2QRZA 4RFSA 3KUDA 3CPSA 4PHTA 3WMEA 3AP2A 1DIGA 3W7VA 1Y33E 3ELWA 3IQXA 3SR3A 3T9AA 4ID9A 4HNRA 1T8YA 2C4NA 3PNOA 4J0GA 1BJTA 4R2IA 3W7BA 3JVDA 5JDCA 3V7FA 2C1EA 5D86A 4Q1VA 2ZUVA 1QZZA 1T5DX 1A9XB 1U28C 2NAPA 5BW5A 1FRQA 3QMVA 3UMCA 2JJQA 4RIHA 3TW8B 4ZQGA 2ZR8A 5JFOA 1EGQA 1UOEA 4LJ9A 4ICIA 1AK9A 4QUHA 5DNEA 4KXLA 4E5DA 1CUJA 5E2BA 1Y1RA 3UMBA 4L76A 4GKAA 1TYAE 4KVFA 3RG2A 1YS9A 3UANA 3OSZA 3ZYZA 4JZKA 2R6JA 4PSAA 1MOQA 3IAHA 2OWEA 4NMWA 3ZY4A 2RGUA 3DBRB 1R8YA 3A1DA 2P9FA 2UKDA 1C0LA 1QCZA 1YL5A 2MWMA 3LKVA 4G5YA 4HNAB 4X8LA 4V0QA 4CV3A 5HKAA 3UWPA 4Q3CA 5DX0A 1VG8A 3DTYA 3G88A 3Q4GA 3ZNNA 3O8OA 2WM3A 3MCUA 5I45A 4N76A 3L4SO 5FAXA 1U7UA 4IAOA 4F4JA 3TXAA 1QVAA 1GGFA 5LCXA 5BWBA 4JX8A 3WWOA 4A6DA 2VDOB 1NHGA 1PR0A 4NMXB 1UOOA 1GSIA 1KYXA 1RR6A 3EXFA 3L8HA 3P9QA 3DTVA 4TVOA 1MCZA 2DPYA 5CLIA 3CVVA 2VZ8A 3AR7A 1G4HA 3AY6A 1NP6A 4IHJB 2XDWA 5T6MA 3OQBA 3D2LA 3F4BA 3MLEA 3ETGA 4I9NA 3LW8A 3N2LA 4N82A 4YECA 4BCBA 1KQOA 5BURA 1XO1A 2W11A 4ER3A 2I6TA 5C3UA 3TQIA 4QD3A 2ILVA 5F5NA 3WGZA 1LBIA 2BH9A 3F1LA 4J8PA 4LDJA 3T9FA 5HUJA 2YV1A 1WIWA 1H2YA 1GPKA 1H2AS 1TU3A 1UK7A 4JLJA 4DA7A 4JT8A 5CHYA 4YJGA 2BP7B 1UK8A 4M76B 1P18A 3INGA 2GPSA 4P33A 1KU6A 4AJNA 4A5OA 4IVPA 5DULA 3CLVA 4I7EA 2CF5A 1JKXA 4LHWA 2B4RO 1XRLA 4IMJB 5DBOA 3R7AA 4BLRA 2ONYA 4NXMB 5BMVA 4WH0A 1QOPB 4U2EA 1BDIA 3H3FA 1MT3A 3HJUA 4DT1A 1QCYA 1WM1A 3RUPA 2IYZA 3CW9A 5CVDA 1ZMBA 5LBTA 1RYBA 4LZZA 2R96A 2P6PA 3IP1A 1XTBA 2PT6A 5JJCA 3AHHA 1AA6A 1S8AA 1S0UA 1X1DA 1FZQA 4ZDKA 1JLHA 3ZV4A 1W2HA 4PPQA 3QFHA 4RZXA 3JSAA 1ZL0A 3HLYA 5SZJA 3JD4A 3EEIA 3R3SA 2HB6A 3DF9A 4DQLA 4BC1A 2KI5A 1YRBA 3UAZA 3EOAI 4JBNA 4U3JA 1FP2A 4FPXA 4YRIA 4N39A 4PG7A 2AMFA 5C80A 2EZ8A 1CRLA 3WLQA 1V1RA 3Q5GA 5CB4B 5K09A 1BS1A 5EHXA 3A1CA 2WA2A 3CUUA 1TJ4A 1XKXA 2VNIA 3JATB 5I7EA 4AKHA 1JQEA 1T9GR 2EKZA 1CZKA 3GJ0A 4R1UA 1WDTA 5EWLB 5F12A 3WJAA 5A7FA 3RJ5A 5KYGA 2RHLA 3GCDA 1WMDA 1KMQA 3V97A 3O1LA 1K2VN 2CCKA 2QN6A 3CNOA 3K7EA 3OE5A 4LZLA 5AJHA 3D7KA 5A4IS 2XUKA 4JLDA 3TGPA 3OJFA 5G1NA 1A3CA 3LG2A 4FFSA 6REQA 5JCJA 3O9VA 2GA9A 3I5AA 5HDQA 3QK7A 5I7UA 2VRCA 1XZDA 4PZEA 4H77A 4ROTA 3KOXA 5EMLA 1MQ9A 1XWWA 1ZITA 2HJVA 3F9IA 4EDFA 1DXHA 2HTEA 3AFOA 4JAVC 4MVXA 4P3OA 4ENUA 5K3SA 2NN3C 1VCOA 2GK6A 1SUSA 5KNDA 1LX7A 1QB8A 4FOTA 5J5VA 2ZJ7A 4LMBA 4BMYA 3LT1A 2FK8A 1GCAA 2WHPA 2DECA 1QKIA 2X0FA 5DHUA 3ROQA 2ACWA 2MDTA 4EYKA 2BLNA 2FW7A 2IU6A 3KOOA 2IDJA 3A6DA 3KLMX 1ZDMA 3TDNA 3EXEB 3MILA 1CIJA 2UXCB 1Z8FA 3W6OA 1QAMA 1VLLA 3KNZA 4HLUC 3UTDA 4XRGA 4M7PA 1C1DB 5CW1A 2E37A 2W2LA 3EWIA 4OMFG 3QLJA 3JVVA 1XTTA 2B7CA 3DBOB 3GL9A 5HE9A 1RHMA 1BD3A 2AWNA 5EMMA 1KZGB 3CWQA 4AQDA 1G9SA 1ADJA 1CUUA 3VC2A 4IW3B 4Q00A 1NKSA 1L5HA 1YB1A 2XT0A 2AF3C 2H2DA 3OLWA 1JI0A 3GJTA 4PCUA 4RVDA 1H5NA 5K0JA 5LDDC 5F9FA 1J9EA 1M8FA 3C3WA 1DUVG 3U4DA 4WN3A 4BVJA 1BROA 1YBAA 5EHZA 3BMNA 3L40A 5TPZA 1KI2A 4J03A 4NATA 2RHCA 2XW6A 1HA3A 2ZWOA 3SM3A 4D4IA 4F1KA 2D5LA 4UOEA 3P2MA 4GQIA 2QZJA 1XWFA 1KSHA 2XLBA 4O8CA 4HMOA 2O7NA 1E7YA 3BIJA 3STXA 2M1XA 4OD0A 1EIZA 1ZIOA 2DKOA 2HL6A 4PC7A 5D3ZA 4RVSA 1EP2B 2AQ8A 2PM8A 3RM3A 1NVDA 1T3ZA 3HFJA 4RD2A 4DPKA 4EA8A 1KK2A 3QHAA 4W1PA 4CG2A 1IHPA 5KBYA 3LGXA 2FR8C 2QTNA 4O2BB 3WISA 3RC7A 4B71A 4N5LA 3C6ZA 2PO7A 3BE8A 5F1YA 3D4BA 3DKPA 4MW5A 4U63A 4C6TA 3OZVA 4FYKA 2OCKA 2A0XA 4D42A 2Y05A 1X7WB 2YC4C 3P2YA 4TXNA 5IP5A 1RHKA 4H3SA 1EG2A 4L73A 4YALA 5TB5A 2A33A 3UAVA 5JD4A 3LE8A 4X20B 1YH3A 2HQSA 2JEOA 4QQFA 5IBQA 5M7EA 4N0MA 4PHHA 2C9BA 5CA1A 1PJCA 3MWDA 3BF7A 4XE5A 1Z5PA 4KKVA 2I3GA 2HT6A 3I9NA 3O8RA 3FSEA 1J0DA 1EKXA 2VAMA 1MX5A 1HYHA 4MTCA 2VP0A 4S12A 1NQUA 5C8YF 4PN7A 5H02A 3G2LA 1KZYC 2IT1A 3I37X 1U1FA 2DQZA 2VYQA 2WUEA 3ZWWA 4OX9B 3GEMA 2FXIA 3JQPA 1TC1A 1BDBA 4UJ5A 5D6NA 5EHIA 1HRKA 4DJTA 1PWHA 4NEQA 1L4GA 1QBGA 5CBPB 1EUDA 3P9YA 2WG1A 1U5BA 3HB9A 4K3UA 1H66A 2OZPA 3UQYS 2G71A 1QV7A 4CF6A 4C4OA 3BTUA 5H16A 3SEZA 2JFYA 3FSRA 4DEYA 1E1DA 4I9FA 1XDSA 4GAEA 2P2ZA 3ROMA 3AF0A 3NTRA 3O4HA 4KPYA 2ZIAA 1CHNA 1AB6A 4E2YA 2DUJA 1VE7A 4JUFA 4XPIA 3JXEA 1P60A 5ELMA 4D4LA 2P9QA 3E7PA 2O5VA 3IP8A 3JAMA 5BNFA 3VO9A 1RJDA 3D8HA 3GZ4A 1KK1A 4FS8A 4NDZA 4DBZA 5B58C 5KI6A 1RJFA 1RQ2A 2Z5VA 2NT3A 3O2SB 5IKXA 1HI9A 2DTDA 1WXHA 4Q9DA 3HQ4O 2O2YA 1RKQA 1CFZA 3F7NA 3QE2A 2X9QA 3HMKA 3I01M 1W8IA 1U8YA 3OLCX 2CLCX 3ZW7A 5J2TB 3AX6A 4MLPA 2VDVE 3JPYA 5EZYF 1NW5A 3K8OE 1P1BA 3UV7A 2QXYA 3A3YA 4EYQA 1QTRA 4YJFB 1ZK1A 4K05A 1RLJA 1I36A 1SRRA 3AUYA 4BNFA 3E2MA 5HQTA 2FRDC 1SCJA 2H85A 3ILSA 5DTRA 2CXRA 2JFHA 3CCFA 4NAVA 4NDNE 1Y3CE 3RG8A 2ETXA 3IOBA 3KT8A 4ZYXA 4IS3A 2FEKA 1JWAB 3ZWCA 4MX8A 2WYVA 2NV6A 3I04A 1Z56C 4YXFA 5CYPA 3G0HA 2YDXA 5FPSA 4L6CA 1YE8A 3G2QA 3F6SA 5BPFA 3E9CA 1LDEA 2V7WA 3NT2A 1HK7A 4KGZA 3UATA 4F56A 1PBNA 4B3CA 1V25A 2C2HA 2IOFA 2OXRA 5HM8A 3C6YA 2JFVA 2W2TA 4FBLA 2BFNA 2I55A 4IP0A 4NHOA 4BO2A 4BP8A 4TXLA 2FUKA 1E5DA 3PCRB 4AURA 2OK8A 4PTZA 1IL0A 2P6RA 3K70B 1Z6QA 3ZVMA 4ZZ1A 1F2DA 3OOEA 3F4KA 1N0VC 4FT2A 4YAJA 5IULC 1O77A 4ZT3A 2WJHA 1NR5A 2VL7A 4B4UA 4OYRA 1LJUA 3RE1A 5L7WA 2FA9A 4HTFA 1FXWA 5JDIA 4ZJZA 1YOVB 2XWBF 2HM7A 1RWMA 5ADWA 2GI4A 4A91A 2EFGA 3EVNA 2Q45A 1ZLXA 2WILA 4V2IA 2XWSA 5CG2A 4R0VA 1O4WA 2BELA 2IGBA 2ZRFA 5K3CA 3L4JA 1QS0A 2B99A 2VPPA 1KYIA 3FMVA 3OE7D 1J6UA 3RGGA 3THYA 1V6CA 3QVTA 2G77B 4JQZA 4XR4A 1N0HA 4NE9A 1A7AA 1V41E 1Z83A 1QWSA 2L0XA 4B35A 4DC0A 1VIMA 4MGEA 4JH0A 2CFRA 3GLIE 2X0NA 2Z6UA 3AEUB 1YRQA 3EOBI 1RYHA 3O91A 4ZVKA 3OP1A 4JCCA 5HA5A 1N6HA 621PA 3DV9A 2AW3A 3FYUA 1Y5NA 2QX8A 4Y7DA 4HDQB 1THTA 5H68A 2YXEA 3SFTA 3B1YA 3JYNA 3OHSX 2CZGA 2G7ZA 3C16C 4JKOA 1PV1A 2WF6A 1QV9A 2BEUB 2ZAGA 3KU1A 3DW1X 4IXTA 2WHXA 1J1ZA 3QIAA 4J0HA 2CF6A 3EZYA 3G49A 1FS4A 1JQLB 3UJ9A 3BDVA 3QF4A 1DIAA 1XL1A 4RETA 4HAIA 1MJ5A 4TV9F 1JR3D 4DNPA 4WL0A 5FUYA 1U0LA 3NVAA 1QLWA 1DAPA 2IXDA 2J6BA 3R74A 3KWFA 3C4JA 3RF7A 2QRKA 4MPRA 4D99A 4ZIRB 4ND5A 2I6QA 3QNUA 3Q7EA 5FOQA 2JEZA 1KEEB 1TCAA 2V7QD 4FLMA 2N3ZA 5F77A 1K5HA 2BPOA 2G9NA 3L0PA 5CK4A 1V16A 2ZJ0A 2Q0QA 3AIMA 3KHKA 4IYRA 5IK2D 3CV3A 2GVNA 3LLCA 4RLQA 5GTDA 1MQ8B 2BEKA 1CZOA 1PLLA 1Q6YA 1YI8A 2G0TA 2PKWA 3KKZA 4JFRA 4F38A 3I62A 4RK0A 2ACEA 1E5VA 4MV4A 3DVLA 3W5HA 2JD2A 4ILEA 4TRNA 1N1EA 1QFXA 1Z4NA 4BGVA 1JXMA 2EAUA 4Z9BA 4E11A 5A06A 3L8YA 5IYZB 1DRVA 4QUBA 4H4CA 4DM7A 2BDUA 4PW0A 2QQ5A 2PQ2A 3R41A 3AVYA 1JG7A 3AVUA 3EFOA 1GPUA 1L5QA 1VYUA 3IMFA 3N7UA 2WPDA 3MIZA 3NM6B 4FFBA 4KPUB 4N3CA 4FFWA 3NEJA 5DSXA 3BULA 4FC6A 5E4JA 3UCXA 2Z2JA 1B3RA 3N8GA 4D4MA 4PLYA 1FBNA 1BHO1 2P9GA 5EAIA 1UWKA 1K6IA 1NMSA 2PGDA 4JLWA 2AZXA 4HO1X 4OLFA 2WJWA 4ZZ2A 1SVWA 3WBKA 2OCPA 4QDJA 2CLSA 1JVNA 2FUG1 4TWZA 1XMXA 2EBFX 2XWJI 4EYOA 3V7YA 1XCLA 4IOJA 4L5BA 5DO9A 4O59O 2FMHA 5AXBA 3TDMA 4OYHA 2P9BA 3GT7A 5C9ZA 4DKXA 2P6UA 5BV1A 3GT3A 4XVHA 2DT8A 4X3PA 3WP0A 3QU2A 1U2TA 2JRCA 4L2IB 1CQJA 1M1NB 2IVFA 4CKEA 3BT7A 1CUYA 4OEHA 4FYHA 4KO3S 4WAUA 1Q95A 4DPLA 5JTUA 1DUIA 3EZXA 4FZ5A 3CVOA 1DAKA 3K32A 1IOWA 2C20A 2ID4A 3JQAB 1AKEA 3KE9A 3NS7A 4JLVA 3SG0A 4BCDA 5CDSA 2G7MC 3CE9A 4N7RA 3ZY5A 4PEVA 2PS9A 2IJGX 1CZLA 1G17A 1XJ5A 3DBHA 5H7XA 2ONZA 3OG9A 5CLQA 1S02A 5T4FA 3GPLA 2W6CX 4ZHQF 2E9SA 1ZGHA 3GRPA 3NHSA 1M2HA 3H1TA 5B36A 2PRKA 1ESZA 1TEVA 3CCBA 1JT2A 3I6MA 4DM4A 2AMYA 1EK0A 1Z15A 3EZ6A 4JEUA 3W7AA 5IX8A 2UYGA 3OT1B 2JBWA 3VJKA 3TF5A 2GZ3A 4EW1A 3Q11A 1J24A 3AEQA 2ZQ5A 3HA3A 3MLBA 5GONF 4OAQA 4HP8A 3TLZA 1XDZA 2PFKA 2OECA 1V3VA 1ZIPA 3C3PA 4Q7KA 1NY5A 3PKZA 3KAQA 3FUUA 1W35A 1MFZA 1ZD4A 5DCLA 4G07A 2CFCA 3FHJA 3FZEA 2JIQA 1TKBA 2F64A 4TRJA 2H7YA 5HKOA 3DMYA 1LDBA 2PYDA 1ULZA 2PXCA 3OQ6A 1FUEA 2JFOA 4PQYA 3LAWA 4PNZA 2BFDA 3P32A 2HXSA 5HBRA 5HK8A 2HV8A 4IIJB 4G81A 4OXNA 1AKNA 5JC1A 1W88A 3HHEA 1P2BA 1F0KA 5K45A 1XCBA 2WB2A 2B8WA 4U7HA 1K92A 1W581 3AP3A 3T5GA 4HNTA 2DOKA 2QB5A 4KN8A 2I8AA 4UVDA 1FXSA 1JFFB 1TU4A 4AF7A 4Z4GA 4J75A 1EWQA 2C5HA 4XR9A 5AK5A 4TKVB 5FPTA 4K81B 4F8EA 1U7PA 4ZARA 2AN9A 4DRZA 2H00A 3ROXA 1WBDA 1XZBA 1ZCAA 5B4VA 1NP7A 2G80A 4KDFA 5EE1A 1PN3A 5AI0A 4IO0A 1U1IA 5CFRA 4EHHA 2GQ0A 4F93B 2DFVA 2PGXA 4KSBA 3SNKA 4DREA 1Z4JA 1SHZA 4W6QA 5T8KC 4AECA 4EA9A 3P7MA 2UXBB 3QKIA 3PPYA 4G0NA 3LHDA 4HN9A 4UDXX 4AJIA 3UXMA 1K08A 5CDHA 4BO1A 2AMVA 2DBVO 2K5UA 1Y8QA 3IUPA 3E7WA 3P2KA 5DB4A 3T8YA 1FL9A 3BJRA 3H2ZA 5G2OA 5I4KA 5B4UA 1W7AA 1L4EA 5EMNA 1NXQA 1U1GA 1ZOPA 4IVQA 5BSFA 2CLOB 3GT4A 1NBMD 4OMDA 1H6DA 1NVAA 3BMQA 3FOCA 4EQZA 5JASA 4JA2A 4OY3A 4YPFA 1T34A 3BMCA 1LX6A 1BH6A 1FDWA 1T10A 2CK3D 1QZUA 3MOGA 1FMFA 1AKQA 1FTGA 4KNWA 4M8IA 3FDFA 4I66A 4MRMA 4DSOA 2FUEA 1GNLA 3KKKA 4L0MA 4UU0A 3SZ3A 3DZFA 2AXNA 3ASZA 3HB4X 3SZGA 1OYOA 4G3XA 1IN7A 3DEAA 5BYKA 3DMHA 5JAZA 4I1PA 2RCNA 3AF2A 4I14A 1EGMB 4OHXA 3VX3A 4KLCA 1UEIA 4D1YA 1NQXA 3EEQA 4RSRA 4JC4A 3WWPA 2BBSA 5IAJA 4AJHA 4LY0A 1KORA 3LUKA 2NACA 1IN6A 3WHLA 3DLPX 3KKPA 4DPMA 3UPUA 3H0KA 4MR9B 3B3AA 1HNZB 3RU3A 2ZYVX 4MPPA 2A0UA 1YQTA 1K68A 3EPKA 4D0SA 4U7TB 4J29A 1YQXA 1I0IA 2B6NA 3HNOA 2NYUA 3PLRA 2VXBA 4L0DA 4OA5A 1YJ8A 1SIBE 1JFTA 5B64A 4BVAA 1MJGA 4HPWA 4M6WA 3M6VA 1OI2A 2QY9A 1C3OB 1Q11A 1J97A 1TYBE 1UWVA 1E2KA 2WTBA 4LRTB 5KOIA 2XVXA 1IY0A 3M3HA 4RANA 4UQPA 2C8KA 2BF4A 2P2SA 3UT0A 3O4GA 3SC4A 3TLBA 2R8PA 1A7UA 3OSUA 4GH5A 4MVJD 1XG5A 4IFTA 3AF5A 3NPAA 4FHEA 4QFBA 1VLZA 2RB5A 3BK2A 4Z9FA 3VV2A 1SVOA 2J9FA 4ESEA 4HDKA 2IYVA 4CMBA 5A4FS 4CMHA 4JLOA 2CJXA 2TECE 1C5KA 2IYWA 2KHZA 4AKTA 4FBMA 1Q0HA 4ZU6X 2O8EB 1VMAA 1RTKA 2ID9A 3NAMA 4JEIA 2HJSA 3LQQA 3LOPA 3IR5A 1QZXA 3OWOA 3QA9A 4FFOA 1M72A 1EGHA 2KW5A 1YR2A 3DLCA 2IZ6A 3JRNA 5KTPA 4OUDA 1S6YA 1DTWB 4UHJA 4HYEA 4OHYA 3FCCA 3K0FB 3WB0A 4U7FA 1DEKA 4GX1A 1M33A 1C0EA 3A6ZA 5JI2E 3LUGA 3C3DA 4PZLA 3NKLA 4M98A 1M1XB 4DMHA 2W0SA 1N2IA 5K0EA 1C4KA 1PGOA 2FMIA 4HAZA 2WICA 3HB5X 4G8BA 4W7SA 4AJEA 3B3FA 4OB6A 4UM9D 4EHJA 3PGJA 4G1BA 2I6FA 5TMBA 2P9TA 1YBFA 4LEIA 3IIJA 4BP1A 3AJ8A 4JT9A 1Z33A 2BAGA 4K9QA 4Z4FA 4WZBB 1JPVA 3HR4A 5IM5A 3SF0A 3SXPA 1ZI6A 2ENUA 1HY3A 4P3PA 3PQEA 2E4ZA 5E1OA 2CL0X 3CLHA 3KXKA 1ZVKA 3ZDEA 3FFTA 5L40A 3KAJA 2FX5A 1JNYA 3ILVA 1SXGA 3QWAA 3R6GA 1QFYA 1LVUA 3GR6A 4TMVA 1ULSA 3EIXA 4GICA 1CEXA 1OH6A 2J41A 1Z7YA 3QFSA 4OQ4A 4UUMA 2VFAA 3LZCA 4G5XA 4LCEA 2FWIA 3CVJA 1VJCA 4FZRA 4JC8A 3T7EA 2GJ9A 1RC0A 1XJ0A 2WYUA 4BP3A 3T15A 3EMDA 3HV0A 5DMXA 3WLIA 4BC0A 5L6MB 1ONNA 2H2IA 4GLLA 1W76A 2H1SA 2FCAA 4C08A 4MYHA 4C4SA 3NIWA 1OLOA 1IM8A 1GGJA 2GN0A 1L5WA 3MCAA 2ZE5A 4KE9A 4W99A 4NULA 4BQNA 2VQFB 5JZSA 2ZVJA 2ZM5A 4IIDA 2X8BA 2FGKA 3N8DA 3P4YA 4JU9A 4N0QA 2VHWA 3O38A 4A8JB 3QX8A 2F1IA 1E94E 1NXWA 2WVAA 2ZROA 1Z6GA 2GHRA 1GILA 4AZ0B 4JV5B 4YDHB 4YCMA 2Q1YA 2X0RA 5FCDA 4GMFA 3TBHA 4UOZA 1O94A 3H0CA 1GHTA 1P5ZB 1IEXA 2VLBA 4ON9A 5A6SB 1E62A 4ZEXA 1T0UA 4F5DA 4DA4A 1JH8A 4MWBA 5FADA 1SUBA 4IIVA 4I5IA 2ONJA 3WLNA 4BMCA 1AKTA 2IPLA 3WJ2A 5KTTA 4FEGA 1N2CB 4Q4DA 3LLVA 4KO2S 3WYNA 4MYCA 3BB3A 3ZWKA 5TT0A 1KNQA 4H7JA 2GF2A 4OXXA 1M1UA 2WSBA 3B9QA 3PPIA 2IHJA 3NHAA 4N5DA 3CT4A 3R24A 2IHZA 3WGIA 3L2OB 2IV3A 3M1AA 2EP5A 4I1OA 1M1YB 1T8SA 2GNPA 1NF3A 2BFAA 3ZCQA 3CHYA 4RDIA 1QORA 2XNKA 1IXYA 5FD8A 2G28A 4D43A 1CV2A 4IRXA 3IUMA 5BUSA 3AOGA 3FHOA 1KJ8A 3L46A 2ZUFA 2PUCA 3AVTA 4N5HX 1KYWA 1WKBA 1N6NA 3G6WA 5FLXA 3R3ZA 4G37A 4GVPA 1L5ZA 1YUNA 2FOLA 3NALA 4CT0A 2FY8A 2JBAA 1YUBA 2COEA 3EODA 3KV1A 5JNRA 1ECPA 4M1TA 4Q9KA 5L3SA 4LYEA 3DP7A 4ADSG 4YAFA 1TVCA 5AH0A 1ACMA 1I0LA 1ODFA 3H5LA 4JA0A 3DHWC 2WMYA 3KLOA 3RU2A 4E5KA 1NUQA 1T35A 4K9KA 5B6IA 4JGGA 3AB8A 4HNVA 2NYRA 2W2KA 4KN9S 3CVYA 4BV9A 3G0DA 3IGFA 5ER6A 1UZLA 2H1HA 3NR2A 4BMOB 4PGFA 2J4FA 3RJMA 2OCLA 2X77A 3GLRA 4YDSA 1Y5IA 2ZB8A 3EGDA 3MINA 2F9FA 3GRFA 3K6SB 3D59A 2C2XA 2R9VA 2Y1XA 1AUPA 4TZTA 4RK4A 1J00A 3QEMB 4Y2GA 2WSIA 3FF4A 2ZT6A 5EE9A 1GUBA 2CHQA 2LRHA 1IULA 2DHDA 4IJMA 1NUSA 2FRXA 4O02B 4OH7A 5DIZA 3PT9A 3PNLA 2RKWA 1KRHA 4BDTA 2HCJB 4NQZA 1P8AA 1MG0A 1NLYA 4L8WB 1VCMA 3LZ6A 1D0VA 3OZAA 3P4XA 3PR3A 1I32A 3WBBA 5H3CA 3EGIA 1QIFA 2EW2A 4WDRA 1QC5B 2WQZA 4WKBA 4O2RA 2XODA 4V02A 1LU9A 3JS5A 4X63A 1ST3A 1VL2A 3H2GA 2ADFA 2G72A 3E03A 1KEWA 2QD4A 4BYGA 4H35A 2LGJA 4ZOEA 5IBCA 1G0NA 4HD8A 2I3ZA 2EWMA 2XYHA 4YN3A 1ZXBA 3CF4G 3GOHA 1LV8A 4L5AA 2VPWA 3TLKA 4JYCA 3WJ7A 1OLUB 4S1OA 3EDRA 1AXEA 2PXXA 4V24A 5FWAA 4XPZA 2V6FA 4MAAA 1RDFA 1V9SA 3QG1A 4TS3A 3WDLA 5E6SA 3PYXA 4U7WA 3IDAA 5DHRA 5TS3A 3VSAA 4Y6OA 3FWKA 3PHHA 5AVVA 2BM1A 2WAYA 5DASA 4RLSA 4LZNA 4XLLA 3KAKA 5I7WA 4A92A 2XZPA 2ZRCA 5T67A 2Q4RA 5DNWA 1GNVA 3QXCA 4CFSA 4PFJA 5E4YA 3ZV5A 3U9SA 2PRYA 2QPOA 1SXJB 2WW8A 4KAJA 1BCSB 3N87A 5DNUA 5CT6A 1SD1A 3ZWYA 1ISGA 5LWHA 3RUCA 3EF1A 1UMBB 3A6HA 2HNAA 3ESXA 5FL7A 4UDNA 4NFYA 1R0CA 4Z99A 2JAPA 2O3UA 4D3SA 3H6KA 4X6XA 3LNTA 3X43A 3WLEA 2WR8A 2UZ4A 3VNUA 3SIPA 2IV2X 3VZPA 1L5SA 5JRZA 1KETA 3PE6A 4YRCA 2GCGA 1HFKA 1E7QA 3AVPA 4IJQA 5ES3A 1II0A 2BFCB 3IT2A 1OPXA 3WZMA 1YL6A 3MJEA 2OWDA 1SVIA 2ZE6A 3BB4A 1REQB 4KV9A 1TIPA 5JWRA 5JYCA 2H52A 4QOGA 5CITA 3TPZA 1L7DA 4W8HA 3STTA 1O9GA 3G1WA 3GRAA 2O2GA 4TV8A 1ZGZA 5GP1A 5CM9C 3ROEA 4CM4B 1G4UR 2QLJA 2FPGA 4Z8XA 1PSZA 1V3UA 5JCPA 1VLMA 4ZCSA 4DZTA 4F6LA 1N2CE 1E60A 4IEEA 4I50A 5JRDS 1A8IA 3CM0A 1FBTA 5ED4A 2VJKA 2AH5A 2BEWA 2QTTA 3EGXB 4LRUA 2B9VA 1FMJA 4NYMR 4Q7JB 5EYPB 2IXGA 4ABYA 3C7TA 1L7MA 1T5LA 3SYNA 3PV0A 5JZVA 3N6RA 4TMZA 4J0EA 1P9NA 4B09A 2YVLA 2EGHA 1HO3A 2ON6A 2ZRHA 5C8DA 5KYYA 1M1YE 1JL3A 2DWPA 2EDAA 2NXJA 5C8YB 1H3NA 2I22A 3L6EA 2G07A 2C1XA 3GWZA 2MU1A 3E81A 3PNBA 1GP2A 3QVWA 4HUQA 4NCIA 4AZ3A 1U7DA 3EQZA 4NMHA 5DHAA 1R8JA 2VJAA 5U9CA 1SXIA 2P5TB 1P2FA 3A04A 1CBUA 2FZ5A 1UKYA 5DLQC 2F59A 3MMSA 2ZWAA 4YRFA 4WXEA 1PYDA 3USES 1JAXA 3MB8A 1FQOA 4MLZA 5H9VA 3RRXA 2JLSA 2REOA 1Y42X 3HBLA 2HRRA 2ZUDA 1ZD8A 1C7IA 3HDHA 2ZVDA 3A6LA 1E4EA 5KCMA 1QAOA 3WYCA 5CG1A 1YS1X 3AUSA 1RXYA 5B5SA 1FF9A 1UFOA 1IPFA 1X77A 3OT5A 4DADA 3UXHA 2O1SA 3RVPA 4N01A 1WB4A 2PIDA 4Q19A 5INTA 1EHIA 4ER0A 4V0OA 4F1JA 3ERCA 2EATA 3WB2A 5J9FA 1PFVA 2JGLA 3AFNA 3P96A 4UHHA 4YJ3A 1U2EA 2XVMA 5LFAA 1C9MA 1SU7A 4H59A 4DV1B 1TJ3A 3QVUA 4DUYB 1H0HA 1O96B 2EIHA 4QEKA 2R1VB 1XHFA 3K9LA 3P1JA 2P67A 1ZINA 2X8JA 4QASA 5DE3A 4KLRA 3RJTA 1P8JA 4O3MA 4YFVA 3E3OA 3JVIA 2B1RA 1SA0B 3M6IA 3OPVA 3RWOA 4ZK6A 1DHRA 2YY6A 3LIPA 3O7MA 4DS3A 1CETA 5FTMA 5MF6A 2XNJA 5EZYB 4BB9A 4ZMSA 3OETA 2VJLA 3WGGA 4HOYA 5KWVA 1TE2A 3NTUA 2EG5A 3CLTD 5CLLA 2PU5A 4RM3A 2RGCA 5LXTF 2IL1A 1GZDA 3GCXA 5ARCA 3TRJA 4PBRA 5GIPE 1GTJ1 3VDMA 2DVMA 3UGQA 1C7EA 1JJAA 1FMTA 2QIOA 3T7JA 3Q15C 4DQXA 4YV7A 2EERA 4Q9JA 3T3MB 1ZN2A 1YS2X 2D1QA 5K3EA 1VE3A 2G1JA 3O1JC 4JYZA 1TCUA 3HBNA 2EGUA 4M1ZA 2GZHA 2RI1A 5BW4A 5JD6A 3VPCA 1KK0A 1MPXA 1ABEA 2H1FA 3E8XA 4RH3A 2Q50A 1KSFX 3IUBA 4P5PA 3JAWA 4P80A 4BOYA 1GCUA 1ZUIA 4I4LA 1JB9A 4L8FA 3RQSA 1SXJE 2A4MA 4JR1A 2J5KA 1QYCA 3I2FA 4KIWA 3UMYA 3HJNA 4O0LA 3PIDA 2YYSA 1OGJA 4U9UA 2HA2A 4R1OA 1RZ3A 4DA8A 4BBPA 4LHZA 4OGWA 2Y1WA 1P2UA 3H8JA 2PL9A 2VPZA 2ZYWX 1PL7A 1Z6PA 2AJCA 4FD3A 1DAOA 1H3EA 2CXPA 4MZDA 1CE8B 4CT4B 3S2UA 4HTAA 1IXZA 5F51A 3ZIDA 4AYXA 5CD1A 1JHAA 2AYXA 4BX2A 7ABPA 1BDHA 5FH9A 3RTDA 2E21A 4KXXA 5I9IA 1KEZA 2VUSA 4GFDA 1ZSVA 3AB3A 2YN0A 4ITUA 4XD7<