4E7PA

Crystal structure of receiver domain of putative narl family response regulator spr1814 from streptococcus pneumoniae in the presence of the phosphoryl analog beryllofluoride
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
131
structure length
131
Chain Sequence
HMKVLVAEDQSMLRDAMCQLLTLQPDVESVLQAKNGQEAIQLLEKESVDIAILDVEMPVKTGLEVLEWIRSEKLETKVVVVTTFKRAGYFERAVKAGVDAYVLKERSIADLMQTLHTVLEGRKEYSPELME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Response regulator
publication title Crystal structure of receiver domain of putative NarL family response regulator spr1814 from Streptococcus pneumoniae in the absence and presence of the phosphoryl analog beryllofluoride.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 48
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4e7pA00
3Q7TA 4IRXA 5TPZD 4S04A 5TQ2B 1SD5A 4H3KB 4RY0A 1YS7A 4RXTA 1PNTA 2LPMA 3F6CA 1BAPA 4DN6A 5T7BA 3OLVA 2BGGA 2FVYA 2QXYA 3LTEA 1EHCA 4Q6WA 2FN8A 4N47A 3KLNA 2CHEA 2ZWMA 1S8NA 3FFTA 3QLUC 4WWHA 2MYNA 2J48A 1DRKA 5IUKC 1ZHHA 3T6KA 1ZVVA 3KLOA 4RK6A 1NY5A 3K9CA 3QLVA 3P9YA 2R25B 1D1QA 1Z18A 3N53A 3OM0A 2PAFA 2PKXA 5FWXB 4RK4A 1H9CA 2YHAA 1LBHA 2E4WA 2FLKA 3FFXA 3EODA 4ETMA 4EYGA 2M98A 3JVIA 3LMKA 1W9HA 1DZ3A 3VNAA 2RDMA 1USIA 1EWTA 3TX6A 3ROFA 2L19A 1B00A 1M2EA 4MS3A 4WXEA 3F73A 1QQAA 1FFGA 2DRIA 4Y9TA 2QW1A 3SG0A 4PE5B 1DJMA 4N76A 1A0OA 3N8IA 2F8SA 1D2AA 1NATA 3UUGA 4EVRA 3JPYA 2N9UA 3OQOA 5ED4A 2FMHA 3K4HA 5KI6A 1SXHA 4Q7EA 2W42A 2YHBA 4HNQA 5C5CA 2L18A 4G0XA 3KYJB 1DBWA 3LKBA 5GQSA 1QNLA 1SXIA 3EGCA 4W5RA 2PUDA 1JYFA 1SXGA 4LZLA 5DTEA 5IEJA 4G0PA 3QEMA 3QLUA 4Z4FA 4KRFA 2JB9A 5DCLA 4QPJC 3DZDA 3C6QA 2H0AA 5TPWA 3I42A 5BRAA 3MQ4A 1VLZA 3HDVA 3BILA 3OLXA 3QEMB 5T3YA 4YCSA 4JB0A 1Y1LA 4XLTA 2JCGA 1Z16A 4G0ZA 3UK0A 2PUFA 1NXPA 1RPJA 2JK1A 4RK7A 2QZJA 4H3HB 3A0RB 4EY3A 3KKEA 3CLKA 3RVOA 3BRSA 2IKSA 2Q5CA 5JNSA 2ID7A 4MQFA 3H6GA 4Z9AA 4IMJB 3F7NA 2P4UA 3RVPA 4F8JA 3GA5A 5IULC 3NHZA 5KWSA 4LDAA 1QP0A 3GRCA 3Q15C 1FFWA 2NUBA 3O21A 6CHYA 1GUDA 1C0EA 1USKA 2OQRA 4GNRA 5EWJA 3HSYA 1W25A 4XARA 1CHNA 2WWVD 2E4XA 1BVHA 5EWJB 4N0PA 1IIBA 3L6UA 5EWLA 5F64A 1E6KA 2L17A 1MIHA 1P6UA 4RXMA 4LX8A 1JF8A 1XWWA 3SQNA 3MF4A 1RXIA 5BRJA 1QO0A 5JNWA 3EJWA 4DQDA 2QVCA 4MR9B 3NNSA 4PEVA 4RY9A 4YLEA 4RZSA 1GLGA 1ZAYA 5TQJA 3HXMA 3NNDA 3GL9A 2FSPA 1RXEA 4JB2A 5JNVA 3T8YA 3QLTA 3LFTA 1Z12A 2CWDA 5JNTA 4QYWA 3ILYA 4KVFA 3LUFA 1ZGZA 4KQ9A 5CNIA 3N75A 1RZRD 3FDFA 3QELB 4EYQA 4ZJPA 3S99A 3DBIA 3MM4A 2QV0A 3RQIA 5FWYA 2X7XA 4PYRA 1YS6A 3L49A 3CKMA 5FBHA 2VUIB 3JY6A 4YS6A 5DLEA 1D4ZA 1FFSA 4RU1A 2JVIA 2B4AA 1QQBA 3A3KA 1DCFA 2QU7A 5JNUA 4XFKA 3H75A 5I4CA 3CS3A 3N0WA 3QX9A 2PUCA 1YTUA 1KRWA 1QKKA 3LOPA 4KQCA 3E61A 3DLBA 1FSPA 1R8JA 4YWHA 4LE0A 1XHEA 1NXVA 3OMXA 4KFCA 2A9PA 2LIVA 3M9WA 1E6LA 1UDRA 2H3HA 2R4QA 2PUEA 3OMWA 2O20A 1DRJA 2L2QA 3IPAA 3TO5A 5HQJA 2PL9A 1P8AA 4P98A 3EQ2A 1ZH2A 5CNMA 3TD9A 1LJUA 1Z26A 3GBPA 3N0XA 2VK2A 3O1HB 3CZ5A 3MIZA 4FE7A 1VRVA 3MMNA 1JHZA 4Z9BA 4ZMRA 4YP9A 4RS3A 3DGEC 3ROTA 3CFYA 4EGSA 3RVKA 3LUKA 3H5IA 1JFSA 4HNSA 1AB6A 2FTKE 5FBKA 1BDIA 4MS1A 2GI4A 1URPA 2LBPA 5HM6A 4OBBA 4MYRA 1Z15A 1LJLA 4YGXB 2FMKA 1F4VA 2QSJA 1NXOA 1T34A 1DC7A 4MS1B 3RVJA 3SNKA 2FN9A 5JNRA 3O2QB 3E3MA 3W9SA 2E4ZA 1ZY2A 4QYMA 4ML3A 3F6PA 2MYUA 1M5TA 4RDCA 1JDPA 4ZMSA 4F12A 4KPYA 1ZESA 2MYPA 4MS3B 1BA2A 2R48A 1MB0A 2E4YA 3URMA 4E7PA 1LK0A 2A9OA 4MRMA 3C97A 2A9RA 2WJWA 2XDYA 1ZN2A 4CBVA 5HSGA 2FXIA 2JBAA 4RWEA 4RV5A 3GYBA 4WXMA 4O5AA 4D6YA 1QPZA 3NHMA 4MLDA 4Z4HA 1CYEA 2JBAB 1U04A 2WJAA 2JVKA 3IPCA 2PL1A 2WMYA 2PE5A 1OXKB 1JDNA 3CTPA 1E6MA 2HQBA 1E2BA 3BBLA 3I5AA 4Z4EA 1D5WA 4MR8A 4N0QA 5TPWB 5KQPA 4G97A 5CNKA 2CHFA 2WRZA 4G86A 4IF4A 3H1FA 3JTEA 4KREA 3KJXA 2IDMA 3CNBA 2P9HA 4MQEA 1JH9A 1EFAA 1NTRA 1JFVA 1MAVA 1CEYA 3H6HA 4LE1A 4D74A 4MQFB 3RH0A 3HS3A 4HYEA 2I6FA 4S05A 2NT4A 1DBQA 3MYYA 4PZ0A 3T95A 4YRZA 1NXXA 5KC8A 1U8TA 1QO0D 1L5ZA 4W5QA 3KG2A 1EAYA 8ABPA 4W5OA 2PLNA 1YVUA 3QEKA 4KV7A 1ISSA 1A04A 3I09A 4LDZA 5EWMA 2PMCA 4OATA 3SAJA 2E4VA 4QICA 5EWMB 5EWLB 1SRRA 3RVRA 1EWKA 2HPHA 5IUJC 4KNYA 4G0MA 4MPTA 1DBPA 2MSLA 3G85A 2VYCA 5HKOA 2HQOA 4EYKA 2PUBA 4OLBA 3CZCA 1K68A 4F3TA 2LUOA 2VUHB 1Z2DA 5KQLA 1APBA 4L4UA 9ABPA 3O1JC 4YV7A 1JFTA 1YK0A 3OLWA 3FMVA 3M9XA 5C5EA 4WZZA 1JLKA 3CRNA 4MS4A 4ETIA 3A10A 5TQ0A 3H5LA 4OG2A 3CU5A 4G0QA 3BRQA 4ETNA 4TLMB 5TQ0B 3HK2A 1TLFA 3I45A 3H1GA 2PJUA 5CHYA 1ZITA 4OTZA 3TMYA 1PHRA 3Q7SA 2FEKA 2WY2D 3H5TA 4RKRA 2GWRA 5IX8A 2PUGA 3FGZA 4NICA 5FWYB 1YMUA 2B1JA 1TM2A 3KSMA 3IP6A 1AB5A 2IPNA 4Z4CA 5ABPA 1KGSA 4RSMA 3M6MD 3O75A 2LP4Y 3RVNA 4JAVC 2FMFA 4N03A 2FQYA 4XASA 1DCMA 3MA0A 1ZH4A 3HZHA 4IMIB 4MR7A 3TB6A 1C4WA 4ZYLA 2FMIA 1DP4A 5JS2A 2IPAB 3KTOA 1VPWA 1LBIA 3O2SB 3GBVA 4RK5A 4MGEA 3CG4A 3O74A 4WUTA 3JS5A 2AYZA 2IYNA 2IPMA 3C3MA 4FE4A 4F06A 1NXWA 1QP7A 2QR3A 4UHKA 4Z4GA 1PUXA 4F11A 4GPAA 1DCKA 1ZDMA 3IP5A 1YIOA 2A9QA 4PICA 4XAQA 4IILA 5BQ3A 3H1EA 1GCAA 3Q41A 4KK3A 3HM9A 3KCNA 1D1PA 2ZAYA 4NV3A 1YMVA 5TPZA 1Z25A 5E3JA 1BDHA 1WETA 3A0UA 3HO1A 3GWGA 3VNBA 1Z13A 3OM1A 3Q9SA 2NT3A 3SY8A 4W5TA 4LRQA 1M5UA 3LUAA 1U0SY 3ILHA 4EYOA 2PUAA 5IBQA 4O1IA 5IEBA 4YO7A 1A2OA 5FWXA 4MAAA 3H5OA 4KMRA 5DGCA 5IUNC 4TLLB 1QP4A 2RGYA 1ABFA 3OO1A 4KK4A 1PEAA 4MRMB 1QMPA 2R47A 3HEBA 2E4UA 3DGFC 3HCWA 3QK7A 3HUTA 5D2CA 3EQZA 2HSGA 3N6VA 3LUHA 1NXSA 3CG0A 3HUUA 3IP7A 6ABPA 3O1IC 1DG9A 4Z99A 4B09A 2FLWA 1Z2EA 4E7OA 3Q7RA 2GKGA 1K66A 4MR8B 5KC9A 1JBEA 3LUGA 3OQNA 2GBPA 2NZUG 3EULA 4O1HA 4W5NA 3CHYA 4EVQA 1USGA 2NZVG 3UKJA 5JS1A 1XHFA 2CD7A 5B3JC 4EUKA 4NCAA 4MQEB 4M88A 5TE9A 3LKVA 3RVSA 5DKFA 3NNNA 3D8UA 1J56A 3D02A 3C3KA 4OLAA 1OXBB 1RNLA 3G1WA 3H5WA 5GOTA 3BREA 1GCGA 3HV2A 3KYIB 1Z17A 1F51E 4G0OA 4Q6BA 4RKQA 4FB4A 1PEYA 2MSKA 4RXUA 4ZPJA 3QX8A 1U2QA 3O2JA 1TMYA 2IOYA 4JOQA 3EAFA 3RVLA 2TMYA 3RVMA 4TN5A 1ABEA 1JYEA 4WT7A 2HQRA 4JP1A 1GUBA 3OQMA 3FFWA 4LE2A 2JVJA 1TVMA 4HNRA 2FEPA 4MLCA 5CNJA 5BR1A 3N0RA 2FW0A 5KQGA 1U2PA 5PNTA 3LUCA 3C3WA 4G0YA 4UHJA 2GX6A 4JASB 4XXHA 1MB3A 1P2FA 2QVGA 4DADA 4RK0A 5KQMA 3HJFA 4D6XA 2RJNA 1EWVA 1VKRA 3H5VA 4RK1A 4MR9A 1JWLA 4YR7A 4MS4B 2FKAA 3GV0A 1JL3A 1HEYA 1ZGGA 2M1ZA 1PNRA 3B2NA 4Z0NA 5B3JA 4IGAA 1I3CA 2F8TA 3OLYA 2FQXA 5IC5A 1TJYA 3EDCA 3KS9A 4KZKA 3JVDA 3IDOA 3RVQA 4L85A 4Z4IA 2MYTA 2OENG 4EVSA 2JRLA 3GT7A 3LUJA 4JA2A 3OLZA 1FQWA 7ABPA 3NBMA 3OO0A 3QELA 2FQWA 4TMYA 1YK1A 3QLVC 2RJOA 1DC8A 3HDGA 3SM9A 4NCBA 3KHTA 1L5YA 3R0JA 2KYRA 2FEWB 1P6QA 2WB4A 3LUDA 1M2FA 3JPWA 4RY8A 1BDJA 1KRXA 4P1ZA 4MR7B 2V0NA 4NQRA 4N41A 2HJ9A 1MVOA 2AYXA 3HVRA 1KMIY 1RZRA 5TQ2A 2ID9A 3T38A 3IP9A 1NXTA 1JX6A 2MSWA 3DLHA 4H60A 2IPLA 1ISRA
chains in the Genus database with same CATH superfamily
3Q7TA 3FUUA 1CQIB 3KXIA 3PJFA 1E7WA 4O2AF 1V11B 4MW1A 3PT5A 4P36A 2DBVO 1BJTA 1TQHA 5LC1A 2PBLA 1V9CA 1DQSA 3NHBA 4U5XA 4CJXA 3OLVA 5DWQA 4AQYB 1RSZA 5EZQA 5K8CA 1WV0A 1WY7A 2OVBA 3DR5A 1ULTA 1SWWA 1YOVA 4WNIA 1YONA 2XQIA 4J0DA 2FG7C 2BF4A 2QYHA 1FOEB 4R0MA 4L51A 3H2JA 1GDTA 3GR6A 1QU2A 1CX9B 4XSGA 5HMLA 3BCSA 1Q5PA 2HHCA 1N1EA 3GG9A 2QB5A 4G5QA 4U8GA 2MSEB 1ZMBA 2X8LA 3R20A 4ZVOA 1RBQA 3IBFA 4LJYA 1S6YA 2XODA 3OM0A 5EE3A 1E5VA 3L4KA 5DMXA 4JBYA 4URUR 1GZSA 2MJLA 1MIOB 5HNKA 3CVWA 3GXOA 3HE3A 3RS8A 4QG3A 1R4AA 4JEHA 1YJ5A 3LMKA 3G9ZA 1A5ZA 1K1EA 4N5NA 4EJSB 4G5YA 2JGFA 3GJTA 3TRKA 3SXJA 3OX4A 5DM60 4BMPB 4YAGA 2JZOA 3BYZA 1B4DA 2D1SA 3DUWA 4RULA 1XMQB 2RAPA 3K9QO 4AJIA 2IYRA 3A9SA 3V9PA 3QX3A 1Q7TA 3NJ4A 3JPYA 2QYOA 2O9JA 4GBMA 5AICA 3VR6A 4U3JA 2ZJOA 3W8EA 3COYA 5JHHB 3AWDA 8GPBA 1TB4A 1PGPA 2C2GA 1SXIA 3L9XA 2ZRGA 5JT1A 2OK8A 3WJ7A 2AK3A 3QENA 3M6XA 3WWZA 1SUEA 3AOEA 4HR7A 4BYMA 2X8BA 3K9WA 2W6JD 2ZJ4A 1VSVA 3GJRA 2PEYA 5DCLA 1DFGA 1M8PA 3FSGA 3A58B 2H0AA 3UWSA 1O9HA 2E0IA 2H06A 4W6ZA 3LDUA 5B4VA 4OI0A 3K94A 3CUSA 1Y1SA 1MA0A 2I4NA 3VR4H 3A1TA 3JQAA 1C3XA 2BI4A 2ZB4A 3MSXA 4KACA 3WLLA 1G6Q1 3KOUA 2A92A 1DUVG 5BT8A 1UIRA 1ZYUA 7YASA 3T1TA 5LMNB 5FTKA 1U31A 1XF1A 5LDDC 4EKGA 1W75A 1JDBB 3FYTA 1NSTA 4M46A 2HREA 3NW9A 4FDLA 5LNK6 3AXSA 4IVQA 2P8JA 1N6LA 2QXUA 2REBA 1UKZA 4KXXA 4FS8A 4DLKA 5BMOA 4AWBA 3AHJA 2AZXA 1TU3A 4FGJA 2WSLA 1XNRB 1RXCA 4CE6A 8MHTA 3ZPXA 1LKZA 1HY3A 2RHRA 2BAGA 2O2JA 4OYYA 4BZQA 1X7WA 4UQLA 3LLMA 3GF4A 1ZR4A 4HRVA 3W8FA 1M7HA 2F6RA 1GY8A 3LXMA 3P0EA 1DADA 3G1UA 3ZGZA 4WTOA 2VQEB 2AFHB 1S0UA 1J22A 3PJGA 3WL6A 5MFZA 2R68A 2ZATA 3NI2A 3BMQB 5C0OE 1B8OA 3N87A 4J0GA 5JV5A 4RVNA 4RXMA 3GLGE 2JCBA 1QO7A 1UDAA 2ZSAA 4MV5A 5E2BA 5CDSA 1G20A 3QTBA 4JXJA 5K3AA 4Y6OA 3X1MA 2X8JA 4EAQA 5HUQA 3C5VA 4UBMA 4IKEA 3RO7A 1E3IA 1EVZA 4KO8A 4WX2B 4PEVA 2I1QA 3ZHRA 3A4TA 1ZAYA 3PR3A 3HXMA 2F1OA 1DDOA 1DZIA 1K5HA 1OAOC 2VSFA 4IWNA 3F47A 1QORA 4KI7A 4XKJA 3FZEA 1A9ZA 1E5DA 1HFEL 2CWDA 5JNTA 1F9AA 3UMCA 1R4NB 2FWRA 3IVRA 1GKUB 1X1TA 3QWBA 3RYTC 5BVHB 1V3VA 3PG5A 1IY0A 4ZJPA 3CW2A 5DN9A 4MYSA 3S99A 3MM4A 1QE5A 3H42B 3RQIA 2HRDA 1SY7A 1FYEA 1UBGA 2AMJA 2ISQA 2QTVB 3E9MA 3MT9A 3RNLA 3EPPA 4I55B 2JFFA 4A0QA 5AM1A 1N77A 2R6GA 4ZEMA 4DLZA 1V7CA 2OBLA 3UO8B 5J5VA 4Y98A 2JA2A 4IGEA 3K72B 4BX3A 3I9V6 3T54A 2NO5A 3IKLA 5JNUA 4RZXA 3CS3A 3N0WA 3N28A 2GK6A 3NKLA 4FOOA 3LP8A 5C9ZA 2EZ4A 1QKKA 2H7VA 1MOSA 2JLCA 4BE9A 5G4KB 1S2IA 1ACJA 1I0IA 3E61A 1O94C 4EMBA 2YN0A 4CUKA 4DRYA 1WB9A 3R7WA 1KPHA 3UJ8A 6YASA 1C80A 4FZJA 1E6LA 5LDGA 1VG9B 2CNNA 1HDXA 1NVKA 3E5NA 1UK9A 2Q07A 2CFSA 3EH2A 3DC7A 3FF1A 4R41A 1LJUA 1T0JB 2BM0A 4FFRA 4PWZA 3VHRA 4OL9A 3K0FA 3AIKA 1MD9A 3IHTA 5BW5A 4TSFD 1WSWA 4FFLA 2GD1O 1JYSA 2ZYVX 3SYTA 5E1OA 4PFKA 1N2OA 5T4FA 5JXJA 4QQRA 3I62A 3KYDA 2ZSDA 3THXA 2ZIWB 4JLJA 5HM6A 2XHEA 4OBBA 1LTQA 1I0LA 3QF7A 4R1PA 1Q0TA 1U0BB 2G3YA 2XXAA 3KT3A 2BHSA 2VBIA 3HFGA 1UMKA 2Q0SA 2QAGC 4MS1B 4P3NA 4QJ5A 5HE8A 1MLDA 2FU5C 4HADA 4LWOA 3TQTA 1VYHA 1N1DA 1ZY2A 2EJTA 1EYZA 4QUIA 3T1OA 2Z1DA 4A6PA 4BKRA 5IF3A 5KREA 4CQNA 1N0IA 2GNAA 3Q0IA 2R87A 4RCVA 5DLDA 4DQXA 3VR3D 1E6EA 1QTRA 2H6EA 2QRLA 1U7HA 2HAEA 3K05A 2D6FA 3H8JA 1LK0A 3CF0A 1L5GB 1IHUA 3BKWA 3RTEA 1YC5A 1J49A 2IYXA 3JU3A 2ZIVB 1E2FA 1A9OA 3ISTA 4XFDA 3EIWA 1MQAA 5ALLA 1SCQA 3AM1A 2GZDA 2GETA 2Y77A 2J9XB 5C31A 1O0SA 1RRKA 3TZCA 4BBZA 5AP9A 5FBWB 4F3NA 5HZMA 1KZ6A 4CEHB 4A8TA 3HKBB 3KP1A 2XZPA 1VL5A 4P5DA 2JIRA 1JDNA 4FSXA 3O4RA 3M89A 5BSVA 1XPRA 1K2VN 5D00A 1H2ZA 1VL8A 5KWVA 3UV3A 1E3SA 2J4DA 4EA7A 4CM7A 3T9CA 4GYWA 5JHGB 4Y2PA 3IBCA 4ZHQF 3EA0A 1MH1A 1Z6YA 4U6QA 4CDNA 1SKQA 3D6TB 2IHNA 4HAUA 3TVYA 4BC1A 3ICQB 2BEWB 3EXIA 1AQUA 1DQPA 2WF7A 1P9LA 3IR5A 4I19A 2WM9B 5ALRA 3TQOA 5B4TA 1PBTA 1DBIA 2FQQA 3EDQA 2OQVA 4ABTA 1JHAA 4O2BF 5EE5B 2PA3A 4LE1A 4Q82A 4QX6A 2QT1A 3RUFA 1YIAA 1NC3A 2X2EA 1NQWA 1ZXXA 1DQZA 2GK3A 5AJTA 3IJEB 1IG3A 2LCQA 4II7A 1A71A 4TMZA 4AY4A 3LRTA 4V02A 1SZJG 3OQJA 4JHLA 2JJQA 4UJ3A 1A9TA 2ZE5A 3DKRA 4UNIA 5BXQC 3GLIA 3ET5A 1JJIA 2QX4A 5DNWA 1JJ7A 2XNHA 1L1EA 1XZFA 1B3RA 1WOYA 1Y98A 2AF4C 2GH1A 3OA2A 2BGIA 4LDZA 4MYUA 4FS3A 4TT8A 5CVDA 3PVZA 1KKLA 5IK2A 1FMJA 3CH7A 5FI1B 1JTFA 4OQQA 3B38A 4YUWA 3RVRA 1EVKA 3IDAA 1YFKA 3A9UA 1EUCB 5JCPA 2W2LA 2CBZA 5GIPE 4LRSB 2D1FA 1EHIA 4BDTA 1ZONA 5HKAA 4B3SB 4COOA 1AGNA 1GA4A 3KU4A 3EIXA 1GGFA 1XWFA 4KRYA 4CF5A 4U7FA 4WE3A 4CMHA 2X41A 4JVMA 2ZRJA 1RAEA 4PTYA 5SV2A 5BNIA 1H1DA 4CGYA 3PKIA 1DT3A 2B4YA 3TI7A 3NVKI 1J33A 1OE0A 4TLAA 1OGIA 2C9DA 2FK8A 1X7DA 3LX8A 5FTNA 4BZWA 2C9OA 4JHXA 1E5QA 4FQ5A 4KYUA 4C7VA 4MIYA 4W1RA 3DTVD 1Y81A 3C8ZA 3FMIA 4XQCA 5IAJA 1KGDA 2EZUA 4E2XA 1B6SA 2QSZA 3L77A 4OTZA 4QULA 5SZHB 2OORC 1RZ3A 4Y0VA 4Z49A 4UHDA 3FMPB 5CH8A 5FWYB 3GN1A 2YXLA 3WB9A 4MMYB 4B85A 1ZCBA 5DW3A 2HFKA 1W1UA 2C4VA 3GEDA 3HA5A 3ZKWA 1XC7A 2YWBA 2XJ9A 3MUEA 3G6WA 3PBKA 3T61A 3UAYA 3I3OA 4NFLA 5A4KA 5A2QA 4DR1B 4OGGA 1GUAA 3HHEA 4KAAA 1CQPA 4OYLA 2DJIA 1TZCA 1Y4UA 1T3ZA 2CNKA 1B26A 3KTOA 2A58A 4RK5A 3DDSA 2QN8A 3E9EA 4H18A 4WUTA 1E61A 4ZQIA 1SG6A 3RIMA 2B83A 2O7SA 1WF6A 2VTEA 4FWIB 1WV1A 4GP6A 3MCWA 5HW0A 4I55F 3RDPA 5LZ9A 3KB6A 4MHTA 1OAOA 3LSYA 3F67A 4REQA 4EO9A 2ONCA 3GAMA 2CXHA 4AF8A 4C4ZA 3ZJTA 5JAIA 1C9DB 4D4MA 3WNVA 3KSUA 1GCOA 4LKRA 4XAQA 2Q3JA 4OUKX 2DPXA 4JBXA 4PC7A 1YZQA 4RDHA 3Q41A 2I65A 2WM2A 3W5DA 3H2BA 5KVQA 1RYYA 1A4XA 4RA6A 2BCGY 4JJ8A 4HWOA 4PR3A 5JS7A 1MW9X 4IVRA 5C4GB 2G1KA 3VU0A 5LU9A 3DLAA 3IEKA 4BVEA 1TK3A 1OCEA 3EFHA 1RTTA 4DCGA 4YRSA 1YNSA 4O1IA 5K0BA 1T4BA 5HF9A 4NFYA 1UJ2A 1VBNA 4DIKA 4Q02A 5DGCA 5IVPA 4KVAA 3X2EA 1TNDA 4EPTA 3ND5A 2XITA 3WV5A 2VR1A 1M73E 5JI3E 3L7KA 2EOAA 4IUYA 2EYUA 2P41A 4R1LA 5HZGA 1X8KA 3GJZA 4MO2A 4TSFA 3LDAA 1KKMA 3JQEA 2HHLA 2FK7A 3HL4A 1N8NA 3VR6H 3KEFA 3FDZA 1C7JA 3F3MA 4BLWA 4I4IA 4H7DA 1KVTA 1RE0A 4RH3A 3AJRA 3NM6B 4KC0A 4WZAB 4N65A 4M0CA 2BGKA 5DM0A 2OD7A 5EJFA 5IXYA 4AQ7A 4LNAA 2YWJA 3ECSA 3DNFA 1Z2EA 3CNOA 5JZVA 1MJ5A 2GCIA 1IXRC 3UKOA 1N3BA 2MMGA 3EDRA 2W11A 4EW6A 1T3HA 3D2AA 2FZCA 4HB3A 2YQ4A 1LPAB 4AG5A 1NF8A 4JB3A 3OH8A 4D9KA 2QYTA 2H48A 4C0JA 7ADHA 1PT7A 3KWFA 3D8BA 2YV2A 2B3TA 3W4IA 5BN1A 3FM9A 5BY2A 4MRNA 1M1YB 2UZ3A 2QRMA 1VHJA 5C1OA 4LZJA 4MKXA 3N76A 3L1JA 4W1PA 1OXBB 1ZISA 2K2QB 3IOYA 1NUTA 4KL8S 3H5WA 3RSOA 1XV5A 4MUIA 4TQGA 4OYRA 1HM5A 4X93A 5GOTA 1L4FA 1N6HA 2JIBA 3U60B 1QV7A 1DKUA 4YH1A 3U4CA 1DUIA 1I3KA 2UVDA 1U2QA 3V7UA 3HCOA 4PVCA 1TEZA 3TIFA 3WFJA 5IDQA 3AK4A 1M6WA 1TCVA 3QMVA 1GUBA 3NHRA 1U1GA 1RP7A 5ECGC 2QLLA 4FCWA 3UPTA 4WCDA 1MJGA 3N0RA 4CEJB 1OZFA 4U2BA 4Q93A 7GPBA 2OGTA 3EE6A 1JH9A 2HDNB 4DJTA 2I4TA 5J4LA 1EJ0A 4G0YA 5L4NA 3FNIA 1GG5A 4JASB 2YINC 1VJCA 4ND4A 4BMOB 1UXJA 2QD2A 3ZD8A 1T8TA 3SFZA 1SRQA 7MHTA 3NYWA 3PF8A 5A5EA 1B3BA 2IXGA 4BQNA 1BE6A 1EFUA 5FPHA 1HEYA 5KOIA 4P86A 3NHUA 3B2NA 1U1DA 3EZXA 2FWIA 5K3DA 3C1AA 3RV4A 3M70A 3O8NA 1EQAA 2VL7A 3BWXA 1TJYA 3EW7A 5EP4A 4BCCA 1PZXA 4KR2A 2HN9A 3JQ9C 4C21A 4IZ6A 4FBMA 1ITZA 3DULA 1Y80A 4MUXA 5JSYA 3ZKAA 5K0GA 1EFDN 5JADA 3WLSA 3THRA 2A0KA 4LQLA 3ZE7A 3AQIA 1DV2A 3EIFA 3PWZA 3S2UA 2WHXA 1OI3A 1ZJ6A 5JRJA 2XQJA 1ZZEA 3PB3A 1A4UA 4L7VA 1P6QA 3HFJA 2WB4A 3DAFA 4QNRA 4BMSA 4F2GA 1LUAA 4PN3A 1E2KA 1GZ6A 5BV1A 1JIVA 1G3UA 1LLFA 2BW0A 1J0BA 1O2DA 2EAUA 4KN6A 4RLSA 5TSDA 1E2UA 1V9SA 2BMJA 2HJ9A 3B3GA 3UICA 1E62A 1IVSA 4KDEA 4M1TA 4MVJA 1E1NA 3D3JA 1VL0A 2VDLB 2ZVPX 2I8AA 3L0IB 3NGLA 4AJ9A 3FBTA 3AR2A 2IPLA 3RBAA 2EWMA 3VKFA 5TQ2B 1J5PA 3AY7A 3F6EX 1DO2A 3GIDA 3TAHA 1KWKA 7AT1A 5JCZA 3DF9A 4MLZA 5FO1A 1PIWA 2LPMA 1AHNA 3CY6A 1L4YA 5ESXA 5AWFC 4WFQA 1MENA 4YRQA 2A30A 4IIJA 1L8LA 3FWZA 4IXNA 3UA4A 3C3BA 4Q6WA 1NAIA 5KOHB 1GUZA 3NCTA 4N47A 1PQ4A 5GP1A 2KI5A 2BMAA 4DF3A 5CH3A 4K9SA 4DMCA 2BZSA 2GK7A 1MTZA 3WKBA 5HM8A 5AMXA 2X2OA 3NPAA 4WWHA 3VR2A 3WL5A 4EHFA 4EAAA 2HU7A 2V59A 1P3JA 4ZT3A 1OWLA 3Q2OA 4LY3A 1TE2A 4HQKA 4D42A 1VIVA 4FIDA 1NY5A 4P31A 4C43A 3KPJA 1JIKA 1NP6A 1YA8A 2JIQA 2G17A 3EDYA 4I6EA 3TZQA 2GS9A 3PJEA 4U9UA 3RODA 4CDMA 5I9MA 4CZ2A 5EUBA 1AUQA 2VF2A 5TY0A 4YMUA 4IIFA 1RYNA 2J0SA 1DIRA 1IOWA 1H2WA 2QW0X 3OZGA 5AOBA 5G0WA 4COKA 1DZ3A 3HDYA 4ZQHA 1N3YA 1DEHA 1X7XB 3OG9A 9ATCA 2AJBA 3DMHA 1Y8ZA 4Q39A 1FW6A 3BMCA 1B0UA 2DRIA 3EOZA 2QW1A 1NU6A 3INRA 1WE2A 5F4ZA 2YV5A 2P6RA 3JD4A 1NATA 2PSFA 3P2MA 1V35A 5DTRA 4D41A 1SZCA 4I4TA 4E21A 3Q10A 3HNOA 3DVAB 2W42A 1CTQA 1C3LA 2VP5A 1Z6XA 4FKMA 4HNQA 3JALB 2C0CA 1RFLA 3CUEF 3FTQA 1J1UA 3BXXA 1NIPA 3IO5A 1UKAA 3P9ZA 2YWEA 2QZ9A 5AR1A 3A9WA 5GPBA 1ZIXA 1PE0A 1GL9B 4R2HA 3TB4A 1RLMA 3UY4A 1T5BA 3MIIA 1JQDA 4JH0A 3UFBA 1G8GA 4HB2A 1KEEB 3MWDA 4QPJC 5FTMA 2NOAA 4TYPA 4YJ3A 4DCJA 1U4OA 1XVUA 2C00A 1AQYA 1WXWA 1YVEI 3SPXA 4CTNA 2WQ7A 2PDAA 2EW8A 1ZD9A 2GAJA 1RKUA 4WASA 3RG2A 4TKUB 3T3GA 1G42A 3UQYS 3NBXX 2XNDD 2Q29A 2HLNA 1IFXA 3MJCA 4MQFA 3WK4A 3H6GA 2A84A 4X3OA 5GWXA 1I2BA 4B6QA 4RD0A 4JUAA 4BNYA 4LBVA 1PJAA 2EKDA 3GA5A 5B36A 2R6R1 2Q28A 3NHZA 4QEKA 5NLLA 4N7RA 2FW6A 6NULA 2P9EA 3FR8A 5ALIA 4NENB 2O5CA 1R4MA 1U7DA 3R75A 4M1OA 4C2BA 4XJTA 4NCNA 3I8SA 3NWJA 2W6QA 1RYZA 3K2IA 2WWVD 5LNK1 2VN8A 3MUNA 4E5UA 4EI7A 1U02A 1RWXA 1XFAA 1U1EA 2W6NA 4YWJA 3D43A 3UJHA 1Z9BA 5LFAA 3JZMA 1IRIA 4HEJA 4LOIA 2HJRA 3EXHA 4MRVA 3DDWA 1C81A 2D2VA 2HT1A 2FZGA 4L2IB 1VE5A 3ETGA 1XVLA 4GZ3A 2XB9A 4IZHA 1ZNQO 2JI9A 3RHZA 3MCUA 1TLLA 1A95A 4YLEA 4CCYA 3KXDA 1QH8A 3KZMA 3OZFA 4BDSA 1IOVA 4IYJA 1R2QA 4QDXA 3HJRA 5LOVB 5ALZA 4WCVA 3O3NB 5LIRA 2W5UA 4Q15A 4B4OA 4F6RA 5KWJA 2VQFB 3NP7A 4L75A 1EE2A 1JECA 3ESXA 2YNMD 4BGUA 1EFHA 1Q15A 1UC4B 1N2ZA 1X1EA 2AH5A 2G1JA 2W90A 5IKOA 3K1JA 4ZMBA 4RHUA 2QM8A 2A86A 1WSBA 2XUGA 1NNI1 2AR9A 1L8AA 2UZ1A 3ZQJA 1UEJA 4MNTA 1YS6A 2GNOA 1NGSA 5DYIA 3QHPA 4Q24A 3CRVA 4L4ZA 1I6WA 2BEKA 5KAPA 1IBKB 1O54A 3G9QA 1D4ZA 1OLOA 2FWNA 1FNMA 3N8HA 1FFSA 4J76A 3VPCA 2JVIA 4HNUA 4DV0B 1QPZA 1QQBA 3PE3A 1NPDA 4KMMA 1X9GA 3PEFA 1POXA 3BL5A 1TQ8A 1ZCZA 2O8CB 1KVQA 3LOPA 221PA 4GD3Q 4C4YA 1OSNA 3DTVB 2ORED 2VSNA 2ZUBA 4I4CA 3RUEA 4OJQA 3VYVA 5BWMA 1J8QA 2BFBB 2I3GA 3PNYA 1T2CA 4X3CA 1TW3A 1KR2A 2GRAA 3IHWA 5KNBD 1AKRA 5LQKA 3RTAA 2X0RA 3EVTA 1XJ0A 2H3HA 2QJFA 3JQ7B 4IDQA 4NEQA 4XB6B 5AUQA 3CPJB 1X94A 3L6RA 5HEKA 4DCVA 4UTXA 5CIYA 1OGYA 3JQ9A 4M2LA 5KX5A 4G0WA 1YZLA 2P3QA 4BGVA 4DTCA 4HKTA 4I6JA 4CUJA 4OP1A 1XTZA 2OHVA 1QIIA 1P4AA 3HM2A 4LI0A 2ZCJA 2HK6A 1G5IA 3TI9A 3RD5A 2P2NA 1WU7A 5HKKA 1M8KA 4LCBA 2DP4E 4LOHA 5EPUA 3ZYCA 2UZ0A 3PRKE 3EMDA 4EHAA 4ZOEA 1ZOOA 1T4CB 4D9FA 3LY5A 1PV2A 1A8SA 1STOA 3AFGA 2Y0DA 1NXOA 4IJKA 2VP3A 2IC5A 3SX0A 1X92A 1YRQA 3PGKA 4BVGA 3V1KA 4X85A 3K96A 4KE7A 4TXLA 5F5NA 4CTMA 3EC2A 3BD8A 4K5QA 5E0KB 3PDHA 3JW8A 3U19A 3EZFA 4G1CA 5KPJA 1K63A 3KLMX 4PC6A 1Z4MA 2NZYA 2OV8A 4AO8A 3JQ6A 2GEJA 1JSRA 2R48A 4BRZA 2WIJA 3L92A 2V7QD 4I99A 5FT9A 4D3SA 2WJWA 2YHIA 3P0JA 2X40A 2PZJA 4A1FA 2FUCA 2HIGA 2P9FA 2VZ9A 4UAUA 1EJ6A 3PWTA 4GEGA 1ADCA 3TTVA 4TWRA 2A59A 4BPRA 2G76A 5BNTA 1GL3A 4FC7A 1IATA 4NU5A 1T3TA 1A69A 3MGGA 3VI3B 1KZ1A 2NV2B 1ZIDA 3OPQA 2PL1A 4YIHA 1QC5A 2BHLA 2C8KA 3H3JA 4MTCA 1ZD8A 4HAOA 5CJJA 4ECAA 5J4VA 3DBLA 3PQ7A 3S1AB 5KQRA 5K09A 2JJMA 3AZOA 2QUIA 3AY0A 1BDMA 4TS9A 3K0SA 3CBQA 1WAMA 4ECEA 2PU5A 3S3TA 2EEPA 4FHFA 3RS4A 3P9PA 2CD9A 3LY9A 3K1TA 4Q1EA 2AGVA 3ROGA 3SX4A 1MHPA 1SQ6A 1QRDA 2X3UA 3ZTWA 4LF5B 2HBRA 5EJ9A 3ML1A 2JLUA 3T9AA 3OCYA 3OETA 4RORA 3AIOA 4CMEC 4GYYA 3AFMA 5GAJA 4EG1A 1CEYA 5JECA 4GKBA 1JEQA 1CF2O 5I7FA 4J7AA 3ED5A 2IXDA 3V4OA 2ZGVA 2YZNA 1HNXB 3LL7A 3O4JA 1NXXA 1K27A 1IJBA 5BSTA 4B34A 5A9SB 1QCYA 2R6FA 4Y1RB 4YASA 4WOCA 3WLTA 4E4RA 1D9ZA 3SJ7A 2QG4A 3CEJA 4D4HA 4P7GA 3L2OB 2V6BA 5GV7A 5C32A 1G98A 1NBHA 1VLQA 5C34B 1GNPA 1N5KA 5J40A 1LXCA 5IAOA 1PS8A 1CJSA 2WKWA 2V0GA 2FG5A 2EARA 3BUSA 2HPHA 1XZNA 3PFKA 2DY0A 3CIOA 4M7WA 3PQ6A 1J2YA 5LYJF 4PWYA 4NJEA 2NZ2A 3CZCA 3F7MA 4MV7A 4DQUA 4ZYWA 1QTQA 3DAGA 4H0CA 3WP0A 4Y2TA 1VDZA 2YN4A 4B6FA 3I9NA 1GILA 4JT2A 4IH9A 3ZK7A 1K3TA 3BTSA 3FG9A 1ZLXA 5CB4A 1C3JA 5F73A 1YB7A 3KZNA 4C07A 2V6GA 1Z7YA 4YRTA 2QRPA 4BV8A 4DEXA 4CN9A 2CV2A 3IIKA 4LK2A 1C1XA 2B9VA 4GMXA 2H1CA 1VPDA 2A88A 2JBWA 1CJMA 2HA4A 1ESMA 2F3QA 3DD1A 3ENWA 3FMOB 1Z0KA 2NWQA 4C6RA 3FUCA 2VTBB 1KJYA 4A36A 1EX6A 1EFVA 2QMHA 4YRAA 2GVNA 5CHYA 1P62B 2ZM5A 2GEKA 3MT0A 1ETUA 2GWRA 3OVMA 4P0TA 3TJMA 4MI9A 4P38A 4UMVA 1A8PA 2A5DA 5CYOA 3O75A 4ZVSA 1E7SA 1G9XA 1P4JA 2W0SA 3MJDA 4FFBA 3SF8A 4BRSA 4JLKA 1GCIA 5FPKA 4BX2A 3B3AA 3U7QB 2G40A 2XWBF 1DGQA 1EMDA 1J2UA 1KEPA 1H9AA 2BGRA 2BV3A 2P11A 1EUQA 4HJXA 2BMVA 1ST3A 4J7UA 4ZQCB 3SDZA 2JLAA 3TNLA 4DYVA 4K9KA 3ZLTA 4CF6A 3KLBA 3P94A 5CGQB 4XRGA 5H9VA 2AC4A 3O8CA 5JQGA 3KOZA 4FP9A 1UKYA 1ULBA 2XR1A 521PA 4DNOA 8LDHA 4IFBA 4RENA 1RJEA 2IYNA 3LCVB 1I0ZA 3R77A 5AW5A 2F1IA 2WSSA 1R1DA 3K4PA 4F6LA 1NVVQ 4Y2XA 4HDKB 5FBLB 2J5RA 2QY9A 4GPAA 2EX1A 3GLHB 3PD1A 5I9SA 5D8DA 3NETA 3RT1A 4EJ6A 4PICA 1QPGA 3N8KA 1XTJA 4PSCA 3D8NA 3T4XA 3IB6A 2GJ8A 3I5MA 3LLUA 1A96A 4LBZA 3TOVA 2J31A 5THKA 1JBKA 2WYUA 4UDYX 1XZHA 5GM2A 2IV7A 3M1YA 1V5WA 4OXIA 1W4RA 2HHHB 4AECA 5GV8A 1ESDA 4HX2A 4ZCTA 1OPRA 1I7QB 5KCMA 1PEKE 3LNTA 2AXEA 3WL3A 2R8BA 4JJKA 1W5FA 1ZU5A 2Y8EA 3I73A 3M81A 4G9BA 1I1NA 4FHDA 1XZ8A 1Q1QA 1F8YA 2HMAA 2QS9A 3K9BA 2PJRA 2J4CA 3U44A 3GRFA 3H5OA 1HT0A 1MZPA 2VJBA 2OO3A 1F7UA 1C1DB 1D4AA 3PGMA 1ZN7A 4YDHB 2FZKA 5B1SA 1DMSA 1MVLA 2QTBA 3GQBB 3Q9LA 4HDMA 2DR0A 3DWEX 3ZC3A 4BMYA 1TVCA 1XNGA 2J9RA 4F4CA 3W1WA 4PANA 1XCMA 2AOWA 3R7DA 4QTYA 1PYOA 5HS6A 3WSVA 1CXZA 3SEQA 3ZY4A 4EUEA 2YFQA 1KBOA 3SI7A 3V8EA 4DUPA 4DV6B 5B1YA 2HSGA 4HZUA 1FZQA 2HHAA 1X80A 5I51A 5F3WB 3CG0A 1XWIA 2C5AA 4M55A 5KYXB 5K3EA 1WZ2A 1OA1A 4QVKA 3WDLA 3H8WA 4EUNA 2C3OA 3QVXA 1T9KA 1HETA 1GQQA 3ZWKA 2JLWA 3BIXA 2G9RA 3RYHB 2ZAMA 4CM8A 1P80A 1R3UA 3ONNA 4X5OA 1M9NA 1XNHA 4WSOA 3ZS9A 1Q0QA 4WACA 2OXEA 5BVGB 3C7KA 1CUXA 1LNSA 2D3TA 4RH0A 2IU3A 2V9ZA 3IQEA 4N0MA 4QELA 5EXEA 3TLXA 2APJA 1XCLA 3F3KA 4FHCA 3WHIA 4EA6A 3I1FA 2VDRB 3GUVA 3D02A 3NH6A 1CD5A 4XSVA 4D5EA 1V4BA 4XH9B 4DHEA 9MHTA 3JWJA 1EUDA 3QM1A 1JPJA 4HAIA 4AMVA 1SWVA 1Z17A 3EMBA 3ZIAD 2MSKA 3A8TA 2Q1SA 3K9LA 3KX2A 2CXRA 3WWPA 3WYNA 2IOYA 2Q3LA 4OHPA 3KKPA 4R84A 1EESA 1ND6A 1Z22A 2BD0A 1R10A 1CY0A 2O2YA 4N7BA 1ZGCA 4KO2S 4C76A 3GVCA 3K0KA 1YC2A 2HF2A 4I36A 3IOBA 5H0IA 3VTZA 2P2GA 4E03A 4DJDC 3P9IA 2C5GA 1Q1GA 5ILGA 4BNUA 5BR1A 1CCWA 1TM7E 2G09A 3NHSA 4J16A 3RUHA 4YCLA 4K0RA 1OFUA 2OHGA 2WUVA 3HCBA 4YYEA 4CM6A 5JCXA 1T2EA 2ORIA 2SKCA 2W2VA 3ECAA 3OU2A 2O8BA 5C8YB 2GARA 4QGFA 2QTZA 4A8JB 3HJFA 2DXIA 2IXFA 4KQJA 1RYDA 1EWVA 1VM6A 2C5HA 5K4GA 4CMEA 2UKDA 5I9NA 5KWIA 2XE6A 4TTTS 1AZSC 3ZY3A 4RJTA 1RQXA 5EHZA 3ND9A 2ZRPA 3LGSA 2GERA 4DNXA 4G1FA 3OLYA 5EIHA 3T7TA 3WKDA 1SVOA 1P6XA 4UE2A 4D80A 2XMCA 3OEHA 5I6DA 4L85A 1JWAB 3Q5GA 3BSWA 4QLBA 1JA9A 3AERA 2F3PA 1U2DA 4UREA 4BWGA 1TL7C 2JKZA 4BO4A 4TWIA 4ZDIA 2YBEA 1LB1B 5CCBA 4ISBA 3R7NA 3OO0A 1D6MA 4GDFA 2I1LA 1A4RA 1Y9JA 3ZNNA 2DHQA 2F43A 3LNCA 3I53A 3SM9A 4ROTA 1EGHA 4UHEA 4RVDA 3KT6A 4DANA 2QLTA 5HIKA 1QYIA 1QQ5A 1PLJA 2PFSA 2OZKA 3F3SA 1OXTA 3FPFA 4KBYA 4CCSA 2HGZA 2VT2A 5BSHA 2X77A 4MVJI 2DKOA 3HZZA 5ELLA 1I30A 1JZSA 2PFKA 4LXUA 4BNGA 1KAOA 4RC9A 2I7DA 1Z34A 4EB8A 1EM8B 1G2OA 2G88A 4OI4A 5AKXA 1FTGA 3V7YA 1V4NA 5ADHA 1W5BA 2OHIA 3N5KA 3CISA 4FMDB 4G1UC 5DHFA 4KPFC 1RKBA 3JQRA 3ROEA 3GEBA 4TV9A 2FZWA 2C03A 1KAGA 1NX9A 4Y67A 3COVA 2C3YA 3U7IA 4GMHA 1YS7A 3KEMA 4R8SA 4RXTA 2QWXA 2JJ8A 5EP1A 1R0LA 1WMAA 1NHGA 4A10A 3PC6A 5DI3B 2IH5A 2OC9A 1TZ2A 1W0KD 4M0LA 1XO1A 4IOLA 2HSEA 5EE9A 1H1TA 3GRUA 1X6VA 3VUEA 3ZTTA 3A7DA 2GTPA 2JFYA 4B48A 2NSYA 2V7BA 4V03A 3W78A 4XX0B 5FLKA 5C1PA 2VHZA 3W4JA 4AURA 2JAXA 4UTRA 2XQVA 4NH0A 4IV8A 4LCJA 4Q4LA 4GGMX 3UH0A 1MO6A 2C4MA 2QX9A 1AS3A 1L7PA 1OWOA 2HIAA 2PWAA 2J41A 3FNEA 3NHFA 3NT2A 3O8OA 4JI1B 5FOVA 3F2IA 1PVOA 1Q1AA 3ACDA 3PEUA 2C0PA 2ZUSA 5E9JA 4H7FA 1H66A 1L5VA 4IUCS 5GZ6A 1MBZA 3LX6A 4HPXB 5JYEA 3A9CA 3STTA 1RTKA 4Z3KA 1W4ZA 3OICA 3PQFA 1ISJA 3DNMA 4IDNA 1SHUX 4HFMA 5DBIA 1BO6A 1UJBA 1DX4A 2BFWA 2IY9A 2JIZD 1W9HA 4WA7A 2IYOA 1R8XA 1UXHA 2R60A 4Q12A 3SK0A 3AR8A 3R4VA 5BQXA 4I5FA 1CE8B 3G13A 5AM4A 5GY7A 3V1UA 1VMIA 4RHTA 4UUNA 5BMVB 1HDIA 3QEJA 1UXGA 4D0NA 2DFTA 3D2CA 3EGOA 2E37A 3GA0A 4BATA 3OE4A 2PWZA 2P6OA 1G6KA 5I7HA 5JRZA 4X97A 5KOJB 2YHBA 4MJXA 1ZHFA 2ZBRA 3K5IA 2HQ1A 3L46A 4RSGA 3VISA 4XJSA 4FI3C 3RRNA 5GQSA 4RF5A 2ZG6A 3A6LA 4I4NA 4QOGA 4WFJA 3LW8A 1JYFA 1EHYA 4WW0A 4X7BA 1GPDG 3RTGA 5IEJA 2ETXA 3M8KA 3QLUA 5CLLA 4Z4FA 4QBIA 1O9BA 2JLVA 3MOIA 5E6RB 2PWBA 1PZFA 3E1SA 1YUMA 2QPOA 1DC3A 5T3YA 4DA7A 5E3IA 1PAUA 3G0CA 2CLIB 3HBJA 3HGQA 4G81A 2PQ6A 5KTPA 3GG2A 1NXPA 2JK1A 1LPPA 1CR2A 3PUZA 1G5HA 1T3LA 2OHHA 4RV9A 1GPAA 4ZOBA 2OSVA 4AZSA 2FW1A 1K92A 2WE8A 2YV3A 3F7TA 3AFNA 3HVKA 4W5HA 4DDUA 3TSZA 5BN4A 1GDDA 2VT3A 4WCFA 4BVJA 1ZSYA 3HJAA 3L1VA 3EGXA 4YJHA 1GPYA 3ZY5A 1EZZA 1QP0A 2GJ9A 1ZNXA 4Z3OA 4XR4A 4EVIA 4GR4A 1C0EA 4LV5B 2WU8A 2CXSA 1B93A 1ONOA 2EF0A 1VL1A 1OC4A 1K7CA 1RE1A 3F6YA 2H1FA 1PWZA 3G2HA 4O3FA 2PMEA 4EDFA 3U16A 2ZE7A 3EJ6A 1EBFA 4K7JA 2PO7A 4JUIA 4XYMA 4F2PA 3DTYA 2ZJZA 3GNTA 4H1UA 4QHYA 1WUYA 3AKYA 1J0CA 1JIIA 3WZLA 2GBIA 4J1TA 3IKJA 3ZWDA 3AH8A 1PJCA 5T8KC 4A82A 1QO0A 2VF7A 3GDOA 3RT9A 1UBFA 2G67A 3LCMA 1X87A 3H7IA 2FRVA 3B2EA 4EGFA 4CNBA 4NBLA 3W5CA 3NBUA 1V95A 2V1UA 4WA8A 4Z8YA 2IHZA 2Q8NA 5I3CA 2CW5A 2P69A 5LQAA 4P84A 1WEKA 1GAJA 1TF5A 3NNDA 3E3NA 1S2DA 2J59A 3G7NA 3JXEA 3OBIA 3V33A 2JS7A 3DEYX 4Z7OB 5FULA 2IA5A 3UC5A 2FUKA 1FA9A 3T1NA 4I1IA 4L73A 2Z4RA 4QYWA 1EXVA 3CUUA 4C4PA 1QFZA 3MJVA 1NFFA 3PFIA 2IYAA 1JIJA 1WP9A 2J4FA 2PYDA 5LM3A 1IPHA 3CV3A 4XDGA 4NYIQ 4ZVLA 2I7XA 4XIFA 3U13A 3USZA 1BJKA 3ER9A 2HLHA 3M6AA 1KEVA 2I2BA 3KFVA 2XTAA 3KFLA 3T7JA 3V1LA 1E2EA 3EXEA 4AVYA 1L4UA 2A33A 2AYYA 3OEED 3LQFA 2GJ4A 2VUIB 3EQ8A 1N25A 4UE3S 3Q8WA 3QHAA 4X1IB 2C42A 4MULA 5JAQA 3G8YA 4D3YA 2FMTA 1AIPA 1YSCA 4M22A 1U90A 1T8YA 3CONA 4FSDA 4G5GA 4CV2A 1BH2A 3C6XA 1UP7A 4ND6A 4AIIA 1ZCFA 2N46A 4FMCB 5CGZA 3QF4B 3VDMA 3U3OA 3CW8X 2QRJA 5FHQA 5ER6A 4BU0A 2B37A 3BE8A 4UDOA 4C4SA 3H9UA 3L41A 3Q3VA 5BR8B 1U8AA 3FCYA 3M9WA 3OMWA 1RQRA 2VJAA 3B1VA 1E9AA 4KMOA 3VDRA 5AVSA 4MEJA 1E6WA 3IXQA 4TL8A 2O8FB 1CDEA 5DSZA 1DWUA 3P9KA 3SGLA 2P9QA 1QF7A 4HQRA 4WERA 1QS0B 2FHPA 2HJGA 1OLUA 3GUZA 2VDOB 5EQJB 5FTWA 3FJYA 3SDSA 1LVGA 3IPRA 3WHLA 3CFYA 3N59A 3RVKA 1BG6A 1GZ3A 3A1CA 2QTHA 4TWBA 2A9FA 4HNAB 4AMUA 5BPFA 4LZZA 3SNKA 3BFKA 1KJ8A 1SCUA 4DR7B 2IX9A 3PGXA 1CLEA 2B82A 2OFWA 2P4EA 4RIGA 5CIWA 3FHLA 3TBKA 3VR6D 2I2CA 4AZ3B 4OHFA 3B1XA 3PDWA 4P81A 1LDYA 1M5TA 1JDPA 3HJTA 2H1HA 2DWOA 3LUBA 1SD1A 3PRHA 1XTVA 5AJZA 2OXTA 1H5QA 3T06B 3C7AA 2QD1A 4CFYA 4YRPA 5CB0A 2QI9F 4E7PA 1VMDA 1O0BA 4GBGA 5BN5A 4PRKA 4CI0B 4ZRDA 3BMNB 4MRMA 1MRZA 2DY1A 1TCAA 2GEVA 5JSKA 3ZIUA 4BC0A 3BHNA 3MHTA 3GT0A 3FSGD 1JSXA 1NONA 1ZN2A 3STVA 4PYIA 4KQFA 1DNPA 3JQAD 3PDIA 5GJVC 4O5AA 1YFLA 4M0FA 1QP8A 2HA7A 3RYFB 5J1SB 5ADWA 1PR4A 2IF0A 2A1TR 4ZT6A 1EAMA 2I2WA 1IWBB 4Q9KA 1ZMXA 5BMVF 2HQBA 4OGKA 3GY0A 3VJMA 3TECE 1JLLB 2WMNB 2IK8A 3CR8A 1UL1X 3OSUA 4RD6A 5TPWB 3RQSA 3U1TA 3TVDA 4ZI7A 2GPNA 3QP9A 3TJRA 4D46A 4C6TB 1NRXA 3U2QA 1UXKA 3KJXA 3CLVA 3REGA 3I0ZA 4LQCA 2F48A 2FF5A 1EFAA 4RL6A 2KBEA 3IP8A 3UVEA 3AWIA 2HPZA 4JVSB 4TKZA 1JQLB 1CC1S 2DSNA 4C2UA 3HP1A 4UNQA 1MHTA 2ZIEA 3A9RA 5EIBC 1L5ZA 2X13A 3R6TA 4AZ0A 2ZDHA 3KUXA 4KLNA 1FW8A 1Z3IX 2HMYB 3GAAA 4KV7A 5AM3A 4QPNA 2RBEA 4NCKA 5CT6A 1V7PC 1WNTA 3BG5A 2Y2UA 4AT1A 3GJ7A 4QICA 5EWMB 4D4JA 2EIXA 4JD5A 4CLEA 4MIKA 2XHZA 5B12A 3GRRA 4RF2A 1VZ2A 1YU6A 4K9NA 2EF1A 1FTWA 1Y3BE 3VKUA 5EFZA 4GPBA 4EYKA 4ZOLB 1P2TA 4HWKA 2N47A 1UXIA 4O4HB 2R1TA 1KU0A 3NKFA 1Z2DA 2B36A 2Y68A 1KDVA 3K32A 1L5NA 3C43A 4C04A 5CFZA 5CLJA 4CMGA 1AGRA 5K0TA 5K5EA 4CF7A 1WULS 1YK0A 1K3FA 2WINI 4RCYA 3WIEA 5K3SA 5C5EA 3P9CA 2MSCB 3OOWA 4GH5A 2ODTX 3DZIA 2OAQ1 4K6GA 3PXAA 4RDIA 5F1YA 1JKFA 1QCCA 2FZ4A 2VP9A 4OK5A 3RARA 2ZI5A 2X14A 3OT1B 4MWZA 3TN7A 1BCSA 1MB9A 4JBWA 4Z54A 3OTHA 4OSPA 3KZVA 4Z53A 1ZX1A 3D64A 3HK2A 1B1AA 1NLMA 1IOLA 2VCEA 4H17A 2JFWA 4HBGA 2WOOA 1B8VA 5DP1A 2WY2D 3BWDD 4RKRA 2OBMA 1GAEO 2C9ZA 3WDMA 2NUPB 5ELMA 2EFJA 3F46A 1WB6A 3V4LA 3TEJA 3HTXA 3Q8KA 1U7UA 1QVWA 1DINA 1QHXA 2PPVA 2X0IA 4DGQA 1IBLB 1XL1A 3QNUA 4LSGA 5T8KA 1PWEA 1U2GC 1K9VF 4JV5B 5KSZA 1UJ5A 2FMIA 4P4LA 4RESA 2QMUA 1N2JA 2XVZA 2VSOA 4N9WA 3I5UA 3GBVA 2NU8A 4EFNA 4YUZA 3NVDA 3WGQA 2VHWA 3PVSA 2ORYA 2EX4A 3E9DA 1FQKA 4XTCS 4CXMA 3NBKA 5EIXA 2IPMA 3QWIA 1QHNA 2HEIA 3UIEA 2IXEA 2REXB 1NXWA 3CF6R 5EKUA 5CA0B 1LLCA 3V8PA 1XTTA 1KYQA 1NJSA 2BLLA 3H4IA 4HS4A 4F11A 2GRJA 3QI2A 4DA8A 4YRGA 3V6MA 1BVYF 1AUVA 4C2AA 1IAQA 1KYYA 4BNKA 4TMWA 2IDZA 4M1WA 2TECE 4L4RA 3HBLA 1TM4E 3CGWA 4OK6A 1JWBB 2CLEB 1WZUA 4FMCF 3W6NA 2P9GA 3P0IA 1KJNA 2JAUA 4I66A 5IFKA 1WDLA 3AETB 2GZ1A 4XEUA 2GUWA 1WP4A 2EKPA 4C3UA 4C7KA 1Z13A 1LBSA 1GVNB 2V45A 3LLVA 2PMWB 1Q0PA 1QJCA 1QQ6A 2P2ZA 1NY6A 2AHOA 5KHAA 1AS0A 1HT1E 4LY0A 5IEBA 2R1VA 3OIVA 4N82A 1SBTA 1SU4A 3B7GA 2XA9A 3KQTA 4AJ2A 3QKUA 3KQLA 4NEGA 1JIQA 1ABFA 1TYZA 5FHRA 3FKJA 1TDJA 2EL9A 3DZBA 1I3NA 1QYVA 1Y8RA 5EZYB 3C6ZA 1PSZA 3O26A 3RKRA 2V4MA 4Y2VA 1RAFA 3WLOA 1QWOA 1QXSA 2YCLA 3E3AA 4Q0MA 1QM5A 3A26A 3SF0A 2E3JA 4WNYA 1J9EA 3GP8A 1SBYA 5F3DA 3EQZA 1GPBA 4HDSB 3UBMA 3TLMA 3TRIA 3HUUA 2XGSA 3C5EA 3Q0TA 4XVUA 3GT3A 1O1YA 3ANXA 2ILTA 3UAXA 3RRJA 1J6UA 5CM2Z 3HCNA 4B09A 2O0HA 1T35A 3DXZA 4GP9A 4H59A 3PU6A 2UYQA 4H0NA 3TDKA 1P7YA 1CQZA 4DDWA 3L6EA 4D92A 5A03A 3OY2A 2ZE6A 3LUGA 1T9ZA 3OOEA 4RFSB 4UCWA 1S7CA 3HB9A 4N5HX 1S89A 4YJGA 3TX2A 5KINB 1IM2A 1USGA 2VF8A 1JHRA 4BFXA 4DS3A 1H2XA 1M54A 1XI2A 4KO1S 5B3JC 5IK2D 2GM3A 1W48A 1M34E 1RJ9A 1KRHA 1WLSA 2CXTA 4R83A 5REQB 3L6CA 3VU1A 3WGOA 1R18A 4ER6A 3TAXA 4AXXA 5I9BA 3S81A 1N0HA 2VAWA 4ZXFA 1WUIS 2W2LD 1GCGA 4U0KA 2PL3A 2G36A 4ZEOA 2C2KA 1UAAA 4CDRA 1MABA 1MO5A 1CEQA 3HDHA 1HPLA 1RWVA 2ADOA 4F71A 1B16A 4GVPA 4RTSA 4D25A 1DB3A 2BTQA 2QPLA 2XYGA 4Q01A 3RVMA 1T5SA 3UH1A 1FTYA 1PEDA 1C8LA 1QH9A 3BAZA 2Z8ZA 3AOGA 1I2CA 4X66B 2I54A 1SM4A 4YV2A 1NT4A 2ZYRA 3W5AA 3FSJX 4M87A 2R7LA 4H7JA 4JJ7A 4Q1BA 1FIUA 1X7YB 4AY2A 1BSVA 2CLOB 2HV8A 4FNAA 1KQNA 3VR1A 1GZUA 1E1KA 1XU9A 5CFNA 2P68A 4R98A 5JSFA 4DJJA 1F0NA 5TGDA 3RROA 2D0PB 3SXPA 3U6BA 1FYVA 2CLKB 2FCRA 3NPMA 3CZRA 5DTQA 3AESB 3LU1A 3LQ4A 4UFPA 4Q05A 5SYNA 3W4KA 1Z7WA 4EO7A 1TZJA 3AEKB 4KQGA 5HF6A 3T5AA 5KYGA 2IX3A 2QRZA 3OURA 5HS4A 1NR1A 4RSHA 1WMFA 4S1NA 4EW2A 1U0NA 4O4HF 2WFZA 4TTQA 1P1HA 1I3MA 1NMEA 1U94A 5TGZA 5C46F 4DA6A 2ENUA 3BVPA 1AKUA 1K06A 3OZWA 4BN5A 2RHDA 1IB6A 1S8FA 3TFQA 3IBSA 4JYAB 3VX3A 2HTFA 3WLQA 1SULA 4MRPA 1UBLS 2YMQA 3KR1A 1G41A 1PLLA 2DLNA 1TF2A 1XQXA 3LFHA 1DIHA 1SUDA 3IA7A 2XMGA 4YCMA 1CJCA 1QE3A 2PLAA 3L8CA 5ALTA 1PDVA 1RI5A 1KJ9A 3AB8A 4FT4A 1GUYA 4X7RA 3PNQA 1NU8A 4QO7A 5ECDA 5FAXA 4EMSA 3J80A 2WTNA 1RZRA 5KYWA 4LV6A 1N9ZA 1H6CA 2LCFA 1S1CA 4A5SA 3EGVA 1ISRA 1SXJC 5DO9A 1N2EA 2GAAA 1ZO8A 2R96A 2HRBA 4H3KB 4L1KA 3TIGA 3E6AA 3V8MA 4DR4B 2CZGA 4FGZA 1TTHA 3LQYA 2YY7A 1Q17A 3I92A 3LGAA 5JISA 3COJA 5SZJA 2BC9A 2B21A 4RAOA 3VSEA 2VLBA 1TUGA 1V9LA 3WRXC 1N7IA 1CRZA 4DKXA 3OJLA 1R0XA 4F2WA 4V3BA 4FGKA 3OM9A 2EJCA 2MSNA 3KLNA 3EPRA 5JWHA 4AU1A 3WLPA 2DOKA 5MN5A 2D2EA 5CA0F 2CZCA 3DTTA 4F4IA 4QHSA 3DE3X 2D0IA 2WU1A 1IY2A 1VP9A 3LWDA 4HLUA 4IJUA 3PK0A 2B1IA 3IELA 4IMPA 1Z18A 3N53A 5DASA 4B0PA 1RC8A 4Q4DA 3ZHQA 3ZCXA 4AO6A 4RK4A 3N7AA 1LBHA 1PK9A 4EYGA 2X5XA 2ZIXA 4IIVA 5KTSA 1B23P 4UNPA 4KWCA 1KO1A 2GKSA 1BXRA 4PQGA 1SEVA 2NQ8A 1T8RA 3C1TA 2B8TA 4FYWA 1LQTA 3SE7A 2WB2A 4R6WA 2WHEA 4OI1A 5JZOA 2QLFA 4QYIB 3DHVA 2C1EA 2CKMA 3UHFA 3KDSE 1V1MA 4P9NA 4Q9LA 1T5HX 1PYGA 4AN0A 4PE5B 4P4SA 3BWVA 1RPTA 3K1AA 3SZMA 1LSUA 4PAWA 2I3AA 3CSDA 4BLUA 1QOQB 2IZZA 3TR0A 4AC9A 1V2GA 2BFCA 4CN8A 1R12A 4MHSA 2VHJA 1W1IA 2ID8A 2XA1A 5FFFA 2JFXA 2L18A 4IHKA 4V0KA 3UJ7A 2KQUA 4CWAA 5EZYF 3KB2A 1WXXA 3R6WA 5EP3A 4BUCA 3EGCA 1U9ZA 4YAUA 4W5RA 4IWXA 4R1UA 1FXSA 3VKHA 1X1QA 4G0PA 4KQ2A 4PYOA 3NATA 5C7OO 4JKOA 4EP1A 5LD2C 2YJ3A 5LLSA 3DMGA 3O9VA 2C8VA 3MD9A 1U5AA 4XTRA 2DT8A 3R9KA 2W7TA 1NUSA 3ND6A 4QODA 1GPLA 5CMLA 3ZWYA 1UJ6A 1K8XB 2A57A 5AK6A 4BAGA 4US2R 1EFPA 4I5EA 4MW4A 4INAA 2PUFA 2Q8PA 1AKTA 4EGAA 3JQAB 4N5IX 2XF2A 4W4TA 2G77B 3FE2A 1JXMA 4AX8A 4U8HA 4ZO4A 1DDIA 5I7SA 1Y8QA 3CLRC 1KOLA 2MTBA 4JROA 4HH3C 4CQMB 4EKEA 5IULC 4QUHA 3TXAA 1KA9H 3SR4A 1FP2A 3ESCA 2V74B 1GQ2A 2AX3A 4G4SP 4O25A 3WGYA 3ZHTA 1MEJA 4C9BA 3CCBA 2HU5A 4RTKA 1UBKS 2IEBA 4P93A 5EWJA 2VK1A 2F9LA 1VKNA 2HCTA 2GPSA 3A1DA 1T2FA 2QUHA 5DNVA 4URWR 5FXMA 5B58C 3H0EA 3O8QB 4W7IA 5BUCA 1A82A 3RFXA 5H3LA 4OBWA 3NHJA 4LYYA 3L7LA 4YRCA 3C70A 4DLRA 4KYVA 4C89A 4LX8A 1DJOA 2JD2A 1ZCAA 4J2HA 5BSKA 3PTZA 4FFNA 1O4VA 4MKIA 2BEVB 4ZAGA 3A2KA 4TTRA 1J06A 3N2KA 3OKAA 3IUJA 1PFKA 4DMRA 3MELA 4HGZA 4LHYA 4TOIA 3SYKA 2BFEB 4QM7A 3CINA 1G20B 3H87A 3S40A 2PH3A 3IIJA 5HCUA 3ERCA 5IT9A 2G0TA 1M2VA 1UXOA 4K05A 1N2XA 3B5EA 4PZZA 3UK7A 2FSPA 2FPWA 3FMGA 1L4KA 4YGYA 3ZWPA 2AX4A 1KSGA 1X1AA 4IGFA 5AJWA 4EFKA 3CJQA 3ADCA 1UM8A 1US8A 3AL3A 2JEZA 1SVSA 1QRAA 1YH3A 2GEBA 1GRQA 3DYVA 1XXLA 4RVHA 5D5HA 2Z08A 5F52A 3ZXSA 5IG2A 1GHTA 2G0AA 3HYSA 4MICA 4LZOA 3FDFA 4MVJD 1M1UA 2R84A 3INTA 4MWOA 3E27A 1D9XA 1LBEA 2RHMA 1O0CA 2QV0A 1JG3A 2QN1A 2CNDA 4Z9YA 4E31A 5IYZA 1EFTA 2F00A 4OEHA 1B2LA 3CKMA 3L49A 1JG4A 3T3HA 1I6LA 4H1WA 1H8EA 1P2BA 4O2AA 5ARBA 4MWEA 2ILVA 3BWCA 4RANA 3UPUA 4FM9A 3P9XA 3PUHA 1RHKA 3PLNA 2WDZA 1H22A 1FP1D 3RWOA 2I67A 4NSNA 2PUCA 5I4CA 5AFSA 3DFUA 4GOOD 5CPBA 3Q6MA 3IMFA 4X41A 4LOAA 1CQJA 5D3MB 4FJ2A 2ABWA 5A3QA 2NSDA 3VR2D 1MGPA 1U8EA 1KIFA 4WZBA 4QQ8A 1XHEA 5BSRA 4QFDA 2C5EA 4NARA 3CO5A 1QIHA 4RM2A 5DGIA 3U09A 1RI3A 1XN1A 3F9IA 2VYNA 1UDRA 1V3QE 2GCNA 4YMWA 1BOFA 5JD6A 1DRJA 1T4MA 3GFBA 4DC0A 3EZYA 3VVCA 2PL9A 1XRMA 4ZVMA 4M0EA 4CBVA 4FWTA 3T9FA 1W85B 2ZITA 3EQ2A 4L6IA 4P98A 5JAHA 4LZWA 4R1SA 4BP9A 4F7DA 1EFRA 1CZLA 3QNWA 2RG1A 1D09A 3N0XA 4FXPA 2A0XA 2V03A 3O1HB 2CF5A 2GPJA 5I48A 5KJ6A 1M33A 1S8AA 3DBVO 1O7JA 2FB9A 5T41A 1TCCA 3X44A 4RS3A 2PUTA 4L5YA 3WQBA 5KYUA 3PE6A 5JNLA 3KKKA 1DWPA 1PR1A 1KI7A 1SC9A 4RTMA 4B2LA 4QGBA 2GI4A 1GSAA 3AYXB 3NHAA 3K15A 3PDUA 4GHWA 4KOAA 4CQLA 3ICCA 4X54A 2EEZA 1Q21A 2IITA 3KOOA 3KKLA 4GG1A 1XLVA 2IZ7A 1UPXA 1E96A 1QR6A 1UADA 5EJ8A 4JYCA 2IS2A 2NX2A 2VJPA 4YBZA 1I7PA 3GGDA 5BXYA 2LR0A 3E8SA 4F12A 1YS4A 5KWEA 2AI2A 1Q1ZA 2O7RA 4D0SA 4ZI2A 2ECOA 2RBGA 1UK6A 1ONSA 1SBHA 5EIEA 4Z7JA 3ZD6A 1WRBA 1ZN9A 2PX0A 3AV0B 3WRXA 1VHQA 4UVHA 2OZVA 1VYTA 5AT1A 3GLFB 1L6IA 2CLLB 3O3CA 3LH5A 1SB9A 2C82A 3QBEA 4K86A 3MERA 3STWA 4H7IA 5TT0A 5BR4A 3AF2A 3W77A 3WS7A 3B3QA 2ZYHA 1L4MA 2NO7A 2WMYA 2BKLA 1FC0A 5G4LA 1E6MA 5LKRA 4MKGA 5I8PA 1HURA 1SZPA 4RQUA 4YAFA 1HO3A 5C8DA 1E2BA 1U7OA 3O92A 1E79A 4MR8A 5IF9A 1HNWB 3QEOA 5ERXA 2JJ2D 1BWQA 3KJGA 1UPBA 1O8BA 5IJ0A 4Y0AA 1KQPA 2ORWA 1X42A 1ZVMA 3H4VA 3H18A 5ALQA 1ILWA 1W6RA 3UANA 4EO4A 2PR2A 1NTRA 1G1MA 2B35A 2BT4A 2H2HA 3H6HA 2B30A 3AI2A 4BCDA 1CETA 2R6ZA 2JHCA 2VDPB 3MT8A 3I1JA 4G5RA 4P4TA 4QRIA 4KXLA 3RH0A 1R0ZA 3KJHA 1QGOA 2XTNA 3EMVA 3OFJA 5ANRB 5AW1A 4Y9SA 4QECA 1EK0A 2ZYAA 3QPDA 2ZROA 3TLGB 5KHOC 3EH1A 4BS9A 4EKIA 4W5QA 2PLNA 3VV2A 1SUBA 1X7GA 4BLRA 2JATA 3PX3A 5ITWA 1N4DA 2P4SA 2XKKA 2J3QA 3W2IA 3JVUA 2VI5A 5KVCA 2B6NA 1ES9A 4OAPA 5DV9A 5JCJD 4FD3A 3VDNB 2W58A 5EWLB 1W5EA 3ET4A 1UBSB 4ZVQA 4AAYA 4BFLA 1M10A 1FFBA 2WTEA 4PGAA 4YCAA 3B3FA 4S1VA 2L0XA 2WA1A 5BYAA 2HR1A 1CIPA 1SCDA 3FSEA 3MINA 1PR6A 2DHRA 2C4NA 2CFOA 3MJ4A 5EHXA 4H15A 3GPBA 1IK4A 1XPJA 1V16A 4MW5A 1LVHA 3PCTA 4L8LA 3M9XA 1FPQA 1YB4A 3ESDA 3D9QX 4JUDX 5CW1A 3V4FA 5K3CA 1DAGA 4OG2A 5DRTA 1ABBA 1JR3A 3ITEA 1IN8A 4DMFA 1YKGA 3BRQA 4ETNA 3G23A 1EIZA 4CTJA 4OB6A 2Q7DA 2H1OA 3C3JA 5JG7A 5FPPA 2PGNA 1YR7A 1YR1A 3BN3A 4IDCA 1ZEJA 3WLNA 2AD5A 3L8GA 1A3CA 1JDSA 3FGOA 1TRKA 1R0CA 1QYRA 3Q3HA 3O38A 3TNJA 4B6GA 4Z4CA 4DRXA 3D2BA 3F1LA 2AN9A 1W4CA 1BEZA 3BX1A 4MDFA 3A4NA 4MW0A 4UZEA 1RC1A 3ABIA 3D3WA 4V0QA 1DCMA 1AT1A 5CVVA 4BUZA 2V5UA 3U7RA 3C8DA 1GV0A 4Y0NA 3DL0A 3FNFA 2V7WA 2Q46A 3H86A 3K9GA 4EENA 5CRIA 1Z0AA 2QKYA 2IPAB 4TN1A 1E92A 3OFKA 5AW7A 1QAMA 1YBVA 2WJGA 3VI4B 3SKXA 2IGTA 1CB0A 1HK7A 1CQIA 3ZHBA 5HKKD 4EHDA 2FOIA 1M2OA 1V11A 3M33A 3JARA 4DSUA 3IL2A 4RF4A 2CLCX 4REQB 1GG8A 3GUYA 3PFCA 4K9QA 3AF4A 3SYRA 4IXWA 2NXNA 4MMZB 4FWBA 4J0JA 1F38A 3G82C 5I9TA 5BSEA 2D7JA 1WDTA 3G5TA 4ILEA 1OXXK 1JP7A 1JRLA 1LV8A 1SHJA 3KHKA 3LC7O 3ROMA 1TEXA 1WOMA 3A11A 3MHPA 4UJ5A 1QH1A 4QQFA 2W2QA 3GWGA 3EHEA 4RA6B 4KSCA 2YIVX 3RRYA 4F3CA 1A9XA 4GU5A 4GI7A 1QX3A 3ZHCA 1LNZA 1SKUA 4RHYA 1VMEA 4INPA 4D3DA 2VP0A 3N58A 5IBQA 2QUZA 1RQ2A 3EARA 4PX3A 4YO7A 2A9JA 2WAAA 3A2MA 3FPHA 3P45A 5CXSA 3SIWA 1MIOA 3BXFA 4RPIA 5IUNC 1KFCB 1RD4A 3QTTA 4XIYA 1R0WA 2C4UA 3N5CA 4IBOA 1QP4A 1F8FA 1MKYA 1XKLA 2C57A 2R6HA 1B6GA 3M9LA 4H1HA 4PBTA 1D4FA 1QMPA 2W71A 2EGGA 3QVUA 1ETHA 2XMQA 1PKXA 3ZXIA 2MT9A 4MV1A 5DW0A 4MUJA 4HGRA 2Q8QA 2H2DA 5DYGA 421PA 2H17A 5K01A 3EC1A 2Z8YM 3UOWA 4UU1A 1LW7A 3D8HA 3HRKA 3DVSX 3TCKA 4D43A 2QRNA 4DLLA 1IN7A 1Q95A 2G0NA 2VWHA 3DMDA 3FDZB 4MGZR 1BFDA 3UW3A 4ZHQA 2E4AA 1OVGA 4YT4A 4NDZA 4HC4A 3BH6A 5H8WA 1XUOA 3NX4A 4JJIA 3I12A 1R5OA 1YHZA 5K0CA 4O2BA 2RAVA 2D13A 4MI1A 4MGIR 1J24A 2WYVA 2ZRNA 4FFPA 5HBRA 4Y6SA 3PT9A 1WEHA 1ISGA 4JI4B 3R1IA 2C83A 4YP0A 1ARZA 1GTL1 1U0TA 1XEFA 2GWHA 4MUHA 4X6XA 3WFZA 3UKJA 2HSJA 2A2ZA 1Z4QA 4W6QA 2RGDA 1QYXA 3LKVA 2QAGB 5EJ7A 1KP2A 4DLUA 3PQ4A 4IP0A 4AMZA 5F76A 1RRCA 3EZ2A 1PVDA 5AJUA 2XAUA 3N6XA 3G1WA 1RM4A 3W6UA 4ISCA 4RIFA 3EZLA 4RVFA 4BQOA 8AT1A 4MDEA 4Q4HB 3I61A 1L9KA 1XCBA 5CP8A 1SBQA 5J2UB 3QX8A 5BW6B 1B41A 3AI7A 2BR4A 5EL0A 5FOTA 3DUFA 2VNHA 4KBGA 1XK6A 3PC3A 4LPSA 5DBEX 4Z2YA 1Z56C 1IULA 1QZ3A 2W9XA 3RC9A 4B17A 5F7XA 4NH4A 1QG0A 4KFUA 4OF4A 4AN1A 1H2YA 1NNSA 3EPJA 2O07A 3LO8A 2F17A 5EYPB 3AVYA 4DM3A 3BMQA 1GT6A 1DIAA 3SSNA 4A03A 2R7NA 3VYTB 1FSGA 1MB3A 3OA0A 4P3OA 3MMPA 3D1VA 4HCJA 1ECGA 2EL7A 3QY0A 1JXOA 4YX9A 2ZT5A 6PFKA 1E9FA 2BGLA 3PWSA 6LDHA 1XTSA 1EWYA 4J4TA 4RZHA 1ZGGA 4HDQB 1DHRA 1E2IA 1RQLA 4CHTA 4IGAA 1I3CA 3IAM6 1JQKA 4C3VA 1IHYA 1XRRA 1Z4NA 1MU0A 1RYBA 4GO1A 3BWYA 1T0PA 2R4TA 3SS7X 2DFPA 2OAEA 1VCOA 2A0YA 2PMFA 1TCBA 5BVHA 1GPMA 1SVNA 4C7BA 2ODNA 3QG1A 2H4ZA 3NALA 4MWDA 1QIMA 4PPNA 1XZKA 2RGNA 2RJOA 3TSCA 2UYOA 3M2TA 4RE5A 4EUSA 3CLTC 2O3UA 1CUEA 3AVOA 2FEWB 4L74A 4PC1A 5BP7A 3LUDA 5A7FA 2QTVA 2WSSD 3BA6A 1V48A 1WUHS 4B2PA 4C03A 4I55A 4DIBA 3EGIA 1M2WA 3H5AA 5FFNA 1ECPA 2JD0A 4FQ8A 1PSWA 2CMDA 2XT6A 4HD8A 3M6UA 2B7BA 2V0NA 1N6PA 4J9UE 3SHWA 3WLRA 3ZJYA 1E0KA 1WY5A 1NA5A 3NGXA 4TLCA 1R64A 1E4OA 1OI4A 2GJSA 2X8AA 2OHJA 3ND8A 4CKCA 3MGCA 2IEAA 3F7OA 4CW7A 5K0SA 5I8ZA 5G4KA 3PUJA 1YOBA 2I9KA 5MGNA 5KYWB 4YI5A 3FPAA 3RJTA 4Q1VA 4C0BA 1RWPA 1A8HA 1PNTA 2CYBA 1JHPA 2V8BA 2VAPA 2XCLA 3WO0A 1NYRA 1T0BA 2ATEA 3ICPA 4WKPA 1GQOA 3L7BA 4DN6A 1GNTA 3QPBA 4PZUA 3DDOA 2BKUA 2V8OA 2XQFA 3H9EO 1IY9A 3VR0A 1XXHE 4YRBA 2BGGA 5C7YA 4V0MA 1VKHA 1E2GA 4K28A 2XXJA 4L5JA 2C5LA 2O4UX 2Z5GA 2OBNA 4OU5A 3IDZA 4LECA 5E8JA 4EF4A 4ER3A 2PFGA 1BXKA 3IERA 4KN5A 1BHJA 4NABA 5LPNA 3HZOA 2ZRMA 3OPVA 5JXGA 2DR3A 1PZNA 1SOAA 4GBJA 4JUFA 1EP2B 4II3A 4TRNA 2ZYGA 3RSFA 3UK6A 4E94A 2P5UA 3D7MA 1W4LA 3WG9A 4TWJA 4WADA 1EDDA 4QLOA 2HJVA 2R25B 3BFXA 1RFGE 3QVLA 4CG3A 3AJ8A 4E70A 1E3TA 3QZUA 5CM8B 2DX7A 2ZI9A 4YP7A 4N3GA 1A72A 5E4JA 3U7FB 4DCPA 3VO1A 1J1ZA 2FUNB 4FZVA 5JDCC 4AS3A 4UUPA 3FFXA 5IJZA 1N2HA 4N8EA 2BP7A 5ITZB 2PIDA 4RMNA 4F92B 4I46A 1VG1A 3NFRA 4BKMA 5DXJA 4MV8A 4EFDA 1R6AA 1SC1A 1M2EA 2QY6A 2JGJA 3ROKA 4XPIB 1T6BY 1ULHA 4QOFA 4ZQGA 3OQ1A 4J0KA 3U4IA 1X15A 2J9FB 3PXCX 2QL9A 3DM5A 2P79A 1AXGA 1W29A 1E2QA 2BDEA 3GZNA 3PA8A 4JGBA 5IAKA 2EHJA 2PD3A 1QAOA 1DU4A 1UT6A 3QQ5A 5F7ZA 3OFNA 4WIAA 2GF9A 3N2ZB 1AF4A 3LKBA 3IUSA 4Y2HA 3ZN2A 4CEHA 2WF5A 1P73A 4EEXA 3HKBA 3LPCA 2NU6A 4B46A 1EFLA 1KVSA 3OU7A 5B7GA 2PYZA 5IJWA 2C7OA 2JFVA 1RPNA 3SX2A 2GJKA 1QK4A 4YCSA 2G63A 1YCFA 2MU1A 1DCTA 4EHNA 1Z6ZA 1IBMB 1PI3A 1OFIA 2BEWA 2Z0MA 1OX5A 3HBAA 4LZNA 3CUYA 2QEQA 4J4HA 2O7QA 2P2SA 2RIPA 2EWWA 3H65A 3RAJA 4D98A 4EJFA 1OXUA 3FNGA 3QUTA 4A26A 1GGKA 4G85A 4JC8A 5DHSA 2FNAA 3TMKA 1CBUA 3EY4A 4PFSA 1WXQA 2IZ6A 4KG7A 2H5IA 5KWSA 5IAGA 4YJKA 1QONA 1U0JA 3ZQKA 1V8DA 4UAJA 3NONA 1X1CA 3M49A 4GNRA 4CT4B 1EXMA 1R4MB 4IFIA 3U49A 5H3HA 3L6UA 3VU3A 2HPVA 2Q21A 1E2JA 3HV0A 3VNSA 5EMMA 4F4DA 2NXCA 3OEHD 3HNPA 1EUCA 1EB8A 3BGSA 1GGHA 2B8EA 1B76A 3SHTA 5J2UF 4D4KA 2K7FA 3EJWA 2VPTA 4IIBA 4E3ZA 3AEXA 3IOEA 5U1PA 2AEMA 1IPEA 1JQ3A 5H7XA 4Z7QB 2FX5A 4EPVA 2POCA 3CF2A 2Y1KA 5A4IS 1QH8B 1FE8A 2JD1A 1WQ1R 3ZQ6A 3IUQA 3IPLA 4OMUA 1UK7A 2DAPA 3AZQA 5CVUA 5ES3A 4A0RA 1CERA 1YJ8A 3MZ0A 2W0MA 4Q4JB 5FWAA 4ZWNA 2OXIA 1CLUA 4F6RB 5JJ5A 3TTUA 2BVNA 4B74A 4ENWA 1Q14A 4QUGA 2YV1A 1AV6A 2ZVJA 4EYQA 1I3LA 1LWOA 1NX6A 1NOJA 2G9UA 1UJ4A 3EOBI 5FWYA 2J0UB 5BNFA 4CCAA 4BGDA 1XU7A 2JLRA 5EQFA 2XT9A 4YS6A 5HUHA 2WKPA 3IUEA 3DE1X 2OFPA 4EHHA 2F55A 3RC7A 3FY4A 1ZU4A 2UUPA 1FRQA 2HA3A 4EI2A 1ZGAA 2OD9A 4KN9S 4HH1A 4LMRA 1SQ0A 3AZPA 3VO9A 1IHOA 2GILA 2YIMA 1T10A 5KQSA 2OCGA 1DAHA 1QO9A 3TKYA 4DAEA 1SVLA 1TLTA 5JIBA 4FDTA 5L95A 4LE0A 2BELA 1W30A 1H3FA 4TT3A 4DA0A 4UOEA 3C1OA 1I4WA 2CVOA 4KGZA 1Z5WA 5DZSA 2A14A 2FR0A 3BH7A 2O20A 1PSDA 5ENZA 3DEZA 1ZH2A 2VYVA 5F1KA 5M29A 4X95A 2W6ZA 2X7HA 3ENNA 1GTSA 5KX5B 1E3MA 2JH9A 3GNSA 2VTDA 4FE7A 4PYJA 3SLKA 4DSZA 1XD8A 3F2VA 1FDWA 4DW8A 3CA8A 3Q9NA 4PG7A 4KHPB 1JFSA 3TZ6A 5E4YA 1BQ3A 4EFLA 4L9AA 1D0IA 1LJLA 2AWOA 2VP2A 3RVJA 1CHDA 1HV8A 4QXRA 1J00A 3W9SA 4IKPA 1TGVA 3QIAA 5I7UA 3RSZA 3F6PA 3E4DA 3NBFA 1KNQA 2AK2A 3M1IA 4RJLA 1K7EB 3N6RA 3VPGA 5IARA 3VMFA 1XRSB 3NOVA 2I76A 3HVIA 4KXWA 1OZHA 3TJZA 1AG9A 1NMXA 4NZPA 4BX0A 1H1LA 3IESA 1M2JA 4XOIA 3P96A 3CVXA 2NVWA 2ZBEA 5EHNA 1ULAA 3ZCUA 5KIAA 4K1LA 4GE0A 2EFCB 1U3FA 3MUOA 5ETJA 2R85A 1GGVA 1T4GA 3FCAA 3AIMA 3KCQA 1OFTA 2JCSA 1GNSA 2WJVA 3OLQA 4QO8A 4TMFA 3WMGA 2FV8A 1FS5A 3D6AA 2GBLA 2WEKA 1P44A 3JWGA 5FLEX 1XNQB 5KNCA 4IQFA 4WZAA 2QMEA 4GKKB 4RA9B 4BQRA 2C2MA 1Z0SA 2VC2B 4AX4A 5DX0A 1LS6A 2I91A 2F3UA 1F48A 1NJFA 2XCSB 3I58A 3TMAA 5KTTA 5A0FA 4G86A 4AYTA 4URXR 5L6MB 4R9VA 2ZR9A 3JRWA 1I5EA 4IF4A 3IP1A 3CN9A 5BSMA 2KSQA 3UK2A 4AQDA 5LJLA 2GN6A 3MLBA 1ACLA 1UT8A 2QD5A 4GWKA 4G56A 3P2YA 5B6JA 3THYB 1M1YA 4NXMB 2LZ0A 2PZMA 1DTSA 1WWKA 2NUTA 2BKXA 1UBJS 2OPBA 3KQNA 3UYLA 1JEQB 3L84A 5CB6A 1QO0D 3N2LA 1T6XA 4RTQA 1QGAA 2O1XA 8ABPA 1FMCA 1Y7TA 1S7GA 1V1RA 2AJTA 3HXLA 3I09A 1A04A 1AO3A