4HX2A

Crystal structure of streptomyces caespitosus sermetstatin in complex with bacillus licheniformis subtilisin
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
274
structure length
274
Chain Sequence
AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGSYSGIVSGIEWATTNGMDVINMSLGGASGSTAMKQAVDNAYARGVVVVAAAGNSGSSGNTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTNTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords KerA
publication title Mechanism of action of a Janus-faced single-domain protein inhibitor simultaneously targeting two peptidase classes
doi rcsb
source organism Streptomyces caespitosus
total genus 93
structure length 274
sequence length 274
chains with identical sequence C
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2012-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4hx2A00
1SUPA 1AF4A 4K8RB 1KDYA 1SELA 1GA6A 2Z56A 2SICE 3I37X 2P4EA 1OYVA 3F7MA 2PMWB 1DBIA 1S02A 4I0WB 3DE4X 1SBTA 4GI3A 3GT4A 1KE2A 3I2YX 1BFKA 3VHQA 2X8JB 1GTG1 1ST2A 5JMOA 4FONA 1AH2A 1Y34E 1P8JA 2DQKA 3DW3X 3CNQS 4J94A 4AKSA 3VV2A 2DUJA 1EA7A 3AJ9A 2W2NA 1BE8A 4NE7A 1UBNA 1NDUA 2PQ2A 5JXGA 3DDZX 1V6CA 3AJ8A 3LPDA 3DYBA 3DE5X 1TM5E 1YJBA 3DVQX 1YU6A 1AV7A 3WHIA 5JXHA 2SBTA 1SUDA 3EE6A 3GT3A 1YJCA 3DWEX 3H42B 5JXJA 4H6WA 2Z2XA 1SPBS 3TECE 1SCBA 1PEKE 1GNSA 1Y3FE 3UNXA 1HT3A 1TO2E 1BJRE 1WMDA 3GCXA 1SIUA 3A3OA 1CSEE 3DVRX 3A3PA 1SCDA 4RYDA 3LXUX 1TO1E 4NE9A 3D9QX 4OMCA 4OV6B 2XTJA 2W2MA 4H6VA 4HVLA 4AKTA 4CFYA 3F49S 5CW1A 1AVTA 1Y4DE 1CNMA 1TM7E 3F7OA 3DW1X 1T1IA 2G4VA 4KG7A 4NMXB 1C9JA 3DE3X 3TI7A 4KPGA 2ID4A 1SCNE 4DZTA 3DE7X 3DE2X 5K7SA 2W2QA 3PRKE 1PJ8A 1SBHA 1GNVA 2Z30A 1Y33E 1DUIA 1WMEA 1SCJA 1WMFA 3ZXYA 1ST3A 1P7WA 1OYOA 1SBCA 5AQEA 1SUAA 3LPAA 3DE1X 2W2OA 4C3VA 1A2QA 2DP4E 3BPSA 3CO0S 3OSZA 2PRKA 1Q5PA 2WV7A 1IAVA 4DJ5X 1AQNA 5FBZA 1KDZA 1Y3BE 3VV3A 3VYVA 2PKCA 3T41A 5B1DA 1GA1A 1VSBA 1XF1A 1BH6A 4ZOQI 3DVSX 3BX1A 3EDYA 5AVJA 1SBIA 5B1EA 2IXTA 1SUBA 2IY9A 5JXIA 1JEAA 3Q5GA 4WOBA 5ARDA 3EIFA 1SUEA 4KB5A 3PTLA 4CG0A 1T1EA 1SVNA 5FAXA 2ZWOA 3VSBA 1R6VA 3ZXXA 4WOCA 1P7VA 3WIVA 1Y1KE 3TI9A 1V5IA 1S2NA 1TM3E 2PYZA 4Z2AA 2V8BA 1TM1E 5ARCA 4LVOA 2X8JA 5FFNA 2ZWPA 3HJRA 1Y3CE 3L1KA 3P5BA 3DE6X 1PFGA 1ZVKA 1SH7A 1SCAA 2XRMA 4JP8A 4BWGA 2SNIE 1Y48E 5ARBA 4B5LA 4HX2A 1IC6A 2GKOA 1SUCA 2ID8A 2ST1A 1T1GA 2ZRQA 1LW6E 1SN7A 1S01A 1Y9ZA 3Q40A 1R0RE 3WIUA 1TK2A 1GA4A 5AMXA 1BE6A 3WQBA 1MEEA 2Z57A 3SICE 1C3LA 3AFGA 5AVKA 1THMA 3LPCA 3DE0X 2WUWE 1KE1A 3QFHA 3SQOA 1C9NA 1OT5A 1GT91 2B6NA 1BFUA 4DWWA 1TECE 1GCIA 2WUVA 2Z2ZA 1GTL1 2QTWB 4YN3A 1GTJ1 2HPZA 3I30X 5I9SA 4MZDA 1SIOA 2Z2YA 1NLUA 3GCWA 4OMDA 1PTKA 2WWTA 2PWAA 1R64A 3A3NA 3D43A 1Y4AE 1YJAA 1EGQA 1SIBE 2TECE 1WVMA 1ZVJA 1NDQA 2W2PA 4C3UA 1Y3DE 1TM4E 1WSDA 2HD4A 3I34X 1SBNE 1AU9A 1TMGE 5SICE 2PWBA 4H6XA 1KDVA 3QTLA 4CFZA 3BGOS 4M1ZA 1AK9A 4LVNA 3VTAA 1C9MA 4ZARA 1MPTA 2E1PA 3QMPA 2SECE 2Z58A
chains in the Genus database with same CATH superfamily
5KSZA 2NUAB 4DQLA 3VUEA 3GJZA 3PL1A 4K8RB 2ZRDA 3WRXA 4RD1A 1CY6A 4MPTA 2H4HA 1ZW1A 1YH3A 3PNBA 2BRUA 3HA7A 3OEHA 5E7MA 4HNUA 2XYGA 3RGWS 1UDWA 3GEEA 4KN8A 4UPEA 5E7QA 3A0UA 2QTBA 3ZD7A 2JGEA 4RU1A 2GLXA 2YINC 1L3BA 3WA7A 1RHJA 3Q0EA 1R4NB 5DLPA 4Q9JA 5DTJA 5CK4A 5HWSA 1GSOA 1QKIA 2QN1A 1E6EA 1WXHA 5BP7A 3EF0A 4YH1A 4CN9A 2ATIA 5IJ0B 3L7AA 3QWHA 4YAJA 1BMFA 2IIQA 3FE2A 3LQKA 4OAQA 3VHQA 2HQOA 5TGDA 3SF8B 5LMCA 1DI0A 4D9JA 5LSAA 3I2FA 2X13A 3L8MA 1G21A 2E4AA 2A1UA 4RY0A 5CFMA 5JWHA 2H4XA 2P3SA 1EFTA 1U2TA 3NKLA 1GZDA 3HL4A 4DIOA 2FQ1A 2PGXA 3RT9A 2QR3A 4QTXA 5HZHA 1NBMD 3V1NA 1VYTA 2QE7D 1FUEA 4YC7A 4AU1A 2ISSD 2KW5A 1L8OA 1IVNA 4IIJA 3CW9A 3RVRA 3CZPA 5SYAA 1KGDA 1BD3A 2QTRA 4FCVA 4ROSA 3KJNA 4EGQA 1GXSB 3EODA 1AHNA 3HY4A 4Z4CA 3LRTA 1NR7A 1D4AA 1D03A 2R7NA 1KORA 2IX9A 1Z0KA 1J21A 4HB4A 2WFMA 1NLFA 4WFJA 2OORC 2JLCA 3TWOA 2AK3A 2X9VA 5B7NA 1TW2A 2G06A 1RQXA 1SOUA 4KSCA 1DQNA 2R6R1 1IOWA 3RBZA 1QOQB 4ZCIA 2R7KA 4UBKA 3D6MA 4C0AC 1Q0TA 3MJ4A 1SXJA 1DQSA 2FLVA 4DJEC 3QY0A 2GCPA 1VPVA 4MWTA 2RGNA 3E9DA 5I7UA 1NP3A 3K2EA 2H7CA 3BL8A 3P0FA 3O8QB 4IZIA 4DCUA 4MDEA 4RDHA 2YJNA 3LSYA 2VDOB 2QRNA 3BFXA 4OGKA 1S2IA 1LQUA 2VG8A 4BO7A 5KYXA 4RPIA 4O59O 1SUDA 4TXHA 2Z4TA 1KY4A 4P5PA 3U37A 1PS0A 2PZEA 1YK1A 1APBA 2BTQB 2P75A 4GDFA 3TKLA 2AJBA 4D3FA 3VR6D 1LSSA 2ZBDA 3WRXC 2RHOA 4D02A 4TT3A 1W5SA 1UJCA 2OCAA 3HFGA 4AIIA 3U9SA 3U1VA 2AN3A 2BRUC 1IBRA 1W5EA 2ZIAA 2OQIA 5AI4A 3CZ4A 2ID9A 1Z4KA 5AHRA 3WGLA 5JBIA 3FDIA 1JEYB 2NZWA 4AUMA 1XTQA 1RRKA 1WUIS 4CU5A 1P17A 4G1BA 1H4VB 3AFOA 1FFWA 1NQXA 2PS0A 3T7TA 1NVVQ 2HWUA 1U28A 1YVRA 2QMYA 1TCVA 2VWGA 1WMDA 1I36A 4H3HB 2C97A 3T5DA 3ZDFA 2FMIA 2GRJA 3L0DA 3PFIA 4Q5IA 4BLPA 621PA 5ADWA 5KDDA 1RYMA 3NWPA 1ND6A 2IYNA 3A3OA 3OH8A 2ZIWB 4IMIB 2JGKA 2PUVA 1SCDA 1TEVA 4KUEA 4B3MB 2YWJA 3O0DA 4RE6A 4JLVA 2ZUTA 3ZCVA 1I3LA 1NQUA 3PYMA 4LIPD 3WWPA 1JAXA 2BJHA 3E22A 1P1FA 4YONB 3PHCA 3SMVA 1CQJB 2I3ZA 2WSYB 3E4DA 3P9KA 3QVMA 1XO1A 1T0UA 4URFA 5JQGB 5JISA 1K2VN 3FUCA 2J9ZB 2XB6A 3KOWA 5EE3A 1CDEA 4EHLA 3RTGA 1E98A 2R25B 3MUOA 4UUQA 4MR7A 4IUDS 3RSFA 4Q4AA 2JH8A 1AVTA 2P65A 4EBFA 2XECA 1J7JA 1LFDB 2MINA 3A1DA 5DLYA 2XMDA 3K4HA 1GG2A 4DJDC 4JBYA 5D1NA 4BQEA 4JA0A 2C7OA 4N76A 9MHTA 1DC5A 3BGSA 3HCPA 3OTIA 1G5IA 1RLTA 3IT1A 3DW1X 3N0RA 1RBMA 3A4VA 3SE0A 4CLEA 2I87A 4FNMA 4KG7A 1B3RA 2AQIA 4XM0A 3C3YA 1FE8A 1GZ6A 4HTFB 4RO0A 5I7OA 3MJEA 16PKA 1OBCA 2ACWA 2VH2A 2Z3WA 2GN8A 3DE3X 1FMLA 4E6PA 3UJBA 4AP9A 2NTEA 1Q1GA 4H08A 1AKRA 1BHSA 3MB8A 1ZCFA 2YJTD 4N5IX 5BW5A 2JLVA 1SXJC 3VQTA 3ZZNA 2GM4A 3HABA 1F9EA 1J7KA 1B6TA 5FV7A 3UKDA 1VFPA 2RGNC 3C48A 4TL8A 3QBVA 4WKNA 3ZE6A 2WE8A 2ZI7A 4IINA 4YLEA 1JG7A 4ZCQA 2FH5B 1P1RA 1P1HA 4J90A 2AJ8A 3DZDA 5I9LA 1DWOA 4Q3BA 3ITNA 4B3FX 3JQRA 4ZCTA 3QEAZ 3BRWA 4BNDA 4WESA 2Q6LA 4ZVNA 4ZJZA 2B1QA 1U99A 4G97A 3UAYA 3MUNA 4GMKA 2C8KA 1F17A 1CRZA 4Q4LA 4YHHB 1Y33E 2IRWA 2XNKA 3DM5A 3ENWA 4HNSA 4JP3A 5DHTA 5ENVA 4DLAA 3KTOA 2DBVO 3MGKA 2DPMA 2EFEB 1W5BA 2IYSA 2UZ1A 3GUHA 4DV2B 3BWCA 4PLZA 1S8AA 4Q6WA 3CVVA 4X64B 1CJTC 1L0BA 1T5BA 2PD4A 1MA3A 3AUSA 1K7SN 1CZHA 1YIDA 3KEOA 2CLSA 3K9FC 4RENA 1VIVA 1ISGA 4HN4B 2WHQA 4PBRA 1IXZA 1W25A 2BD0A 3T3GA 1J2YA 3OA0A 5HJEA 4M86A 2W4IA 1JSLA 2WIAA 1U28C 3DE1X 2C2KA 2O8NA 4AXXA 5JY6A 2ZTMA 4CKEB 5C7IO 1AMOA 3SEFA 3BMNB 1AV6A 2G5PA 1PYDA 2H6EA 3MRVA 1M83A 1PGPA 3TZQA 3EF3A 3RSHA 3C8MA 3OUZA 1UK6A 3GLHE 1TQ8A 2PS1A 3WGYA 1MFPA 1O5IA 5BQPA 3GFQA 1AUQA 2JFPA 4KLAA 3UAXA 4P33A 4Q9AA 4DBLC 3VR3D 1KFKB 2RGGA 3F9RA 3GEGA 3L04A 3O9ZA 3QIAA 2O0LA 2OV6A 4CMEA 3BBPA 1OFTA 2WIJA 3ELUA 1OF1A 4ZJYA 3B5IA 2AEEA 4RFSB 3STXA 2GAIA 2EOAA 4GYKA 4PRLA 4TSFD 3GY0A 3K0AA 3MQFA 3UMSA 1RXYA 2QM0A 3D02A 1PW5A 3PPVA 3DPIA 3PU6A 4HWPA 4I2VA 4YDSA 3ZX4A 3MJFA 1RVV1 1GA1A 2CYAA 1XNJA 1QVWA 1IJFA 2GETA 3WK6A 4ARSA 3B36A 4DLXA 4L76A 4HZUB 3D2LA 1XF1A 2EZTA 1UOPA 2QD1A 1JU4A 2JFXA 1SOAA 3COVA 1TMOA 5COAA 2IJGX 1G3QA 4JU9A 4OHMA 5FL7D 5G40A 1KSFX 3SR3A 2CJWA 3D1JA 3Q41A 4IX1A 5DM2A 3VNSA 1IUKA 1QCCA 5G02A 4D9KA 5DM60 2E4VA 2QTCA 121PA 2QQ5A 4OLHA 1PJ2A 4TMYA 2XT6A 1O08A 3R75A 3SQMA 3VTKA 2XLBA 1NASA 4ARAA 4YB8A 1X80A 2CFRA 4M6WB 1JKXA 1A5AB 3BRQA 1G9TA 3LUKA 4Q1VA 4WEQA 5HZGA 4P4SA 3H5NA 2QMOA 2W22A 2R2AA 1CUVA 1DIBA 3EEIA 3EVDA 1DLJA 1XVIA 4C3ZA 5JIBA 3UMGA 1ODKA 2AMFA 3MJHA 1QIJA 3IPLA 4TVBA 5G3YA 4N7BA 3UAZA 4AJJA 5ILGA 2QTGA 1IXYA 4XQ9A 2Q3BA 4Q01A 3SM3A 2R9VA 1AKWA 2ZYTX 4CCYA 1E1RA 2APJA 3QE2A 4KFSA 2EG9A 2XA1A 4WLUA 3ZU5A 2VA8A 4HS9A 2LDBA 3AVWA 3IULA 3A1NA 4KRGA 1GAEO 2BFFA 3FNEA 2R65A 2FSVA 3CNLA 2A4KA 2CNNA 2I34A 2YWDA 2D1FA 1X7XA 4JHXA 5IVDA 4QEDA 1YAJA 4DGSA 2IZOA 1P2SA 4U7JA 1L7AA 1Q12A 2F62A 1NJ2A 1TM3E 2YWCA 4FNGA 4OMFG 4AK9A 4BEWA 5HW0A 5K5EA 1TTPB 2PYZA 3FGNA 4A2QA 4AUNA 1VPEA 5KOJB 1BROA 1PQWA 4JLDA 2PSDA 1IFXA 1U2DA 3GO4A 4DPMA 2ZR9A 1KJNA 4YJKA 2AEJA 3MFYA 5A3RA 3ZJTA 3Q7QA 4BO5A 1ESEA 1GL3A 4L8LA 1LS1A 2P6NA 2VF2A 3CUSA 3TS1A 4QJ4A 2O3TA 1YL5A 2D0DA 1FTNA 1E63A 3AUYA 1JZSA 2QVLA 1MOSA 2OVFA 3LZCA 3SF0A 3V4ZA 3ZHZA 3KAPA 4BX0A 1ZNQO 3R6TA 2Q0HA 3P5BA 3PGKA 5LA6F 1EFUA 2D2EA 2EU8A 3KR9A 4Q1CA 2QRVA 3ZLVA 2P9CA 5CB4A 3RT1A 2ZSFA 2E0IA 5K8CA 2XCRB 2BFEA 3TCNA 2REQA 2OSVA 2ZT7A 1VSUA 3UMVA 4CMEC 1UBFA 4EF4A 1XL1A 4DARA 4F2GA 4MYTA 1M1ZA 1PR5A 1QFZA 1Z06A 3RFUA 3EPJA 3FZEA 4DCCA 1GSIA 3JVUA 1LVGA 4GOLD 1RZ3A 4LDJA 4UEJA 4YUAA 4C2BA 1PHRA 1HT0A 2J07A 4JI6B 3ZKWA 5ARBA 3A6PC 1H2FA 1YAHA 2YW2A 3NNSA 3P2IA 4OIFA 1UIRA 4TVOA 4XB6B 3WR5A 1Q84A 2LNDA 1PKEA 2JGNA 4FC6A 5EIFA 3NYQA 2R6DA 4FR0A 4YAGA 1U5BB 1NVDA 2ACVA 3OLXA 4Y6LA 2AMJA 3ZDRA 1NYLA 3EFHA 5BNZA 1VG9B 4KOAA 1K6MA 1Y9AA 3L1VA 5A6SA 5C5EA 2P0AA 3GFTA 4ECEA 1ZLXA 3NDIA 5TT1A 1SCUB 2M1XA 2ZRMA 2NADA 1AD2A 2DH6A 3QJ5A 3SI7A 4DLKA 4D0NA 3PNSA 3WRWA 2X4LA 3P2OA 4R2HA 4RLHA 3E35A 4KQGA 5ALPA 5KYUB 3KTDA 2I2BA 4LCJA 2WW8A 4RD6A 2A0XA 4FILA 1QS0B 2WOJA 3EVZA 4B2LA 2QM8A 2V03A 3DLBA 4C6TB 4AMVA 3EY4A 4CCSA 1KMHA 2A0WA 4KO2S 3NTVA 3NHAA 1RAGA 3R7LA 5IJ9B 1R0YA 2HDWA 1ZOLA 1OB5A 2E2WA 2W2LA 3QPBA 4I46A 5DGHA 1JDTA 3OM1A 1NC3A 2P2LA 3KJXA 3U4QA 5ALFA 1THMA 1RZRD 1ECFA 3EZ7A 2H0AA 3QE4A 3THOA 1Z08A 2FSVC 3WYNA 2XE6A 3GHHA 3EG5A 5A0VA 4LOHA 4V1CB 3E23A 1E6LA 1RRPA 5LOVA 1F4PA 1K66A 1UANA 2O4UX 2WT9A 3NTRA 2YJ5A 4JL5A 1HR0B 3SY8A 2HMYB 1D2AA 1Q0HA 3P0RA 1UBJS 1KVUA 5BRAA 2C2MA 3B13B 2FWBA 1TECE 2FNAA 4ZQCB 2X9NA 4WFIA 4UBNA 1U2DC 2FG6C 1VZ2A 1JAIA 1JHXA 3RJMA 5JH7F 1YBVA 2ZANA 3MWKA 2A9QA 4HAWA 1M5UA 2J5RA 4RVDA 1GTJ1 3TNJA 3HHEA 5F4BA 2VP9A 3L8CA 1SIOA 4H7FA 5CA0F 4QBFA 4AYXA 4MVJE 2VTBB 1NLUA 2DBZA 5DMHA 5AJXA 3DBIA 4I9UA 1IEQA 2AVDA 4IOLA 1I2BA 1D9ZA 3BS4A 4A8HA 3BQMB 3OO1A 1KYTA 3WG9A 3PPYA 1HYBA 4US1R 2BFBA 4N1AA 1V71A 3KTAB 4GXNA 1SIBE 4M9SA 2YWGA 3KT0A 3VMMA 2EQBA 2P9EA 1XXLA 1NBME 1FP7A 1UBKS 1Y1SA 2CMKA 2GOYA 3ZZ1A 1M5TA 2CXRA 4PHHA 4TYNA 3LCCA 3ZU3A 4WZBB 3NVDA 4L5IA 2IV7A 4TVKA 3FA2A 3B60A 3G2NA 3ADCA 3PFNA 4FU0A 5BVGA 1IM5A 4IKEA 2FFBA 2IUUA 1RFLA 5I4BA 2RCYA 4MUBA 3U3XA 2A0YA 2O3SA 4MVJH 4WFQA 2C77A 4EHKA 2D1TA 5ESWA 2GHIA 4Y6RA 1JDSA 3M33A 1TLTA 4TKUB 2JPDA 2ODEA 3M5DA 2CL6X 2FUKA 3RAPR 3WKDA 5CA1B 1VL1A 1UC5B 3ZQ6A 1VMAA 1WB5A 2WYIA 3JD2A 2YBDA 4BNFA 2MOKA 1C9MA 3L7LA 2YMMA 4F6LA 1T0IA 3SQWA 3CFYA 1VL6A 3H6KA 1OLUB 4WDQA 4EY5A 4FHFA 3HYTA 1OW3B 4G0XA 2X19A 1N6LA 3GK3A 3IAHA 4ZZ0A 3QSGA 2CHEA 3O8OB 4JDUA 3TMAA 4NMMA 4HEQA 2XQVA 3HQ4O 3VSCA 2NO0A 4MNTA 1O77A 4Q9HA 2P9YA 1E6WA 1WW8A 2AC4A 1Z6QA 4I5IA 4I6EA 2WJJA 3GRPA 4QQ8A 5SY9A 5TPZD 3U7QB 3D5EA 5CGZA 4MW6A 4RSHA 2FG7C 1EK5A 1OYVA 2O5VA 4WNCA 4PYNA 5DYWA 3ZWBA 5JWOA 1OVGA 5LM3A 4FN4A 5GADl 1Z4MA 2EFCB 2GK3A 2XBLA 4BMCA 5LYYA 5HYVA 4KPYA 3EFOB 4AC9A 1OC2A 2JH9A 3R7WB 5IKPA 3F9IA 1L4FA 2WRZA 4PRZA 2W9XA 5EXEA 4EVIA 8GPBA 1C3OA 1X9GA 4UXJA 3EXEA 1TJNA 2I2WA 3BMOA 3U4CA 2HU8A 3D8TA 3DOEA 3HDVA 1NY6A 3ISVA 4GI5A 4RESA 5CBPB 4B8YA 2ZZKA 10MHA 3IP6A 4Z54A 5FR2A 1W35A 2QMUA 4S24A 5KMGB 1ELOA 3PXCX 4IG4A 1W6RA 1X86B 1DBQA 3T5AA 3C1AA 3KYIB 1F14A 2JKVA 4XRRA 2IHJA 2BZ0A 2H18A 3V1YA 1AH2A 1J90A 3GGDA 2O8FB 3IURA 2HF8A 3ANXA 3V6LA 3EMBA 4GPIB 3VR6H 5HKKA 1GOTA 3L0IB 4GE0A 2I62A 1GYPA 2DPHA 3IAM6 1HG1A 1X7GA 3KFXA 3P94A 3SGLA 1AC5A 1BIFA 1LDMA 2NVUA 1B2LA 2P5TB 4DCNA 4BNZA 1JPVA 3UH0A 2QLFA 4EG7A 1L5KA 1AHIA 3OFND 5FPTA 4URVR 1XD2A 1G42A 3ZVRA 2R6FA 2E1RA 4DQXA 5FWXA 3JQ8B 2PUCA 1G8AA 5LFAA 4PYIA 4PLCA 1NKSA 5ITZB 1LX6A 5LMNB 4L72A 4R2JA 2VHUA 3SDZA 2WSSA 2BFWA 4EQ6B 4I55F 3URMA 3WNBA 3VMFA 2Q9CA 4ARZB 3E61A 3MS7A 3NFYA 4FOLA 2C4TA 2QQEA 1KY3A 1DEHA 2IYAA 4U2EA 3NC1C 2IWRA 1BWQA 3LBFA 4EFNA 2OFXA 2YHBA 1LPBB 3AJ8A 2PDAA 4QECA 3IUNA 4RAQA 3RBVA 3EVCA 4BNWA 3JQGA 5JAPA 4BLQA 1CUUA 2BIFA 2QNIA 2VQDA 4RA9B 2M6LA 4A2WA 3DVQX 4NKRA 4F4HA 5CG1A 4HSGA 1BDHA 2ET6A 4FDAA 1YB7A 3IHWA 4R68A 2FFQA 4TM7A 2NO6A 3AF3A 3I2GA 5JXHA 3TQHA 3T7RA 4E6EA 1VIDA 3O75A 4MQFA 4HQFA 4W5NA 4PS1A 3V7WA 2X86A 4HD8A 4RVOA 4I19A 3SS7X 1XX6A 2OSBA 3EE6A 1SBQA 1UR5A 3D6UA 4PWYA 2C1XA 2YWFA 1NJ1A 4DNOA 1E62A 3RSLA 1DFHA 1AA9A 3SC6A 2VHYA 4QRHA 5KI6A 3GEBA 1QIFA 1LC0A 5B4UA 4MQUA 3VX3A 2XAUA 3VHXB 5I7FA 2HM7A 2ZRPA 1O87A 3TGWA 2P68A 2VDMB 5DN6D 2NUPB 5AW0A 2ZKIA 3ITEA 1D0IA 1ZONA 3ML1A 2Y2VA 1TYCA 5LWHA 1UMKA 2AE1A 3DDOA 4LI3X 4XWTA 4FCWA 3AFIA 5FUXA 2HR1A 4IL5A 3PV0A 5CXUA 1WMSA 3AK4A 4DNXA 4R4JA 2IUSA 1ZH8A 2OHFA 3IBYA 2OA0A 3ZE7A 4Z8YA 4TTJA 4N18A 1JKJB 1W46A 3K7EA 4LRTB 4ZFNA 3DO8A 1EB9A 1QYIA 1VQ1A 1TZMA 4HXEB 4AM8A 4XSGA 4MMZB 2NZ8A 5JLAA 1KTVA 2PWPA 2I4NA 2YRXA 3BMQA 2FWMX 2QLTA 3EQZA 3G0IA 3ZK9A 1AQYA 4GQAA 1JA9A 3V3KA 4NONA 2YCLA 4LBZA 1MJFA 1GAJA 3MQ2A 5DOZA 2XTJA 4OP3A 3M49A 3QLTA 4LGVA 4XFDA 2IUFA 3AI2A 1QZUA 1Z6PA 4LYJA 4QLBA 4EKYA 5DNCA 3HI4A 1GG8A 4CKCA 5L8VA 2FFRA 2G9QA 4YCCA 4QD3A 3G7UA 1MQAA 4YDQA 3L07A 3U80A 1TKBA 1PU2A 1A50B 4IDCA 5COBA 1UEIA 1XLTA 3N8GA 1FXWA 3PJRA 2AKEA 1SXGA 1HL7A 4JJGA 4UTNA 4YMVA 1G17A 2QR2A 5KQPA 3R3VA 3ENZA 2WB4A 1EVIA 2VSFA 1EUCA 4KYUA 3QKWA 4WIAA 5EKDA 4ZEOA 2IXBA 2VT3A 1EM6A 4MO9A 4YX9A 3KUUA 1P4AA 1WCXA 1SHJA 2ZBVA 3KPWA 4XPZA 1DX6A 5EUMA 1UAYA 4PZCA 4TV8F 2O8DA 1PJ4A 3EXG2 4HP8A 4MJ7A 3BHIA 4II7A 1QGUB 2XX3A 1MCZA 4BMDA 3L8EA 4GKAA 2Y92A 4BDTA 2C5EA 3D3QA 1GFIA 3SG0A 2JW5A 3U2QA 3PK0A 1N5JA 3Q6MA 3U4DA 1E4VA 3NIGB 4PZEA 4QWWA 4ZMRA 5KWEA 4JJKA 3NBFA 1Y89A 4LXHA 3E9QA 5AKGA 4OGGA 1X13A 3KDSE 4QAJA 1Q3HA 1GITA 4E11A 3QMVA 2Q8NA 3I0ZA 3QEJA 4WERA 5EEGA 5ALDA 3VOSA 4BNHA 2CXNA 4P3PA 1FDRA 2ZSDA 3PRKE 1Z62A 3OF5A 2YIMA 4GGMX 3P0IA 5E6RB 5KOIA 2EARA 4B48A 1UXOA 3OJFA 1D2HA 1U65A 2E48A 4XRGA 3JYQA 2ZTLA 2NSDA 1FP4B 5KQMA 2ESRA 4KREA 4YACA 2FFJA 1IY1A 3VFDA 3AHGA 2NNLD 4UUBA 4UTOA 1FUUA 3NFRA 3OU6A 3HJTA 4W8HA 3CVUA 1YE5A 4LE1A 1ZH2A 3EIQA 2FWNA 1BVYF 1SCJA 3M70A 5DKFA 3IQIX 4HCJA 2D4HA 2DQYA 2HSJA 2NO9A 3PXUA 5FAKA 3GNQA 4B6OA 8LDHA 4RGQA 1I6KA 1XE3A 4B33A 2IF2A 2GVDC 3TH5A 6GPBA 4MVJP 5D85A 2GXAA 3IFSA 4IIXA 1XKLA 3Q10A 3GUYA 5LMUB 1K89A 3WBBA 4CZ2A 4LOIA 1G55A 1E3WA 1ZK0A 2DOKA 3CS3A 3MYYA 3OOYA 5LMZA 1BVHA 5BV0A 4MRPA 1AM4D 4PAGA 2C78A 3UHPA 1XPJA 3KBBA 3BUSA 3NAQA 3OE7A 4MR8B 2J67A 4RHCA 2YWRA 1NGSA 3IVGA 1OUMA 3D3WB 2OOSA 4J0IA 1BA3A 3DV0A 1N2CE 4IDNA 1YRAA 1R8XA 3PDUA 1B0UA 2NNWB 1S3SA 4FBGA 1O6CA 3MOGA 3DF7A 3NM6B 5IVIA 1N7HA 1Q5PA 4A6EA 3NO4A 4EJ0A 1E8DA 1Y3IA 3QLVC 1IAVA 4FZ5A 3ZCUA 2D5AA 1FXUA 1TZKA 2Q1SA 3THYA 1GGNA 2VPZA 1I7PA 1XUOA 2QTVB 2FMUA 1N2HA 1MXFA 4PBTA 3TXAA 4JQSA 3VH1A 4BU0A 1ITZA 3NAMA 4NNJA 3SSAA 1SQ0A 4CV0A 2VF4X 2R5WA 5B1DA 4M9QA 4KUHA 4CEJA 1VM6A 5K6TA 2I55A 1SG6A 2CFOA 4UDYX 2Q28A 1XLTC 4YT5A 4Z7QB 1XRNA 4WKCA 5DO9A 5GIOE 5AKZA 5K0NA 1J8YF 1R9GA 4XX0B 2FPIA 2VNJA 4L8WB 1PD1A 2ATVA 3KLPX 4RLQA 5CLIA 3SS8A 4BQNA 1GFZA 3QFFA 4AT1A 4ZMSA 3HVUA 4CIWA 3TOSA 4AMZA 1Z0DA 2NPFA 3IAEA 3EDYA 4M8SA 4MV3A 2FB9A 2VCYA 4C9BA 1TMYA 3AFHA 3B5EA 1E2JA 4OHOA 3DTVB 3EA5A 5CCBA 3DOOA 1OFIA 3VPCA 2GFHA 5F5NA 1U3WA 1NXOA 2JIRA 2OYRA 4LYEA 2FX3A 5C51B 1W4RA 5ALQA 1C30A 3FN4A 1J23A 4E5SA 5IDYA 2I3GA 2UYOA 2JIMA 1C7FA 4IDOA 4P0QB 1HDIA 2V3WA 3OF2A 1U0TA 4KB5A 3AB3A 4WRRA 3BCHA 1ZMTA 4J43A 5CT8A 1FDIA 1D2EA 1ZY2A 3GLHA 1VP9A 3L0BA 4G81A 1DOAA 3K5HA 1Z0ZA 1QNLA 3PNLA 1LH0A 4JGBA 1SB9A 4F6CA 1WULS 3AY0A 2CB9A 4XGIA 3OQIB 1P7VA 1ZJ5A 1W88B 4ZHQF 2EJTA 2REBA 1I7DA 2UU9B 2GHRA 4AB1A 1IK4A 2O1XA 3WAJA 1ZR2A 1JHUA 1RIIA 3W9SA 5GOZA 1DWQA 3LQRA 4TLAA 4WLFA 3LX6A 3X1MA 4EYQA 4QOFA 4XCVA 2E89A 3RFXA 3L8YA 1AB6A 1QYRA 2P79A 1W2GA 4ZDIA 5CVCA 1CDDA 1L6IA 4JD5A 1M6NA 4RY8A 2M6SA 2GN2A 3JQFC 3R4VA 5AKXA 4B75A 1IZ9A 3T7DA 4ILKA 4JJ4A 5FBVB 2CLDX 4FYMA 2VJAA 5KNBH 4OYLA 3FPKA 2J0SA 2ZRFA 4IS3A 4IIGA 2QRJA 4MV0A 4B2YA 4FB5A 1PZGA 4AS1A 5IG2A 4L4ZA 4Y98A 2VEDA 3WADA 1YRHA 2G08A 3MM4A 4LV8B 4C7VA 3GN1A 1XDSA 1BHO1 4YV2A 4RVCA 1UJ2A 4B6PA 2VRWA 3F67A 3L40A 5KYTA 4GWGA 1VI2A 1K5DA 1NNLA 1PNVA 2A35A 2FHSA 1T9KA 1U4NA 2O3JA 1B1AA 2C2WA 1XCJA 2VHTA 2ZI3A 3L7NA 3R3WA 4M38A 3AEYA 1YBAA 5C46F 3THWA 4YP7A 3EZLA 1Z8FA 2AC7A 3TLMA 2CXHA 2W2VA 3DDHA 2MSNA 3H5VA 3JX9A 4TL7A 4ZAFA 1CG6A 1UBCA 3OQPA 1DCKA 4GLLA 1UP6A 1P3Y1 2RG1A 3BH7A 4KWCA 2AIRA 3HKEB 1BN7A 4X1IB 2G71A 4HAUA 1H42A 1KBZA 1LSOA 2DX7A 3D4PA 2OQ2A 4KO8A 4L22A 4XB2A 4YA6A 3U26A 1CRPA 2W2KB 1JYFA 2CW5A 3H6GA 4WOKA 4EG0A 3VO9A 1FLVA 1S9DA 1A71A 4OB6A 2UYCA 3FCYA 3R9XB 2Q2OA 1YHNA 1XRLA 3HR4A 4CDNA 1RZVA 4UULA 4G8CA 4DVJA 1UJMA 2NTJA 1E7RA 5EG5A 4FOTA 2VH5R 1WKBA 3VPGA 3M6UA 5C31A 3NHSA 4PPQA 2XKKA 5DJ5A 4LK2A 1U7HA 4W63A 4OBBA 3Q40A 3D3EA 3HCCA 4B43A 1WE2A 4BZXA 1J4AA 3R3XA 3C3CA 4C06A 4DANA 1XQXA 3I73A 3DKPA 4HDKA 3ZTTA 3ADDA 2QRKA 2BI4A 3GXOA 1E96A 1BE6A 2CVZA 2R8RA 3LUAA 1NYRA 3V8PA 4G0VA 3RIHA 4J4TA 3TCXB 4KYVA 3UN1A 2B69A 2H2AA 5I7EA 4Z4FA 3E9YA 3R0JA 2J09A 2I76A 1OFGA 3NB0A 1WMBA 5JAZA 5L4LA 2HA7A 3FR7A 1WNTA 3PUYA 3UA3A 3LPCA 5ICFA 5CTAA 1CUEA 1D6SA 1Y5RA 3B48A 4I1OA 1PIWA 3K4PA 5EI5A 4OI0A 3UGKA 5I7RA 4HN9A 3WS7A 2VRNA 3OZFA 3AM1A 2LTAA 2ONCA 3FHCB 5HRAA 3INYA 3CA8A 4IJKA 4Z0TA 5DM70 3ZQKA 4TYYA 4JBIA 2Q3FA 1CVIA 1QPGA 2W2XA 2QLLA 3HSYA 4FINA 3STTA 1KK3A 3PFCA 4DWWA 4EJSB 3EXFA 3CRVA 2QJOA 3H1TA 3LFTA 4IQ0A 2PX6A 3FG9A 2IDJA 3FNIA 4JZYA 1K27A 3S29A 1ZITA 2GB4A 4ZTBA 2PGNA 1Q1QA 3AEKA 4KV7A 4CF6A 5A4DA 4GSKA 1DUSA 3RIXA 2DLDA 4UUOA 3BTUA 4JLSA 1Z2PX 3U40A 2UUAB 5AVYA 4EG3A 4F9TA 3STWA 1N2BA 4UVHA 4EIWA 2FDRA 3DD1A 4MWCA 3I76A 1IN1A 3PYXA 4RHXA 4GICA 3C5EA 4ISBA 4Z4IA 3BXEA 4CUKA 4K8OA 2GPYA 1KZ6A 1CZOA 3N2KB 3IR7A 2YVLA 3OTHA 4NH4A 4PONA 4PZYA 4ZAXA 5FV4A 5TV2A 2CNOA 3VAYA 4B3JA 1JDUA 3WK9A 5I7SA 1KEEB 1UBMS 2A0FA 4K9NA 4JYCA 4EKGA 1UJ5A 3ZUGA 1LB1B 2WABA 1W4AA 4WN9A 4B35A 5K01A 4FMCF 4MLZA 3R5HA 3V4LA 2IXGA 1BKDR 1KJQA 1V41E 2Q7XA 2O8BA 3WMWA 4GOJA 5F5XA 3PX3A 1SMKA 4FUTA 4N5LA 1QBGA 3AUUA 5B1SA 3DCYA 2PWBA 4BO1A 4HVTA 2D5CA 3BDVA 4F86A 2JKYA 1II0A 4E5UA 5AM5A 1EWKA 5HQJA 4Y2UA 3WLLA 3K15A 4DEVA 3FNRA 1LD3A 4JC0A 1V6AA 3ZZTA 4HXYA 2BP7B 3KYBA 2GQ0A 4DGQA 2W8BB 5EHZA 4IFBA 1K0UA 4QGBA 2H1LA 1GAXA 1WUHS 1X1EA 2GCGA 3GG9A 1PAUA 4LVNA 4ER6A 4F84A 5HRCA 5FRDA 1U2ZA 1YA8A 3IAM1 5FWYB 2IPAB 3AESA 1NI5A 3P9IA 1FDVA 3JS5A 1TQ6A 3QJGA 4M46A 5EXDA 2IUTA 5F9MA 4EG1A 4QTYA 3QXXA 3LK6A 3PL5A 1UPUA 2P7HA 4ZVOA 3DDCA 1W36B 3A58B 2NIPA 4DBVO 5EHXA 3NBMA 3BD9A 4TQGA 4J8PA 2QZPA 4H59A 1YA4A 4MVJA 2Z56A 2OR3A 2XSZA 4XJSA 3V8MA 3K1TA 1WL8A 2HCRA 1RYBA 4HAYA 3VDQA 2NN3C 3ZDDA 4WN3A 3CLHA 4DSZA 3WIDA 4E33A 2PWZA 3RKRA 4UD6A 4DV7B 1TCUA 3M4JA 1YNOA 3MOSA 5GZ6A 1BW9B 2Y1EA 3GF4A 5CFOA 1IZZA 1SUSA 3EVBA 5JZVA 1KO4A 1NBMA 4I3GA 3OZEA 1YB2A 5B6IA 1QF6A 1E9AA 2ONZA 3G0CA 4XPIA 3U7RA 3ZDQA 3BWDD 2ODNA 5DNAA 2BTOA 3JATB 1KMNA 4Q48A 5IASA 3AR5A 1YZFA 1Q6ZA 2YOHA 3H0CA 1GTG1 1VLMA 3HU5A 4I08A 1UQTA 2MT9A 2FKAA 3KZ1E 1DNPA 3T7CA 3DZHA 4ZDKA 2QPAA 5JMOA 4RZSA 1G7TA 4LKOA 5J43A 3BHNA 3E5HA 4J3JA 3NKVA 2H1FA 1J06A 1Y34E 1YR9A 3KU1A 3COSA 1CR2A 1I6LA 2ZRGA 1I4WA 2XCOA 3AIOA 3GJ5A 3H84A 2HJ9A 2ZG6A 2FCRA 3HZRA 4XI9A 1F8GA 1MA0A 2C3YA 4DMHA 5AW3A 4O2BF 1UFOA 4OXYA 4QXAA 5D7BA 1C7ZA 3S28A 3V42A 1SHUX 1OHHD 4GX0A 3MD9A 3QTTA 4YJHA 5AW6A 4IDAA 4E4RA 1CTQA 1Q7EA 1V8OA 2YWXA 5H80A 4DR5B 1BE8A 3N0WA 4COKA 4R1UA 2BGUA 2JGFA 1TA9A 1BZYA 1UC9A 2Y0CA 4KN9S 4X24A 4Z86A 3NHYA 4M0DA 1JKIA 4WXEA 4MKZA 4B44A 4OF4A 1T5SA 2FSSA 3RTCA 4R40A 4F1JA 4X54A 2N1BA 3SIPA 2HV9A 1MZPA 2NZJA 1CQZA 1J9GA 4E2ZA 3AR3A 1YOVA 3G5TA 4DLVA 1TKAA 1YS6A 3COWA 1FQWA 6YASA 1UQUA 3AHEA 3DDZX 4QLAA 1VHWA 3USCS 3O8CA 1WLYA 2O7NA 3B53X 5CRIA 1ZXXA 3VR6A 2LGJA 1JSCA 4R16A 4X85A 4DRXA 1T13A 4PO3X 1C9EA 3QXSA 2X6RA 4LJ8A 2AF3C 3IEIA 4PNEA 2H1IA 2WUFA 3IT0A 5TF4A 1KSGA 4MX8A 1ZM2A 3MA0A 1ZGHA 1NVBA 2AG5A 4H7JA 1ODCA 1J8FA 4ZT6A 4DYHA 4B6EA 4JX8A 4MQ4A 1EG7A 1JF8A 5I9BA 3TLKA 2F90A 2RGDA 2AEFA 2HHCA 4O2AB 2VP5A 5JJ5A 3V48A 1Y7IA 3KOOA 2G04A 2G4LA 3HUDA 1NSTA 3R7DA 5B58C 5C8ZA 3KB1A 5C5CA 3KR1A 5JYEA 4V24A 3VI3B 4KR2A 3QVLA 3UT5B 4BVJA 3CZCA 1H2XA 3G13A 1MB4A 1KKUA 2WT4A 3WISA 1K7XB 3ND7A 1XVTA 3OU2A 3RK0A 4C4SA 5JXJA 4BE7B 5BSMA 3W5DA 1E3IA 3NMUF 1IN6A 3L7KA 5AK6A 3TXYA 2WIKA 4O8ZA 5HKBA 4MUHA 2QI9C 3KX2A 7ABPA 4ZVQA 1BS9A 4EY3A 5FI0B 2V6FA 1QB8A 3MTBA 4LJYA 4QU9A 2PXAA 1OH7A 1K86A 4G37A 3KUCA 2JIZD 3C8UA 4MRNA 4MW2A 4X1KB 2QJTA 4BVFA 3HNOA 5DASA 5FBHA 3B1FA 1EK2A 1V5EA 3WJAA 3ZHBA 3SHWA 3QU5A 1G6KA 4RACA 1PFWA 5ALWA 1QONA 2DUNA 3KKQA 1T3SA 3E9RA 3PWKA 4N6OA 4OXXA 4Q21A 1NBOA 2Z43A 2AWOA 5EINA 5J9FA 3RPEA 1I13A 3AU8A 4R5MA 3T7JA 4P3XA 4XJXA 5BWCA 2D1SA 2RIPA 4WACA 1PG2A 1M6VA 2WNSA 2ZLBA 2DFDA 1NYTA 3OWHA 1IBKB 1Z39A 4NE9A 1OV4A 3PRJA 3D9QX 4WZAB 2CGEA 4O4IA 2HJWA 2QGZA 1TIBA 2QLBA 4NBLA 5FQNA 3AX6A 2QLJA 3F6BX 4M1EA 4TTAA 3LL7A 3VPFA 4M8NE 4MEJA 421PA 5EY5B 3MBKA 1FSFA 2FOXA 1WG8A 1HRDA 3PC2A 3VKGA 3BJRA 3K0EA 3IUBA 1RBQA 1JEQA 1R27A 2JGDB 3LK7A 4R31A 3MLAA 3RVOA 1V39A 1Y6GA 1WDWB 2HBYA 2QROA 5C8VA 2ZCJA 1GEEA 3S68A 1OZ0A 4D96A 4BCBA 1DOHA 1R66A 3SX4A 1DADA 2Q7DA 4QNMA 4AYTA 5JS6A 4JIGA 4HLCA 3SAJA 1WZCA 2EIXA 1DZ3A 1DJNA 4MA4A 2IWHA 4I5EA 3TI7A 4BS9A 1X70A 2JCVA 3V4OA 4F8EA 1N34B 2BHRA 3ZV4A 4PGFA 3AUAA 3TTWA 1NZDA 4KPGA 5B4TA 2MSEB 4LXXA 3BD8A 4JI1B 5IF9A 1RQNA 3QA3E 2C4NA 4C7OA 3BE6A 1Q3TA 3N28A 4WH0A 4F7WA 1VLLA 4RTKA 1UMCA 1Z68A 2I4MA 3C70A 1X94A 1QGZA 1U80A 1YQEA 2EKLA 3E27A 3H83A 1BQ3A 4NK4A 3I01A 1BXRB 4OCZA 3V8RA 3IQGX 1GDTA 4XM1A 5CFRA 3EJWA 1BTOA 4ETWA 3ABOB 4Q1DA 5LD2B 4GZ3A 1KJZA 4TV9A 5IYZA 3F4KA 4DLPA 3ONFA 1XCMA 2L82A 2X41A 4RVNA 2YRFA 5FO0A 3FMVA 3R9KA 2KJQA 2PMDA 3UB4A 2I66A 4TMWA 5LDDC 3CYFA 4LTMA 2ZIXA 2LV8A 2PS9A 3K72B 1RC1A 3SSMA 4EI2A 5F2EA 2G17A 2BGKA 1ZNYA 1SKAA 4F72A 4J3FA 1P2BA 4LWPA 2HO5A 5IW8A 5IN5A 2BV3A 1LU9A 4BNTA 4UOZA 1KSJA 5HPYB 1XP5A 3T35A 5IWAB 1X42A 2VTDA 1C1DB 1XMJA 2PMBA 3C4VA 1G9SA 4R9VA 4B3SB 1EUZA 1FFHA 1IG0A 1FX0A 3CX4A 2Q3HA 2PRYA 4PYMA 1E4EB 4JJ7A 4BC1A 2PBFA 1YC2A 1JWBB 4QFMA 3B6KA 4XASA 1HRKA 2AX4A 4M8IA 1VJGA 2TYSB 4WINA 5F1KA 1NY5A 4LHSA 1QLHA 2D7CA 1OR8A 2X14A 4Q7MB 2Q0SA 1T25A 2G1AA 2QTFA 2QRHA 3LPAA 1ZSNA 2J0UB 4DT1A 5HSGA 2C0CA 2Y1OA 3ROEA 1YS1X 2YMLA 3V55A 5IXJA 3HB0A 4U1RA 2OWEA 3PQ5A 3RC7A 2RE8A 1VA5A 1QMPA 1JE1A 4M3NA 2PR2A 4AUEA 2VHCA 1VKHA 2I3AA 3BN3A 3N2GB 2ASEA 2OZLB 2VUHB 1U1FA 4L8YA 4XYEA 3RU9A 4BLTA 4M53A 4JLPA 4CKBB 4WFKA 1JDPA 4XJTA 3ZK7A 4O2AF 4M76B 4PCLA 2Z5VA 4Q37A 4R84A 1GAQA 4YBZA 5DHFA 3C1OA 4WSOA 3R41A 3TMKA 1II8B 2IODA 3TLGA 4B3IA 4EFLA 5ICGA 3TQRA 5F4ZA 1ONOA 1X87A 3AXTA 3DEFA 3OQ1A 2GZRA 4G0ZA 4JP5A 1RSZA 3GW8A 5DXAA 4AKGA 4BEBA 3HWSA 1JQJC 2PNJA 1R6AA 2GN1A 4EOGA 3RVQA 3G0HA 1E3JA 3RROA 1FFBA 4QGSA 2YNMD 1UKAA 5T4FA 2GERA 4DLSA 4PZZA 5JNLA 5J2TB 3RU3A 3JU3A 3M4XA 4BV2A 4CEIB 3UB2A 5FUWA 2XQKA 2P90A 3N2EA 3HSSA 5TMDA 4AAYA 5K8TA 4LA4A 2JFFA 5KWIA 1XK7A 3AR7A 4XARA 1KOLA 5J1SB 3QOXA 3TMYA 3ANMA 2VT2A 2DPXA 2B37A 4H18A 5EWJA 3TTVA 3ZIAD 4L4YA 1O03A 1EBFA 1TXGA 4FYKA 4JBNA 4WCFA 3DM9B 2YDXA 3RASA 1V9LA 4JOSA 1ZD1A 4BFCA 2BAGA 2HCBA 1XTKA 3E5RA 3F46A 3SIWA 5BV7A 1UP7A 2CXTA 2O57A 1XV5A 5FPQA 4C2UA 5G0TA 4UFNA 1E9SA 4OJQA 4CT0A 5JOQA 3ACBA 1ZD3A 1N2CA 3KYCA 4Y2PA 1SG0A 5I4CA 5AXBA 1OQAA 1VYUA 3PEVA 4GRIA 3QFSA 4PLHA 2J46A 4C0HA 4D4LA 5FTWA 1Z0JA 2BEVA 2IXFA 1SVIA 3GAAA 3OD1A 5J63A 4EO7A 2PZAA 5LQDA 4PFJA 2QQGA 2D5LA 3KU4A 4F93B 1T8YA 3ORFA 4IWYA 4MDHA 1QNFA 1C2YA 1GEGA 2RH4A 1Y8RA 5IT4A 4WW0A 4NHEA 1D1TA 3RKUA 3C5HA 2VJBA 2FJ0A 3QE9Y 4F5DA 2BEWB 4PLVA 2VN8A 5FUBA 3OCYA 4DB2A 3G2OA 4RL4A 3OLVA 2XNHA 1Z2OX 1VJ0A 3UIEA 2AD5A 2O3UA 3H2HA 3L0PA 2WD7B 1JEJA 3L6OO 3LP6A 1OA0A 3OMWA 2NWQA 4NBNA 4MI3A 1SZDA 3UO8B 4KQFA 5GJBA 1KO7A 4IMRA 4PEVA 4QU8A 2OWDA 3IOMA 4BN0A 2G1JA 2VYVD 2CNKA 1VG0B 4EG4A 1WU7A 4MV5A 1B76A 5HJ2A 4TN5A 4I66A 2EHDA 4DN6A 4ZK2A 3CUUA 2ZJ8A 5LP1A 5LZ2A 2AA3A 3ZBUA 2GK6A 3F97A 4YRQA 1P77A 5HS6A 3G9ZA 3L7BA 3L0ZA 1CJVC 1ESNA 3MCTA 3UWMA 2B83A 1FNSA 2V4ZA 4E1AA 3ITKA 3GA0A 4JYAB 1NHGA 4LJ7A 3MERA 4UCQA 5LP6A 2DHEA 2CF6A 3AHIA 1KI7A 1N6OA 1HEUA 4AZWA 4EA7A 3CU5A 1OKKD 3DBLA 3EIEA 4HDRA 2TMGA 1P7CA 2MTBA 1XRQA 3KZCA 3DV2A 4K6FA 4LDPA 4NOMA 3W06A 1XNHA 1A9RA 2CB0A 1RYHA 2D7DA 4ZZ2A 1RLMA 2ID8A 3DAFA 3B8HA 1KRWA 3PGMA 1NW9B 1TIKA 2H2HA 2TS1A 4ZZIA 4U2FA 3SZOA 4NFLA 1QGAA 1JZQA 1OLSA 1G59A 3Q3CA 3VOTA 4IDPA 3ZKAA 1S01A 3VPSA 1QHEA 1WNFA 2WZBA 2ZYUX 1FFXA 2X0NA 3FUXA 3IALA 1RCUA 2F1IA 1CNFA 3OEED 1ZUWA 2O0HA 3FSJX 4IO0A 4R8KA 3GRAA 3URKA 1JTVA 1P0PA 1B41A 3UAWA 4OHRA 5CVUA 4CFSA 3DKKA 4AZTA 4WCFC 4AMGA 1LBEA 3FDZB 3MWFA 3RUIA 1I2ZA 2HDHA 4H0FA 5FOSA 1FSZA 3C3BA 2ZJ2A 5CT6A 1NMEA 2W6CX 2A1TR 3S2IA 2R8PA 4DIKA 2G83A 4ES6A 4MRRA 1VPTA 3FF4A 4F4DA 2ZB3A 5I4IA 1Z5NA 1OT3A 1R9MA 3AUJB 4Q3KA 4H1UA 1L4NA 1EFDN 2VR1A 4DDKA 2HCFA 2QD4A 1JN0A 5CFLA 4RKWA 2XIQA 1KE1A 1NRJB 5CLGA 3R9IA 3SQOA 4Z2YA 1RE1A 4HB2A 4RIGA 5HFAA 3D1VA 1PDVA 4GF5A 1ZW6A 2E4ZA 3OIUA 4C22A 1VBKA 4CM4B 2UVPA 2AN5A 1QWOA 5DHAA 1JLLA 4J3NA 1U9CA 2B2XA 2XWSA 1OX4A 2C7GA 1X1AA 3MWLA 2Q62A 1Q2XA 3BGDA 4ZQIA 3UUGA 1NRWA 2Q5HA 1L6RA 5FOWA 1Z4NA 4B34A 3VJKA 2C8VA 2XADA 1M34B 3IUYA 1GTL1 2I1QA 5CFNA 3Q5EA 2PLWA 3GRKA 4YUWA 4PM4A 3DLAA 5C4MA 3UVEA 3EMKA 5MGNA 2PBLA 2GLTA 3CINA 1V4BA 4NJOA 3H5WA 1JVSA 3LF1A 1ZESA 3H13A 2VNIA 3NH6A 4G5GA 4LRXA 1C14A 2WWTA 2Y71A 2FGJA 3NRBA 4UBIA 1Z29A 3OWOA 2QQFA 3A6HA 4FNAA 4LPKA 4ODIA 3QH4A 4RPCA 3BD6A 4Y1RB 3RIGA 4DCSA 2YICA 2C9OA 1C29B 1XMOB 3FYSA 3HJFA 2P6PA 4LC0A 1YQTA 1YZYA 1ZMBA 2V7BA 4LRUA 1Y3DE 2EJCA 3NVKI 5EJFA 3EH1A 3PYLA 3FTCA 4R0VA 4X8HA 3SDSA 3FYUC 1WSDA 5COQA 3ORSA 5LP6C 4I9FA 3A27A 1XZBA 1SBNE 3I6BA 1UK7A 5LU9A 2X0RA 2VRBA 4L7QA 4DXAA 1EM8A 1XSEA 3MIIA 4MJLA 1ADGA 1PFKA 2P8SA 2O2EA 4BX9A 3N53A 3NJ4A 4TQ9A 3KXIA 1F8UA 1MRZA 5TPZA 4MIKA 2A5FA 4ARCA 1YS7A 1ZUIA 5ALZA 4Y2RA 1QVRA 3D4NA 1VJRA 4C87A 1BXKA 4KFRA 2JA1A 3TLAA 3L4KA 1NHWA 2Q3EA 3LOPA 1NVXQ 2PL1A 5KSWB 3N5CA 2ZTHA 3H97A 3KOYA 4M87A 3T4UA 2P8JA 2E1PA 3KT8A 5H9WA 1RWKA 1TQ2A 3H0EA 5D6OA 3CN9A 5JSKA 4AG5A 2JKZA 3OY2A 3PLNA 4DR3B 2V5UA 1NVFA 3L79A 3LYUA 3NORA 3H9CA 3CRZA 3OCJA 1FTWA 3I05A 5JARA 4ZWNA 2JJ1D 2BBWA 1EVYA 1RHKA 4EJFA 3T3HA 5BMVA 4G84A 3KKOA 1U0GA 2ON6A 1Y1PA 1XZJA 1T8UA 4B8WA 1Z4QA 1T8SA 1KC3A 1PVOA 2ZCUA 2XRZA 1E2NA 2WK1A 5FO1A 4H7HA 2PQ0A 4QQFA 3WWDA 5MFZA 2MINB 5EMLA 1QH8A 1L7BA 1NWCA 2XHZA 3A0RB 3FCEA 4IUCS 3W2FA 3IEVA 3P5SA 4DV4B 4Z53A 4QHSA 3OQ6A 1QH9A 4M21A 1W2WB 4Q9DA 2F3SA 1B43A 4ETNA 3OT1A 4F8JA 1O6BA 4HLDA 3STYA 4N5NA 1AURA 1YCDA 2EP5A 1TQ4A 3NTOA 1OLXB 4GM4A 4IJUA 1XXHB 4NV1A 5AYVA 1Q50A 2O14A 3KHTA 5IXYA 3AVXA 3OFNA 1U1IA 3A9RA 1ST2A 2PAAA 1H69A 3I83A 3CX8A 3JZDA 2QU8A 4O29A 4TN1A 1HYHA 4ZQEA 3KQHA 4GR9A 4GLFA 5JSZA 2BM8A 1GWNA 1P7YA 1QC5A 4ZCRA 1I7SB 1BOFA 1P8JA 2NYRA 2CXQA 3CX7A 3QEMB 5EPUA 3G9TA 2DQKA 2AEMA 3MGAA 2A1TS 4JLAA 4P1ZA 5AW9A 3TRJA 3WDKA 4EVSA 5JO9A 2ANCA 1L4HA 3P4XA 1TAUA 3PICA 4GECA 1N5RA 3Q4GA 4XLLA 2ZYAA 3L18A 1KK2A 1YKGA 1PG5A 5JHHB 3O03A 4W9MC 1O57A 3NHZA 1PO7A 2JIOA 1YQUA 2W2NA 3GDHA 1W1WA 2X9LA 2GYYA 3NCTA 1ZU4A 4I5DA 4LXGA 4RK7A 4W8GA 4IIJF 1DAOA 5CIWA 4EGJA 1G3RA 2ZWAA 1ZHOA 2P2YA 2QVBA 3RTBA 3SXUB 3UWDA 3OZIA 5JAQA 4PV7A 2EFDB 4K88A 4IDFA 4Q3LA 2W8ZA 4PC6A 5HVNA 2O0KA 2PLAA 1HZZA 4W5TA 1GRQA 1CHNA 3JWEA 4POAA 1ISRA 4LJRA 5A3SA 4RZ2A 4NFYA 3BT7A 2FRXA 4QOEA 1K92A 3G85A 1BH2A 1V6CA 2X3YA 3F2IA 4RPJA 3V2HA 3LPMA 1ADJA 2HK6A 3BFJA 2X4DA 1YZQA 1DSSG 4G85A 4I9NA 4C4RA 3GQBB 4RGYA 2MCFA 4KQWA 4K6MA 3E4CA 2C9BA 5DN6A 3VAAA 5KQLA 1U8ZA 5EXTA 1REQB 2G1UA 2ADOA 5KKNB 4MP3A 5I45A 3TLYA 2XITA 3NW9A 1JPJA 1KI1A 5M2QA 1RRGA 1Y7LA 2Y1CA 2DF8A 2YL2A 4ITRC 3KKMA 3L8GA 4GKJB 3VZCA 3KT3A 3AB7A 4D6PA 4PZLA 4WI1A 3L02A 3RAEC 1HFKA 4Q7KA 1L7XA 4O4LB 3X43A 2MSLA 3S2SA 2J1LA 1ESZA 4PX5A 5HF6A 3ZYCA 1GIAA 1R6UA 1HY3A 3WL5A 3CZAA 5BVHB 2OHJA 5E2BA 4B9AA 4DLLA 5ELXA 1TC2A 4CKZA 5F7JA 5K8VA 1XZQA 2ONYA 1T9DA 2DG2A 4IFTA 3PQ3A 1L5WA 1Q6YA 5I9MA 1DAIA 1RFGE 4RQUA 5DCUA 3LT1A 3ROXA 3T9FA 2OZKA 4UHDA 4WL0A 5JCPA 2VJOA 3ZHUA 1JVNA 3T7IA 3MVEA 4XH9B 4MVJG 3ZDAA 1EIZA 4UBMA 4WV3A 4DEYA 1I51A 3MWDB 2C5LA 4MVJM 3DWFA 1WCV1 3JAKB 4C2AA 4ZHSA 4MV1A 3EQ8A 1ODTC 1X1SA 4YRCA 4RYDA 4JOBA 2CWDA 1LZKA 1IDN1 1U7DA 4X63A 5J5CA 4D98A 4DPKA 2H4YA 4AJHA 2DGDA 2FP4B 5EIXA 2PA3A 3L7IA 3H9GA 1N0WA 2ZJ1A 4E4TA 5F23A 1CUFA 4G89A 2WG2A 4QL3A 3LZDA 3QFRA 4H6VA 4TRRA 1P9OA 3EIUA 4BP3A 2WPDA 3Q6NA 3UHJA 1EVJA 2V7VA 1U2GA 3F73A 1D1PA 4QU5A 1FY2A 1Z4IA 2OO5A 4KTTE 3WAGA 3NYIA 1MU0A 5HA5A 4OA8A 2AFHB 2GCIA 3TIVA 3FOEC 4BWVA 3BFKA 1CS4C 1AKTA 3GUCA 4FXOA 1WA5A 3HACA 5KVSA 1OC4A 1HZZC 3AEXA 3LQ1A 4AJ4A 4C01A 2P91A 1FX1A 1C9JA 3D4LA 4E08A 4XYGA 2C3PA 1CUGA 1HA3A 5IZCA 1DBVO 4BTLA 3EIXA 1CF2O 3DDNA 1MB9A 1P9RA 1X2EA 3GYBA 1C9KA 1PEAA 1XZKA 2J3KA 1N5DA 2M9MA 2OXEA 3BKXA 3CCCA 3P45A 1C5KA 2A5LA 5HG0A 4M37A 2JLWA 1FU4A 2FP3A 3Q87B 2ZZNA 4E3WA 4K1XA 1I3CA 1KP2A 3G82C 1SA0A 3C14C 3B7GA 2E4UA 4OAPA 4XFJA 1BEUB 2C8LA 3C5CA 3H4TA 3K9BA 5E0KB 3VR4D 4ENWA 4ZK6A 5KWVA 1BD4A 1RI3A 2VAMA 2ENUA 3QXGA 4YASA 2G40A 3B9BA 4R71A 2ZRIA 5A5EA 2FOIA 1L7EA 5K3FA 2Z30A 4Q15A 3FTDA 1M67A 3DMNA 3F3YA 1W9MA 3ISJA 3M89A 4MS3B 5T4EA 3ZV7A 5KTMA 1PR6A 2OE2A 2OESA 2OYCA 3RNLA 4YAUA 4KRXA 1DTWA 3K8QA 1HC7A 3FOZA 3LHFA 3ZEIA 2CVFA 1IB6A 2ZJ7A 2YRWA 3F6PA 4TMXA 5C1OA 5EJ4A 4AF7A 4G5RA 2ZIFA 1T4MA 1K5HA 1EGAA 1G3MA 3V7NA 3FGZA 1HUQA 2C07A 3TLEA 2C5BA 1OYOA 3ULKA 1T4DA 4YRMA 3OZUA 5HDQA 1V3QE 4LNHA 1T6BY 3DOHA 4HWTA 4ZOLB 3RB8A 3NP7A 1X6VA 4IQFA 4OP1A 1X8KA 4NEGA 1PUXA 1FP1D 2HJSA 4QYSA 3GWGA 6PFKA 5D3MB 3ORHA 4UMDA 4EG5A 2HSZA 4TMZA 1PCXA 1QKJA 2XH8A 1IZ0A 5AUNB 5IULC 3A9TA 2UZ4A 1MJ5A 2ISCA 3E2MA 2O9JA 4DXDA 3EPRA 2E82A 5A5FA 1ZI8A 3I5UA 4X6LA 1WXDA 3CF2A 5DH9A 5KHAA 3U3ZA 3C3KA 1HQCA 1G6Q1 5E9JA 4JXXA 3V97A 5HUQA 5IVHA 3TOXA 3DDUA 5G1NA 3RIYA 3RRNA 5JATA 4CF3A 3QVXA 5JNRA 3DTTA 2XXAB 3ICWA 1UPTA 3A9VA 1BE1A 3IX7A 1AUXA 1DO2A 3QF4A 4K9QA 4AZ3A 1N0UA 4HNAA 3KLOA 5FTJA 2FEMA 2QX7A 3U9LA 2DR3A 1YQXA 3M9WA 2IELA 3F2VA 1E2UA 1U2GC 1OZGA 2NU7B 4MUJA 1S8NA 4WY5A 3RS9A 5EZ6B 1VSBA 1W29A 1X74A 2LXNA 5H8WA 2OO5C 4KWHA 4I8XA 4XB1A 5HCNA 3BIFA 5C1DA 3SJCA 4BEVA 1S96A 3K70D 1BH6A 5A9TA 4DG9A 2TMKA 3HDJA 4OBWA 3UV6A 5D5PA 3UBMA 5IM5A 3BX1A 3BAFA 4YI5A 5K6AA 1Z3CA 1NF2A 1PDOA 1VHJA 3RKSA 3TTXA 2PUJA 5IZCC 3F6RA 1DEOA 4X66B 1LWOA 3QE0A 4CQMB 1FP2A 4AO6A 3ROKA 1E59A 4FFPA 1ZO8A 1HTBA 1ZC4A 3GJ8A 2LVBA 5CD1A 3SBDA 2EFYA 2H16A 5FTNA 4UM9B 5KUTA 1GZHB 4G4SO 1ACJA 4BE9A 3A25A 3CEJA 3Q3VA 4ZZ1A 4DHWA 2AD1A 2HRBA 2PZJA 2CD7A 2J41A 4QUKA 2DT5A 4U2KA 1GDHA 3PTLA 3VNAA 3QFCA 1MTOA 1QMGA 5BSGA 1KHHA 3ORQA 1W1UA 4XIIA 1BO6A 5JNUA 3D64A 2XI4A 2R1TA 1ENOA 2KWIA 3GLUA 1GAWA 1F6DA 4B3DA 1CFZA 1WZIA 3KJHA 1FUIA 4RDCA 5F2KA 2VXYA 3J7AC 1LTHR 2QSJA 3FOBA 2IA5A 1OV6A 1F3LA 1RQ2A 2J32A 1P5JA 3E82A 3INTA 5C4GB 4JNKA 5D51S 1VLHA 4V0SA 4XCQA 1HURA 5EGNA 4N47A 3TR5A 5JWRA 3QUQA 2F7SA 4XVCA 4OHWA 1YB6A 4OHXA 1YJXA 5CJ2A 1XCBA 3R7SA 2GD6A 5ECYA 1T8PA 2G88A 1H2AS 1PDWA 5HIKA 1DO8A 4YO8A 3GJXC 2SCUB 1FLAA 3D8SA 2ZB2A 3IVXA 1JJVA 5IS2A 1ML4A 1V35A 2YKGA 1NRXA 5JFGA 2B36A 3PDIA 4JI8B 1D4OA 4E7OA 3Q1KA 4U7DA 1V4VA 2IOFA 1ZM4A 4G4GA 5LDGA 2W43A 3HA5A 5IAGA 2ZJ3A 2C84A 3L4JA 1Q95A 2G5TA 2VTKA 2R85A 1Y6JA 2WP8J 1FNDA 4XAQA 1RLUA 3I5YA 3PKIA 2H7VA 1JMVA 2WEKA 5AW8A 2A8YA 3TW8B 5JO0A 2OBMA 3OPXA 1DWUA 1ZJZA 1BDBA 1WEHA 3NQ41 5CB4F 1V1RB 3JQAA 1EXMA 3OJLA 4LZJA 4UNIA 4EK9A 1Y48E 3TIIA 3R4CA 4EUKA 3U61B 2MYNA 5TPWA 1C3EA 1ENPA 1G8SA 3MIZA 4IR7A 4LDRA 4RNCA 3KSBC 4BY9E 1PJLA 3N8IA 4J4HA 2ZYRA 4LMBA 5GM2A 5DNVA 4GWKA 3AM3A 2BHNA 2F3TA 3LCUA 5BSRA 1MW9X 3DH0A 3DHYA 1TE2A 2K7FA 3RVBA 2PMKA 1RADA 2JEYA 4L78A 1XNQB 1SZCA 3HCDA 1QH1A 3KO8A 4QYWA 1WBDA 4DA7A 2A7QA 2JANA 2NZ2A 3GRUA 1XAHA 4YP6A 2C0PA 3PP8A 3HDQA 1J2RA 4KXLA 3P7MA 4IYRA 4OHYA 4D7AA 2HT1A 2R0QC 1EGMB 3DEAA 4HQKA 3BMOB 3JWPA 2WAMA 1M0WA 2IDZA 2CNDA 5P21A 1TK2A 3S1SA 2WJHA 4TOIA 3QLUA 1CZLA 4UQPA 4J6EA 5IK2D 2VCEA 2JBAA 4K0RA 4RNDB 3HZZA 3THRA 2BKVA 1CRLA 3SHQA 2NPOA 5JTUA 2HBRA 1PNTA 4LZAA 3FPFA 1ETHA 1JB9A 2PU5A 2QE6A 4NECA 2WI8A 4TSKA 3W7BA 3JSAA 3TRHA 4OI2A 1QTRA 4FZVA 3ZOKA 4JGGA 2DT8A 3JPWA 4BB0A 3B3QA 1C8VB 4O3MA 4YJFB 1ZUD1 4ZC1A 3OZRA 2Z8YA 2NVUB 5IF3A 3OCZA 1AGRA 3MELA 4GUDA 5E6SB 3UWPA 4C4PA 4DC9A 2OXRA 1BGXT 5LBTA 4XVUA 2IH4A 4N54A 2ZYDA 4W82A 4B3GA 1N0VC 1TIPA 3AKCA 5FWXB 3BWYA 3CIOA 1B6RA 1IBSA 1RYZA 3IEPA 4Z7JA 3GD5A 1Q77A 1FYDA 1TLLA 1NIJA 5AW1A 1GT91 1M1NB 3ND6A 1XBTA 3QJYA 3SX0A 4KLZA 4DSOA 4D4GA 1H1DA 1FFGA 1NMSA 3O4FA 3SSOA 3R3ZA 3KBOA 4TTIA 2O06A 3NAGA 4FFBB 4CEHA 1JIKA 5LOVF 2AKAB 6REQA 2RGYA 4MYRA 5KEIA 2HYDA 2E49A 3H8WA 2GAAA 3OZWA 4ZT3A 1N33B 1FRFS 3DEJA 4AO7A 4G56A 1P2FA 3W6ZA 5EZYA 2H7YA 2I9KA 1NNEA 3CGWA 4ZT5A 5EJEA 9ABPA 3I30X 4MWSA 5NLLA 5K8JB 5GV7A 1Q7GA 2HCTA 2PIAA 2D0IA 3NOVA 3JZIA 4HPWA 4AURA 3QVKA 1J1UA 1OBVA 1EU1A 2OB1A 1W87A 3DDWA 1WW3A 3F8WA 5K20A 3ORRA 4MDFA 2VF5X 4C20A 3CXUA 1RJEA 2VDKB 3PQ8A 1F2TA 1XKQA 4ZI2A 2O54A 3CLSD 1DIOB 1CT9A 4FYVA 3ZWAA 3IJ5A 1WVMA 3S81A 4MVCA 5AVOA 5EESA 1R0SA 1DQPA 1HYQA 5FR1A 2HTFA 3NT4A 3WIBA 5A03A 4NS4A 5LYJB 3KZNA 4HNGA 3NTQA 1JHMA 3LA8A 4OD0A 3H05A 2HD4A 1C8KA 4J9VA 1OREA 4JITA 4P32A 3I2JA 4V02A 4YP5A 5AKJA 5FD8A 3UK2A 4ND1A 1SD5A 3TNLA 1R5NA 4AJOA 5KZMB 3L9XA 1L5HA 2CLLB 2PJRA 4EATA 4QBGB 2E6KA 5A4MS 3REFA 2QRQA 1T9AA 5B57C 3OOHA 3OQMA 3VKWA 1TYBE 4MW7A 4B73A 2JHGA 3VR5H 3SNHA 3R2JA 2IZ1A 3GVHA 3P9RA 1D2NA 4OQZA 5KREA 1AK9A 2AG6A 3ZQUA 1N2IA 1A8UA 4HFJA 1NVMB 4G23A 3KSAC 3OIFA 1WZ2A 5KIAA 1GDDA 3CH5A 2XMSA 3Q7IA 3QLUC 3ESBA 2II6A 4KCGA 3W1WA 1OY1A 1SU4A 1MEJA 3QBJA 4FT2A 4QBKA 5ULLA 3AB8A 4F2WA 5DWDA 3W1VA 3RYCB 5IRCD 1JAYA 3IUMA 1AIPA 1S0UA 3SDBA 3TSZA 2ZYSA 4Z4QA 3F6CA 4ZEWA 1HOXA 4TX1A 5AJWA 1G38A 1NJ5A 3D6NB 2JEZA 4RHEA 1FTYA 5IABA 4R6XA 2FETA 4LHWA 4TZ0A 4KLNA 1UOOA 1NVKA 3PT5A 4X91A 4CU2A 1QR2A 4DSTA 2J3MA 5JLJA 3P9YA 5KOHA 3MILA 1JFTA 1RJGA 3LWDA 2HA3A 3QU2A 4ZO4A 2I6SA 1W0JD 4FEYA 4YRJA 2A2ZA 4RPGA 1EX7A 3FMOB 4IHJA 3WYBA 3DQPA 2BR4A 1IY8A 3HYSA 1HT2E 1TT7A 1KE2A 4WLVA 4HXFB 1Y80A 4KXMA 3FUVA 3HCRA 1IUOA 1SKUA 2YOFA 3B12A 4R41A 2NU8B 5EIWA 3U19A 2ODBA 3EISA 4Y0NA 2V7XA 3AERA 3WXBA 4D4KA 3UUEA 4MO2A 3WNQA 4Q66C 1H66A 5JD5A 1UADA 2QNBA 3KZMA 1Z36A 2VTEA 1KH1A 4L4XA 4QVKA 3BULA 2BHSA 4RIIA 5KKAA 8ABPA 4B40A 3QSYA 3ESYA 2YS7A 4JLKA 3NATA 5DX8A 3PT9A 2ORED 1T8TA 1K4MA 3GEHA 5DBIA 2GAJA 3ZTYA 4J94A 2Z98A 3JD0A 1WR8A 1GR0A 3WNCA 1U2SA 1P1KA 5C8XA 5D87A 1ZK2A 4HBZA 1PGNA 4JU8A 2Q4OA 1J97A 4HQRA 3FI9A 1ZD2P 2D1QA 4QXQA 1Q83A 3OZTA 1DTEA 1OFUX 3GH1A 3K9NA 1OJLA 4Q03A 4B7XA 2F64A 2HHHB 5CM8B 4JR0A 4FYXA 3HE3A 4GI7A 2IPOA 2GZHA 4M9ZA 4PQEA 2V58A 3RWBA 3EGWA 3I28A 3DFKA 1NT4A 3O8BA 1UEJA 4MAMA 1ZWKA 2KLHA 2ZREA 3U09A 3QYJA 2WWYA 4G4SP 2HA0A 4NE7A 1I4OA 3RBAA 3M6LA 3PUJA 3HXKA 2EEPA 1Z7GA 4MRMA 3ICCA 4KPUB 4NYIQ 1KKLA 1EWTA 2IUEA 3B9PA 4B45A 4RDIA 1MVLA 5IX8A 1I7QB 1WDMA 4RZHA 3KUDA 3X44A 4PAMA 2ZS7A 4B2IA 2NZXA 3SYKA 5CBKA 5CLJA 4MI6A 4FI3C 3DE5X 4MICA 3A4TA 1YJBA 3DTNA 3HUEA 4Q1EA 3MT0A 4Z8XA 3HSKA 5GINE 5L6MB 2AOXA 2C3MA 3W3AH 1GQRA 1E3WB 1DAGA 4YAEA 2NMVA 1TFUA 2XYQA 4MIOA 2FX2A 1DV1A 5GTDA 4E88A 2HPAA 3GR6A 3JY6A 1PYOA 2VK2A 4JQZA 1F5NA 2J4CA 2J6HA 4Q4HA 4RW0A 1KI6B 1NMZA 3I9NA 3KWFA 3F8SA 3WWZA 1X3LA 2YQ4A 5D00A 4IH4A 3K6SA 4Z3OA 4DV0B 3AV0B 3TGLA 2VBCA 2JIZA 3EMVA 3WB1A 5CK5A 1QYDA 2FHPA 3GRCA 4FCCA 4AJ1A 5EJ8A 4EL5A 1CUYA 3EXHA 3LRPA 3JRXA 4MK4A 3S2EA 2UUPA 3BMCB 3K53A 2NT4A 2GTHA 2I7CA 5EQFA 4FKZA 3B2NA 3O26A 3TN7A 3WRYA 3X2EA 2JHPA 4JL6A 4G5SA 4XX1A 3ZY5A 5CURA 4YJGA 1V1JA 2Z6QA 3GC6A 1PGOA 5K0TA 3DBRA 1O0BA 1P5FA 3DT9A 4G2NA 5A3QA 4F3TA 1W2HA 4NG4A 4OXNA 5HIIA 2C03A 5BYBA 3CISA 3HKBA 4MQEA 4QJIA 3FHTA 2PH1A 5AI8A 1YUBA 2J33A 1A7KA 2ZVJA 4GHWA 1Y63A 4NYMQ 4CL3A 1ZGBA 3OZAA 1PR1A 3LA6A 2QZJA 2G8LA 1AZWA 1KEZA 2ACKA 2C95A 3T9DA 2G3YA 2MMGA 4RV9A 5LZ8A 2JAXA 3QPCA 4PC2A 1JDBB 1CLUA 1Q16A 1LKZA 2WAAA 3WB2A 2BMWA 5JZOA 3UT0A 2EJWA 1CEXA 2A59A 2FU5C 4B3HA 4DY4A 3AR6A 1VDMA 3RF7A 4PG4A 1Y42X 1V37A 3A1FA 5C1IA 1T3TA 2YHAA 4L5AA 4L50A 3SNKA 4DNFA 5A6VA 3GJ3A 3A32A 4L8FA 4AZVA 1HEYA 3VO1A 1TU3A 4BCCA 4YV7A 1VE7A 4JN6B 3U31A 2XGGA 5JS8A 2BKXA 3H86A 1UOQA 5G0VA 1YR1A 1R18A 1EFPA 4IRMA 4ACBA 3VC1A 3F96A 4A0QA 1R4MA 5BT8A 1Z18A 4TUYA 5CJPA 3PUKA 3RJTA 5C7YA 3TZBA 1T1IA 5D8DA 4OQNA 1S2GA 1KU0A 4DDMA 1FXWF 1UZNA 1JILA 2A9OA 2OP0A 3OPYI 4PYJA 1WVIA 1BG6A 1CUWA 2L42A 4AROA 2HLHA 1LNQA 1X19A 4KBFA 2ZI9A 1T2EA 2IEBA 4LHEA 2AQ8A 2ZYGA 4M88A 4LV5B 5CIYA 3NX4A 2RGCA 1ZIPA 1RQLA 2HF9A 2ID4A 5BQOA 4FIZA 2P3OA 4BIIA 2COEA 4JEUA 3UHFA 4M98A 3NU1A 4AJLA 4DM4A 3S0JA 2ZSHA 2UYGA 3LAWA 1JHVA 3M1LA 3ND8A 4Z6KA 1TC1A 3GP3A 1LVUA 1XA4A 3JARA 3RVSA 4LFAB 2QPLA 1CWUA 4CTOA 1ZAYA 3ESZA 1KR2A 4B6GA 3PCTA 4L85A 4MWEA 5KYYA 3M3PA 1UCFA 3N86A 2G70A 1Z63A 1LK7A 4J0KA 4RVFA 3PFKA 4DIBA 4PAOA 1B4DA 1DUVG 5CDYA 1L2TA 5E3IA 4J1SA 5CLLA 4TLLB 2VT7A 1JJAA 2XB9A 3NHPA 3K1JA 4HX9A 4X8LA 1CJUC 2AYZA 2M98A 1K8YB 1ZNZA 2I6FA 1UZAA 4DUZB 1E5VA 5EGSA 1K7CA 1P19A 3REOA 4B32A 3WRYC 1J5EB 1KQ3A 1XTVA 1P4RA 5AKLA 4Q3CA 3RYFA 1PUIA 5HMMA 5A2QA 4BLOA 5C7OO 2XTZA 3NASA 5T64A 1P7WA 1M75A 2GXUA 2IK8A 1GR1A 2V9CA 3JWHA 1W5AA 3KB6A 1LFAA 1ISSA 1ZISA 2XZOA 1RKBA 3IIJA 4G5QA 5BQFA 1CUXA 3C6XA 3QNWA 4MCHA 4UAUA 1H6CA 4CM7A 3AR8A 4MWGA 3IEUA 3P2KA 5CTJA 3HJUA 3TZCA 3RYHA 2YNMA 3WB0A 4MGIR 4U8HA 5JBQA 3ZCPA 1A5SB 1OWPA 4PNHA 1X8JA 1XTBA 1OXTA 4JKOA 3PEYA 3AEUB 1JQ3A 4NMWA 4MULA 4N0DA 1F9AA 2J3QA 2UAGA 4JSYA 4FWTA 2QT0A 1L1EA 2GHTA 3D31A 2WU4A 5GQSA 5REQB 1N3BA 1FLDA 4WA8A 3RUCA 1YB5A 1JBKA 2F3UA 2WWWA 4Q19A 1E18A 1P2GA 3I8SA 5CAEA 1WB9A 2QMQA 5DFAA 3UICA 2WR8A 1N7JA 3D3NA 4ZO6A 3ZIAA 4WBNB 2IKSA 4LOAA 4K6CA 2FPRA 3V1UA 5CEFA 3ZWXA 1YCHA 1MG0A 1X7YA 2PQMA 2ZROA 1VIAA 2B0JA 5M5BA 1A8SA 4KXYA 3RABA 1SVWA 1OAOA 2ZJFA 4J9UE 2CE7A 3JALA 3LY7A 3WLTA 1V7PC 5FLYA 3HLTA 5LXTA 5JJBA 4IXWA 3CSUA 3E03A 3BXHA 4TWJA 1N4AA 3QUTA 2NUTA 4CRWB 4QKQA 1MZVA 2PHZA 1QIKA 1ZXLA 3K2QA 1HMPA 4Y6OA 8ATCA 1RXVA 4AZSA 1DEXA 3HB4X 3RHFA 1V4NA 1KVSA 4LY6A 4NY1A 1AXEA 2HMWA 3RLFA 4D3YA 3DUWA 4JLBA 1DEAA 3OG9A 3OLZA 2ZJBA 4L5CA 4CMIA 2JK0A 4OM7A 3RG2A 4DTCA 3N2IA 2V74B 2EDAA 2ZRLA 3FHOA 2PZBA 4OB7A 4U39A 4EJMA 4JX9A 1A4IA 2QLMA 3ZHTA 2H07A 4MRAA 1A82A 2YIDA 2L0XA 4OH1A 5KO2A 2A5DA 3IAFA 4M1WA 4YJDA 2ONJA 1UC4B 2RHWA 1Q15A 2FR1A 3PNVA 5DRYA 1TCBA 4LHZA 5HGXA 2BFDA 2EJBA 1NUHA 1OLOA 3LUHA 4HGPA 3AY6A 9GPBA 1HX7A 1AA6A 2VIIA 4CG0A 3MNFA 1SC6A 3O3MB 1KS2A 5FAXA 3IYLW 3QX7A 4RKEA 3M1IA 4AD8A 2PNFA 4X45A 1U0FA 1XZLA 4JAVC 1Q0QA 3C8DA 1QRTA 2XUOA 3KKZA 2KBEA 4ERXA 4OREX 4RLSA 1E1YA 5CPBA 1IN4A 2I80A 2LKDA 2R4UA 3K05A 1YHZA 3I04M 4YP9A 1N8KA 2QX8A 3LCRA 2PEYA 3ND5A 4FTWA 3IXMA 4Q16A 3CR8A 2GRAA 4TXJA 4BGVA 3DG9A 3O82A 2WNHA 1FB5A 4L2IA 1P6XA 1A2BA 2ZUUA 2EBHX 5D3ZA 4N49A 4EAQA 4R0NA 1G4UR 3TKAA 2B4AA 1VKJA 2D1RA 3M7IA 4OBEA 3WTCA 4NYJR 3CX3A 9LDTA 4W6ZA 5C1PA 4QREA 2ZJ4A 5AT1A 2AHOA 1O95D 1OKKA 2G09A 1PV4A 2YNMC 4ZCPA 5I3ZA 3GMSA 1FCJA 4ENQA 4KDEA 1TYAE 3FTQA 4MI1A 2JAWA 2VZ0A 4E1BA 3SC2B 3CMMA 3HXPA 3IRUA 5EVCA 5IUKC 3AQ4A 3WBFA 2PL9A 1SWWA 3D8NA 1JU9A 3ZCTA 4LVCA 3ZI7A 4C3OB 3KELA 2AMVA 2VKTA 4G5HA 3C5WP 4BWGA 4UHHA 1DV2A 1NM5C 1DMRA 3U60B 2W0MA 3UMMA 1OTYA 5GV8A 2LP4Y 2VYFA 2R86A 3K71B 3IR6A 1I3OA 1JP7A 3A06A 4LEIA 4OQYA 4MYSA 4Q7EA 4OOFA 2NZUG 2XE8A 2M6RA 2DB3A 2O8EA 3PC8A 3TSOA 5D84A 1UFKA 4RMIA 3NS7A 5K3BA 4C4XA 1OAOC 2CZGA 3IGFA 1KETA 1NW3A 2GJKA 5FA6A 3W7VA 2EERA 4XQEA 2NAFA 1T6XA 3I58A 4LZNA 2XWPA 1V1MB 5JZSA 4QPJC 4KP7A 2ZDQA 4R7ZA 4C0LA 2GZ3A 4QUIA 3EASA 1Y9ZA 1TT5B 1UMBA 4HH3C 5I9TA 1UWVA 3VI4B 4NDZA 1ZN2A 4ZVSA 4D1YA 4HUQA 3CLUD 3LIIA 2NVWA 3KG2A 5B3AA 3TTUA 3H1EA 3WIUA 3SBOA 5DK6A 3M2PA 1RABA 1USIA 2UVDA 2YV2A 4HB3A 4OHZA 1Y8QA 1YE3A 3KQQA 3MS2A 3VSDA 1JR6A 2DCUA 4N39A 4WBSA 3UJPA 1S2OA 3ED5A 1ISMA 3K3PA 4QDKA 2NYAA 2JFYA 3X1YA 2LIVA 5CCEA 2XCLA 2H1WA 4MGZR 4P58A 2UZAA 3UXMA 4V0RA 1W52X 2QYSA 3H9UA 3VYSB 3Q9NA 1ORHA 4JOCA 1EHYA 3HA2A 2PBRA 4JSRA 4UEWA 2Q6IA 4RGBA 3TIGA 1EDBA 1VJ1A 3HP7A 3QFHA 5CJJA 2IBTA 5ESRA 4KGDA 1CRWG 5DULA 3BFVA 2GPSA 4LX8A 2HDNB 3ISTA 2RGBA 3OFJA 3R6LA 3RR2A 4Z3KA 3CN7A 1Y4SA 2CKDA 5TQJA 4E46A 1LW7A 1E9EA 2QXTA 5EYPA 1X92A 2RBGA 5FOQA 4NMHA 3G59A 4NCIA 2LD4A 3F90A 3QI2A 3BK7A 4R05A 3V00A 3VX4A 4B83A 3EPLA 4X1YA 2PT9A 5F3RA 4F4UA 4HFMA 2PUBA 3NOOA 3ZZUA 1EVZA 1GPMA 2QAGA 3EG9A 3PDHA 5I9SA 4N6NA 5AIAA 1SO8A 7GPBA 1GGJA 1NLYA 4LMRA 3VKFA 4DV3B 4QXOA 5TE9A 1JIXA 1QZZA 1MXHA 4ZEXA 1R6BX 1SB8A 1PJAA 4FZRA 3K0SA 1NR5A 3A4LA 1ACMA 1MX5A 3FPHA 3G1TA 5FXMA 1JG2A 2YYZA 1WX1A 5J59A 1PK8A 1ZZEA 1AG9A 2C3OA 3L3BA 3RTDA 1EGQA 2AUTA 2OAQ1 4P54A 3HN7A 4TTTS 1A8QA 3ENNA 2A5YB 2E18A 4M8KA 1QTNA 3D7MA 1XMXA 3WGIA 4QUGA 1SD2A 4QGFA 5DGIA 3TBKA 1G5QA 3FHJA 1PR3A 3KHUA 1OTXA 5EUCA 2QZSA 2OEPA 2B5OA 3QBTA 4NCNA 1UFVA 3MYRA 2P78A 4CM6A 3HB9A 1RYDA 3BILA 3PC8C 4P4UA 2I4RA 4BJ6A 3OU7A 2XBMA 2CLOB 2MSKA 2QZZA 1NNSA 4RHYA 4EX6A 1NJSA 4AO8A 4IIUA 4A0GA 4OXIA 1YQDA 5K0EA 1X1RA 1M2FA 2G0TA 3NANA 2E37A 1MJHA 3OQHA 5J4KA 2R751 1A97A 2IZ0A 1W19A 2I2XB 2ZWMA 1ZL0A 3CBQA 1MOZA 1ZDMA 1CJCA 2IU6A 4KODA 4LBVA 4PSVA 3EUEA 1CETA 1LV7A 4GBED 4QUEA 2XUPA 1F8YA 4P5EA 4RH0A 2NP6A 3BAZA 5A62A 1M54A 1YDHA 1TVKA 2OZPA 3QMPA 4IUBS 4W4TA 5EC8A 4ETIA 5T7BA 2CUTA 2AG1A 1P4JA 3PC3A 4RTQA 5K3SA 5FI5A 4UJ5A 4LSGA 3PSAA 1EX9A 1G2OA 4FFSA 3GDGA 1QKKA 4YYEA 1C7EA 1VRCA 3FWYA 4FIDA 3R3HA 1F2UB 4DDUA 3VDMA 4BEJA 4KMSA 1ABEA 4Z1OA 2VWPA 5JYCA 5DX1A 4AUKA 2XZPA 3DBHB