4I9NA

Crystal structure of rabbit ldha in complex with ap28161 and ap28122
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
331
structure length
324
Chain Sequence
AALKDQLIHNLLKEEHVPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLRTPKIVSGKDYSVTANSKLVIITAGARLNLVQRNVNIFKFIIPNVVKYSPHCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWILGEHGDSSVPVWSGMNVAGVSLKTLHPELGTDADKEQWKQVHKQVVDSAYEVIKLKGYTTWAIGLSVADLAESIMKNLRRVHPISTMLKGLYGIKEDVFLSVPCVLGQNGISDVVKVTLTSEEEAHLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment growing and linking lead to novel nanomolar lactate dehydrogenase inhibitors.
pubmed doi rcsb
molecule keywords L-lactate dehydrogenase A chain
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 107
structure length 324
sequence length 331
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4i9nA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4i9nA02
5TF4A 1QXSA 4XIYA 4YT5A 5EERA 4Z6KA 1ENOA 4GH5A 3ZV6A 1LLCA 4FFMA 1B8UA 5L45A 1FDSA 4KUHA 3TDKA 1GAEO 2EKLA 2G5CA 3ASUA 1LLDA 3LYLA 4Z3DA 1CETA 3F5SA 4GVXA 4QECA 3TZQA 5BQFA 2PZKA 4BO0A 1EFKA 2QZ9A 1E7YA 1R4MB 1UAYA 4ILKA 4Y67A 3FTNA 4NU6A 5DBFA 1YE3A 1DLIA 3W6ZA 4BNTA 4XIJA 4N54A 1UAGA 1IHYA 4AVYA 1CDOA 1QV6A 4FFPA 1X0XA 2I67A 3E48A 1LA2A 2BGKA 3H9UA 3QRWA 3VPGA 4DLAA 1ISHA 5EQDA 1GQ2A 2ZJ0A 3EVNA 4J4TA 4YQYA 3ITKA 2ZCVA 3GNTA 3DC2A 3WMWA 1Z82A 2OUIA 3IDSA 1BDBA 3DZIA 3HDJA 2D5AA 3PYXA 4D0RA 4CLOA 3MJSA 4LGVA 2A9FA 2PY6A 1UUFA 2JJYA 4KTTE 1M66A 4WLFA 4B79A 2B36A 4HP8A 1Y6JA 4OKIA 3DTYA 4P22A 3DZJA 3Q6IA 4Q3NA 4GI2A 4CMHA 4CV1A 1RPNA 1EVYA 4BO6A 5K6AA 2H6EA 3ZWNA 2HDHA 1ZCJA 4TZTA 1T26A 2WTBA 1JN0A 5CFZA 3PWKA 2ZTUA 3WNQA 4CMGA 4CQMB 3ZH2A 2EERA 4U7WA 3PGXA 4R54A 1NAIA 1U9JA 4A5OA 3NRCA 2WD7B 1E77A 3AK4A 1ZUD1 4KZPA 1C1XA 1J0XO 1GEEA 1CQJA 1YL7A 2DVMA 4FGSA 2YHIA 4GX5A 2FPPA 4L75A 3ST7A 2DUWA 3JQ7B 3SVTA 4WCFB 5I9NA 1GL3A 1Z73A 2FZWA 3X2EA 1R0SA 1LC0A 4YT2A 2W2KA 2DU8A 4ZQHA 2CNBA 1YL5A 5T8KC 1UP7A 1ISMA 4FN4A 1EVIA 4PG4A 2JHFA 3H65A 3MJCA 3OHSX 3OBBA 3QVTA 4JQCA 3TZCA 3W8DA 4QO8A 5HRUA 5AXDA 3IOYA 2GRAA 3GRKA 1H6AA 2DTXA 5A05A 2IZ1A 4RPLA 5C7OO 3VPSA 3QSGA 4HFMA 1FMCA 3Q9UA 3CZRA 5BSGA 1DIRA 3C1TA 2VHWA 4FR5A 5TJHA 2SCUA 4WLUA 2OOSA 2VRBA 5GMOA 3IJPA 4W9NA 2O4CA 4ITUA 3AU9A 3ICCA 3R0IA 4GPD1 3SXPA 4DPKA 1VPDA 1WAMA 1P1KA 2Q1WA 1GD1O 1E1LA 1ZJZA 1KC1A 2CD9A 4PVDA 1T2CA 3PFWO 1NPDA 1AUPA 1DO8A 1EVZA 1YQDA 4RQTA 1K0UA 3OECA 4A2CA 3DHYA 3WYEA 3W4IA 4IBOA 1MP0A 5JDCA 4Z9FA 1PQWA 2J8ZA 1C14A 3GVHA 4R1SA 3TQHA 1HF3A 4Y6PA 2O3SA 2VYVA 1X7HA 1A4UA 5BNIA 4XQCA 4NMHA 5IZCC 2XAAA 3G1UA 5AXBA 1DRVA 2RBEA 1CYDA 4N5NA 1R12A 4L9RA 3AUUA 3ZZNA 1NTOA 3HFGA 1B3RA 2P9GA 1PS0A 3SJUA 3MCVA 3DONA 2H9IA 4OJNA 1ADBA 1OBFO 3NJ4A 3KO8A 3WB9A 5DBGA 3ZHBA 3L07A 3BIOA 4O0LA 4TROA 1NWCA 4E2XA 3QV1A 4DLLA 1NHGA 3ZI0A 1YQXA 2Q4EA 4U0KA 3S2GA 2P2SA 2ZYGA 3WLFA 4DIOA 5KVSA 2V6GA 1B8VA 1WVGA 4CR6A 1GFSA 1M6WA 2P9EA 1KC3A 2P5YA 1QLJA 5COBA 5DN9A 3WSVA 4MVJE 1U2DA 5BNFA 1T4DA 5EJ2A 1WW8A 3F1KA 2Q3EA 4NFSA 4FFLA 1SPXA 1UP4A 3RUEA 1K5HA 5JAMA 4BIIA 1FF9A 1YBMA 3DHNA 3IP3A 4M54A 2GZ1A 3LC7O 2ILTA 4HWKA 3NJ8A 3SEFA 3Q0EA 2DTDA 2VOEA 1RM4A 1IULA 1JKIA 2C5AA 3VZPA 4J7XA 1RWBA 3FWNA 3QQPA 1MA0A 1LLQA 3JYLA 3K6JA 5TC4A 1LLUA 2C5EA 4RLHA 3FPLA 3JD4A 4MO2A 3WBBA 2FP4A 2W8ZA 4EUHA 3M2PA 1V9LA 3D5QA 3W8FA 1U5AA 3HN7A 4XDZA 4XYBA 1NVMB 5C5IA 1R4MA 1XU7A 2PKQP 3H5RA 1W6UA 4IGEA 3OQBA 4CR8A 4DQUA 2VWHA 3VH1A 4AJJA 1S7CA 1NQTA 4JCOA 2GN9A 3I6IA 3ONFA 4DYVA 3ASVA 4ALMA 4MIYA 4BNHA 1XQ6A 2PH3A 1T1RA 3EZLA 5ER6A 1HYHA 3PQFA 1IPFA 3ZWVA 5IDWA 2FSVA 3U3XA 4E4YA 3WX0A 2QQ5A 3KSDO 4OAQA 3ZHYA 2CDAA 3HFSA 2J3JA 4DLBA 1PJ4A 4OSOA 4B7CA 3BHIA 2OXIA 2QRJA 5ER9A 2JD1A 5G0WA 4DQXA 4A73A 2NACA 3D4PA 1I24A 4J0FA 3RIHA 2O7QA 3LC1O 3ITDA 4YAJA 1HZZA 1I33A 4IPTA 5CEJA 5JNLA 2BELA 2BKAA 1C0LA 3FSRA 3U4HA 1ZK2A 2Y05A 3DFUA 3FCOA 3OJOA 5JS6A 1NR1A 2CF5A 3RROA 4I9HA 4BNUA 1JAYA 3AU8A 3E03A 3F47A 4CMCA 2JHGA 1XIVA 2E37A 3KYBA 3GUYA 4ZQGA 2WYVA 5L7WA 3CXRA 2NWQA 2J5RA 3AI3A 4OOEA 4IJKA 5A9SB 3S2FA 4M55A 5ILOA 4CQMA 1Z45A 4BKRA 3BMOB 3GVXA 7MDHA 3EHEA 2VYNA 4NK5A 2WD7A 4ALIA 4RO0A 3ZWCA 3PTZA 1E0DA 2LDXA 1YVEI 3C85A 4CM7A 3FI9A 5L9AA 3BZUA 1GEGA 4EUFA 2C2YA 3JQ7A 4HADA 1NQOA 3OJEA 4M87A 4NJOA 4WCFA 1A7KA 2P5UA 3OF2A 5IZ4A 3MOGA 2G1UA 2X5KO 4GX2A 1J4AA 2Y66A 1G1AA 1H6CA 4FC6A 4BKPA 2O7SA 1T1SA 2IXBA 4IJVA 5AXAA 4ZJUA 4JJIA 3OIGA 5TJ9A 3I52A 3C3XA 3D0OA 3TOXA 4CUJA 2PTGA 4XGNA 1T25A 2FHSA 4YRDA 5G2OA 1R66A 4ZU3A 3G1TA 1SMKA 3SLKA 4PGFA 3T7EA 1AXGA 1B14A 3QA9A 4RVDA 5COAA 2BGLA 3DBHB 1MXFA 1XELA 1Y8RB 4AJIA 2OGUA 1OMOA 2A35A 1ZK4A 3E9NA 4NU5A 3BMNB 4XZ3A 3ROPA 1HDZA 2C82A 4L8VA 1GCOA 3ZW8A 3AW9A 1C3VA 3UFXA 1PJCA 5JPIA 3QP9A 4G81A 4TRNA 5C3MA 5HWSA 3DOCA 4UEOA 2BH9A 3PRJA 1X0VA 2J5QA 1HE5A 5DCWA 5IFLA 3U4CA 2WJPA 3DEYX 4R51A 3ZWAA 2ZTMA 4WOJA 1KEUA 2Z5LA 1M67A 3D3WB 3H4VA 3MZ0A 1Y9EA 2BGMA 4WLOA 2ZQZA 3Q11A 1XGKA 2IYOA 5IXYA 4R68A 4XDYA 3IJRA 1GCUA 1DB3A 1GYRA 3K73O 3NT4A 2O2YA 3WR5A 5JMWA 1JDJA 3RWBA 5A3JA 3GEDA 2NVBA 3UCEA 1PL7A 4PN3A 3W6UA 3JD0A 1E7MA 4JBIA 3V1YA 3AUAA 4BNXA 1NYTA 3A1NA 4RLSA 1OC4A 2Q2WA 4RCVA 4OXYA 4BGVA 1JKJA 3MOIA 5KKCA 3I9MA 1FDVA 1ISGA 1UDAA 4J2HA 3UVEA 4OKNA 1Q2XA 3DAFA 3UOGA 3CEAA 2Y67A 4Q39A 4BV9A 4HNGA 5FI3A 3DL2A 1GADO 2CSUA 3TNLA 4HXYA 1ADFA 2D1YA 4K28A 3AM3A 5K0ZA 2ZB4A 1HEUA 3VTZA 3SC4A 4FFNA 4LISA 1AGNA 4ROSA 3Q1LA 2X7HA 1Y5MA 1PGJA 2Y1DA 2VHYA 4TMFA 1ZEMA 1P33A 4WEOA 1DPGA 3LLVA 2GD1O 4IS3A 3WOHA 2NTVA 4IZIA 4ZQBA 5KTKA 4IIUA 2GZ3A 1U8XX 2VWQA 3D64A 1JA9A 4Z9XA 1I2CA 4UULA 1PWZA 1B7GO 2EF1A 2DBVO 3GG9A 4MDHA 1OC2A 1RYEA 5T8KA 3LSYA 4M49A 3JQAB 3RBZA 5CDUA 4BNVA 3BTOA 5I9MA 3I6QA 2VT2A 1JVBA 5AXCA 3V5NA 1T4BA 3DZKA 2GO1A 3QE3A 3K30A 4DPMA 5ITVA 3PJFA 1LNQA 4J90A 4D41A 1I2ZA 1N1GA 1WDMA 4XYLA 3GHYA 1XWFA 4JJFA 3F6YA 3PWZA 3ZWYA 3LT4A 2W2LA 3GR6A 4BO8A 3KB6A 4U0JA 2Q1SA 4ZGWA 4JX8A 2GYYA 1N7GA 2VUTA 3WYBA 1H94A 4XQGA 3GF4A 4MVJA 3I3OA 1GQQA 2HKIA 2X0RA 2YQ5A 4UEKA 3WXBA 4D43A 5JCJD 1E3LA 1AN9A 1R4NB 4N18A 1UXJA 3AWDA 3KETA 1LU9A 2PNFA 4CJXA 1KVTA 3PHLA 2X8LA 3DAPA 3RC2A 1H0KA 1RM3A 5GY7A 5I9LA 5THQA 5JAZA 4LN1A 4J1TA 3SLGA 4AL4A 2PFGA 4YCAA 4LRSB 2AG5A 2C54A 4MP8A 3AI1A 1DAPA 2GF2A 3MJVA 3OMLA 4FGWA 4DMMA 4I5GA 1ISFA 4BKOA 3I5MA 1Y5RA 1YKFA 4DYDA 1IZ9A 4TSKA 4B7UA 1ONOA 4W4TA 4WPGA 3PGJA 2DPGA 1KS9A 4PVCA 2Z95A 3EMKA 1N1EA 4CR7A 4YYZA 2P4HX 4GQAA 3AOGA 2J3HA 3PWSA 4RVHA 3KLMX 3U0BA 1ONPA 3DQPA 3E18A 3WYCA 1YJ8A 5L40A 2NTNA 1MFPA 4I1IA 2O50A 5DT9A 1OZAA 1PL6A 3L4BC 5A02A 1IZ0A 1RJWA 4I9NA 2YFHA 5TIIA 5A9SA 1DOHA 1I36A 4RPKA 3TZ6A 4DTIA 4YJFB 3BMOA 1BWSA 3IKTA 1TVEA 3HB4X 5CG2A 3PZBA 2POQX 5ICSA 1DFHA 2VTEA 4GGOA 3PQEA 2NVUB 4EYEA 2FSSA 1W0CA 2H1SA 3OP4A 2O2SA 1NPTO 3HDYA 4J9VA 3E5MA 5DOVA 3V1TC 3ZV3A 2J5KA 3ANNA 4TVBA 3E1KA 4RPGA 1HDOA 3C7AA 4DGSA 1PJSA 1JAXA 2AQHA 3LK7A 4NFYA 4UUNA 3ZWPA 4CM4B 1Q0HA 1I3LA 1KEWA 1LSJA 2H63A 3UGKA 2JCYA 1HT0A 3VOSA 3CH6A 3GUCA 1PZHA 3GNQA 4WEQA 4E5YA 1GZ3A 2AA3A 4R16A 3CIFA 2O3JA 2C29D 3SC6A 4A27A 2I66A 3U09A 1GR0A 1QORA 1EDZA 2Q1UA 4ZQEA 5TLSA 1AHIA 4CM1A 8ADHA 5HA5A 4IDAA 4BO5A 1EBFA 4NQZA 3PHIA 4OMUA 1BVUA 4PLHA 2JCXA 3DBHA 4CM9D 5HM8A 1Y8RA 3GY0A 1HTBA 3WJAA 3IC5A 3A4VA 3D7LA 2OBNA 3WG9A 4RF4A 4FQ8A 1A72A 3BMNA 1ENYA 3H5AA 4IQGA 4BMNA 4EBFA 3DFZA 2AMFA 1X7GA 1YH3A 3ANLA 1GYQA 1UDCA 5JMPA 5JSFA 1ADCA 4NH4A 1V3TA 2NU7A 3I4CA 3WGTA 3BTUA 5ENVA 4BNMA 3PYMA 1ZJYA 2HK8A 4II2A 1R6DA 1W73A 2PZJA 4IS2A 2JL1A 2GLXA 4WNCA 3RKUA 1UZNA 3E82A 3OM9A 3ZDFA 3UCFA 2HRBA 3AOEC 1JTVA 4BO7A 1BVRA 5AQ1A 4KQWA 3G79A 3D3WA 4IMRA 4Z0PA 3WGZA 4D7AA 3ONDA 2UYYA 1HYGA 4WLEA 4F46A 2D8AA 4B4VA 1BW9B 4Q3DA 1BSVA 1GV0A 2D0IA 1HWYA 1A71A 3OA2A 4CMKA 1IY8A 4GKBA 5KVCA 1T2AA 4PIVA 4Z9YA 3LT2A 2PGJA 3JQFC 3QHAA 4YRBA 3GGOA 3BXXA 1YXMA 1DC6A 1I5RA 1CIVA 3EZYA 1VKOA 1KVUA 1K6XA 4RZIA 4IXTA 2HK9A 1TB4A 4LSMA 4E32A 1ZH8A 2I99A 4WLVA 3SX2A 1A4IA 1D8AA 5H83A 2ZB8A 3FR7A 3GDOA 3KRTA 4XWYA 1NP3A 1P77A 3NV9A 1XLTA 1D3AA 4TRRA 5G0SA 3JV7A 1EE2A 1H6DA 1U5CA 3ZN2A 1OOEA 2X9GA 3V2HA 4AG3A 1XEAA 1X13A 4DIFA 4TWRA 4L4XA 4FB5A 1E3JA 1GQYA 2EJWA 1J6UA 4KUEA 5TNXA 1XU9A 3LQFA 1B0AA 3QWAA 2IEDA 4PCVA 2JAHA 2IDZA 3GVPA 5LC1A 5IXSA 3QLJA 1P0FA 3K2EA 2FPIA 3JQAA 4HBGA 4PRLA 4RF5A 4CLHA 4CODB 4UVGA 1JLLA 3GDGA 3JQ6A 2XXBA 3ZWWA 2NV6A 3H6KA 3VDQA 5IN4A 3VPFA 3RI3A 3WWZA 4NR0A 4AFNA 2X9NA 5DBIA 2NSDA 4BNYA 5TT0A 1I01A 2X5OA 3N74A 1WMAA 3H8VA 1ULSA 4TRMA 4FW8A 1EQUA 3INGA 4NDNE 4ZHSA 1K89A 4JBHA 3WS7A 1TEHA 5CDTA 5KJ1A 5T67A 3DB2A 3WFIA 2V6BA 2F00A 1QMGA 3H7AA 1ZK1A 1KVQA 3WFJA 4E30A 3H3JA 1R4NA 1E1NA 1U3WA 4GLLA 4NPCA 3A14A 5ITWA 1PZEA 4J1QA 4J0EA 4QFDA 2X22A 4K6FA 2BF7A 2PA3A 1WP4A 5EIOA 1VE9A 4TZKA 1SBYA 4DWVA 1ID1A 1E7SA 1OAAA 5COQA 3VPXA 3E5RA 1HDXA 2GASA 3JCZA 3OETA 3FWZA 3O4RA 1M2WA 1H2HA 1BDMA 2YY7A 2VZ9A 1DLJA 1O9BA 3M1LA 3GPIA 3PDJA 4BB5A 3ZGYA 2GR9A 2WWRA 1GDHA 2O3UA 2V6FA 3GC6A 3T4EA 3DXFA 2NU6A 4GVLA 2NU8A 5C7LO 2Y99A 3ANMA 1XR3A 1Z7BA 2X58A 4QX6A 2J6IA 3Q9NA 2IE0A 2G76A 5A04A 4M86A 2HK7A 2CY0A 1SOWA 5KVVA 4C7JA 5JXWA 2Y1FA 1NVGA 2R6JA 4BNLA 5T6BA 3VHRA 2DBZA 1DJQA 5A5FA 2Y0DA 3HB5X 4E2ZA 4OL9A 3S2IA 1YBVA 2EGGA 2NNLD 3NUGA 4MJLA 5FFFA 1HDCA 3F4LA 3GPDG 4MPDA 4Y98A 4YJGB 8LDHA 4RVSA 2XXJA 4ALKA 5FWNA 5GZ3A 4EUEA 5K9ZA 4YJFA 3FNFA 1H9BA 1WDKA 1LQUA 1MG5A 4CL3A 4CMIB 1AHHA 4WE3A 4JNKA 2BD0A 3GT0A 1H5QA 2NVUA 3P7MA 3DMTC 5I8ZA 3WNVA 5TSDA 1UJMA 4YT4A 4UEJA 3H9GA 2DC1A 2BFAA 4OM8A 4F3YA 5EESA 2GNAA 3WGYA 1QR6A 1ZW1A 4D3SA 1T2FA 1UDBA 2C07A 4QT0A 4CM4A 3STHA 4DC0A 3TPCA 2EGHA 3NTQA 5JAIA 3LC2O 2IODA 4MOWA 5L51A 3RUDA 1DRUA 1P0CA 4L0QA 1LDBA 3BHJA 2C0CA 1ZBQA 1A7AA 4EJ0A 5MDHA 2B4TO 4QTZA 5TX7A 1V8BA 1GY8A 1MG0A 1SEPA 1HYEA 3TJRA 1YDEA 2OMEA 3WSWA 3NGXA 1P44A 3GVIA 3ROQA 1ISJA 3AUTA 3DBLB 2VHZA 3OEWA 4PZDA 2X0NA 5JY1A 1PWXA 1ML3A 3E8XA 1LI4A 3H9JA 3NYWA 4P38A 5L4NA 1P1RA 5JO9A 4J7CA 1NBOA 1C1DB 5BSEA 3WDSA 3WIDA 3OH8A 3L0DA 1HDRA 3ZNOA 3R1IA 4I5EA 5G0VA 3IMFA 3ICPA 4M8SA 1EUZA 1W8DA 4R1TA 5A3VA 2CFCA 1DC5A 1BW9A 4GAEA 2HCTA 4ONEA 1Z6ZA 3O9ZA 1QRRA 1ZMOA 2O3RA 2EP5A 3BYZA 3KM0A 4RVFA 4K9DA 1XSEA 3CINA 4B8ZA 3CZMA 3ULKA 4CLRB 5U9CA 4PLCA 2YDYA 2ZIZA 1VJTA 1U7TA 4IQ0A 2FZEA 4GBJA 1E1MA 2Y0EA 1M6HA 1EDOA 1NHWA 2LDBA 3NAQA 1A9YA 5EPOA 1DIAA 2BFMA 2NU9A 1ARZA 3Q2KA 3FRJA 2PR2A 1GPJA 5B4VA 1KOLA 5ENDA 3NDIA 1N9GB 2BI7A 4B3IA 3INTA 4GL4A 1WWKA 3L4BA 3BAZA 5DOZA 3DO5A 5KIAA 3ZNPA 3JYOA 2HMUA 1PJBA 1PL8A 4D44A 2G0TA 4Y6RA 2QYSA 4IIVA 4FC7A 4CMBA 4ND2A 3PK0A 3AM4A 3CE6A 3ETDA 5CPBA 4PLFA 4BGIA 4D3FA 3HDHA 1MFZA 1Y9AA 1LSOA 3AJRA 3FF4A 4CUZA 3JQDA 1EMDA 1SZJG 2YZ7A 2ZQYA 1JVSA 2VTDA 1VJ0A 3GOHA 1PR3A 4R5MA 3W4KA 1DFIA 2FR8A 4QFCA 2GDZA 3BTSA 1ZEJA 3DDNA 4JN6B 4CLXA 2GSDA 4R9RA 1ZKMA 2A92A 4J16A 1ZSVA 2FOIA 2G17A 4U6QA 2GZ2A 4NBRA 2BI8A 4TKMA 1YL6A 5L4SA 2CF6A 1QYVA 2J3IA 3D1LA 3GH3A 1E6WA 2Q49A 5KCZA 3EDMA 4AJLA 2DBQA 4B4WA 3RJ9A 4PG5A 3K92A 2OP0A 3TFOA 2HLPA 3P5SA 3AI2A 3TF5A 3M2TA 3QIVA 3QJ5A 3NDRA 1LJ8A 1PGNA 2AE2A 3AY6A 3FNHA 2XPCA 4KOAA 5EL0A 2BFPA 5TQVA 2ZTVA 2YDXA 3OEYA 2GCGA 4NIMA 3KYDB 2B0JA 4BNWA 1T24A 5JAQA 2EEZA 3MTGA 3P19A 4QSMA 4YACA 4IZHA 3PYLA 4CM3A 2VHVA 1F12A 2O4UX 4OO3A 5I8WA 3B1FA 4FSHA 4L73A 4CQMD 4DQVA 2RH8A 4B8WA 3AOEA 2PGLA 3GN1A 3NTRA 3WGQA 2VYND 2J3KA 1P3DA 5CDYA 2JD2A 3QWIA 3B6ZA 1J49A 4W7HA 3ROKA 3ZHXA 1ORRA 3GRPA 4E0BA 2B83A 2W90A 4EJ6A 3VKUA 3ZHZA 5JFOA 3TZHA 1D7OA 1IHXA 3OSUA 3UHAA 3IP1A 2YQ4A 3GA0A 1NFRA 2PZMA 5EN4A 4CMJA 5DNAA 4O6VA 3GHHA 1D1TA 3JQFA 4ESOA 1N92A 3KZVA 1MXHA 1YONA 5G0UA 3ENNA 1L1FA 4EI2A 1PJLA 4ZN6A 4OYRA 3LLSA 1BXZA 5C37A 5FEUA 2WDZA 2DFVA 4ALLA 3SJ7A 2Y1EA 2R2GA 4BOYA 3L6DA 2O3QA 2AQIA 4RJTA 3CPSA 2EXXA 1NFQA 5BR7A 3BMQB 4YJGA 1U2GA 1P1HA 4WASA 1I8TA 1SEVA 4J49A 5EINA 4CMAA 1LDNA 1GPDG 4W7IA 4KDEA 1U3VA 2PLAA 1WLYA 4OHUA 4CMIA 1R15A 2V7PA 3VH4A 3EYWA 4XQEA 1EK5A 1PQUA 1X15A 5HS4A 1GUFA 2P9CA 3LT1A 4MKRA 4DC1A 4EEZA 3GLQA 2HMSA 3RASA 3P2OA 4C7KA 1VSVA 4E31A 5KJ6A 3VDRA 4L4SA 5JC8A 1O95A 5HTOA 1MLDA 1MV8A 3B20A 3H9EO 3RUHA 1RKXA 4GSKA 1CWUA 4EJMA 3AFNA 4E13A 1ZFNA 1FDWA 4IINA 1LDEA 2Y68A 4CL8A 4YRAA 4MKXA 3VZSA 4A10A 5L7TA 1VM6A 3C24A 4O59O 2I76A 1E3WB 5F5NA 5JE8A 3WGGA 2PWZA 3ZWBA 3EUWA 1D1SA 3DBLA 5CDGA 4J7UA 5KJFA 2R00C 4KP7A 1Q7BA 2PD6A 2YFQA 4DUPA 5C7IO 4J2OA 2OORA 3GFBA 1LRJA 1CJCA 4YDRA 1CERA 2RAFA 4FBGA 3RFVA 4TRJA 2Y1OA 3TSCA 2IRWA 4AJ2A 3EGOA 1KBZA 3JQGB 3DTTA 3T4XA 3M1AA 1C1DA 2D59A 1K3TA 2ZTLA 3NDJA 1NXQA 4TVOA 1U3TA 1VL6A 4IDEA 5LDGA 3OJLA 5MGBA 4IM7A 5BNTA 1DHTA 2ZCUA 4BO4A 3V1UA 2TMDA 1ZIDA 2NADA 3JQ8B 4MVJF 1JW9B 1K6JA 2O3TA 3GZNB 1LSUA 3PFFA 5AOVA 4P8RA 3E6AA 4J1NA 4LSWA 4IDBA 1ISIA 4XKJA 5ES3A 4CLRA 3NT2A 4RZHA 4RPJA 5B37A 5CDSA 3EC7A 3GNSA 1AE1A 1YRLA 4XYEA 1GV1A 4E12A 3G17A 2Q99A 3I4FA 3TFQA 5I7VA 1PR9A 4J4HA 4CLDA 4GLOA 4BQRA 2NTJA 1N9GA 4IGFA 2CVZA 4D79A 4LVUA 2QYTA 4DBZA 2YV3A 2W2LD 3QWFA 2Y93A 1P45A 2D4AA 2E6UX 2YV2A 2W4QA 4E6PA 2QG4A 1C0PA 1YBAA 4XQ9A 3OJFA 1V6AA 1ZZEA 2I3AA 3CTMA 3NEPX 4INAA 4MVJD 2B35A 5JDCC 3WQQA 4XB1A 5L4LA 1BHSA 4RV9A 5A4DA 4GWKA 1QP8A 1T2EA 1N2SA 2UV8A 4PLZA 4NBVA 4A26A 2BMAA 3DMTA 1QG6A 2O48X 4JBGA 2AEMA 4LMRA 1ZK3A 2VN8A 2VZ0A 5F3RA 2VNSA 1K6IA 4YAEA 3MTJA 4NG5A 1FJHA 4OH1A 1QYWA 4YAKA 5A9RA 3RFTA 3COSA 1XDWA 4BVAA 2UAGA 4QQRA 4K1LA 4J6FA 4MINA 3RD5A 3PEFA 4YTEA 1IB6A 2EIHA 3KSZO 3RFXA 5JCJA 1IOLA 4ZRMA 4NZ9A 2A4KA 3P2YA 1HE3A 1YDWA 4ND4A 2GN8A 3VKVA 1EQ2A 2AE1A 3CUKA 1TXGA 1M76A 3L77A 4ZICA 5IZCA 3OICA 3AM5A 1VL8A 2WD8A 2HMTA 3UW3A 3NT5A 1KERA 4B3HA 4R3NA 4E2YA 1C0IA 3ZU2A 3KYDA 3ZW9A 2JAPA 3LVFO 4PLYA 1VKNA 1B26A 3PPIA 5U1PA 4YBZA 2OFPA 5DCYA 1XKQA 1HE4A 4MP6A 4ZQFA 1KVRA 3ORFA 2OO5A 1HSZA 1I3KA 5IJZA 4J91A 1HZJA 3WWYA 3GGGA 3K31A 2I9PA 1LTHR 4MIOA 4D0SA 5T64A 1NFFA 4W6ZA 3OA0A 3EAGA 1ENZA 3K2BA 3F1LA 4O63O 2AHRA 4DA9A 1I10A 4NHEA 2VOJA 1LQTA 2RHCA 4R1UA 5ADHA 3WTBA 3RUCA 1XHLA 4U5QA 4BMVA 1B3BA 1O5IA 1R0KA 1F8GA 4NJMB 7ADHA 1U1IA 1G0NA 2VRCA 1P1IA 1ONNA 1PQPA 5L3ZA 3GMSA 1PGOA 4DBVO 4L76A 1FDTA 1EFLA 2B4RO 2VWPA 4CM6A 3I9LA 4LVCA 5FI5A 4FOOA 3JD3A 3F5QA 4OGWA 2HJSA 3ETGA 3IQDB 4M1QA 3I1JA 2CDCA 2PKRA 1JWBB 4RDIA 2NQ8A 4B3JA 1LX6A 4O5OA 5T5QA 4TKLA 5FYDA 3WQRA 3AY7A 3MWDB 1DIGA 2FR1A 3BMQA 1O6ZA 2WE7A 1UR5A 4XRRA 1JKFA 2VT3A 5F5LA 3EVTA 4L74A 3KV3O 2W98A 3JQCA 4DVJA 4XEHA 1KIFA 3C8MA 4I5DA 3ZWMA 1I2BA 2QX7A 4RDHA 4F6LA 1XA0A 4NI5A 3ADPA 3DZBA 1EZ4A 2CVOA 3R3JA 2HAEA 2EWMA 2CDBA 3AUSA 1E1KA 4E21A 1ZSYA 1E7QA 4F6CA 1E3SA 1B16A 1CF2O 4CMEC 4I8XA 1YO6A 4Q3EA 4ALJA 3GDFA 5CEFA 1KY4A 2VZ8A 1RYDA 1N5DA 3VC7A 4HV4A 3RAJA 3GEGA 2YV1A 4WLNA 4Z3KA 3A9WA 3VAZA 1E3WA 4H3VA 4Z0HO 4CPDA 5F21A 2Q1TA 3PHGA 1QSGA 2D3TA 4FPXA 2EW8A 3S55A 5F1PA 2OL4A 4NFHA 4U8GA 1YQGA 4EW6A 4UUOA 3OIDA 2WYWA 2C20A 2UDPA 3JQGA 3HQ4O 5DP1A 1NASA 3L6EA 1ZMTA 4WCFC 1YB1A 2DTEA 4HKTA 5KWEA 2EHDA 3CKYA 5JLAA 3U4IA 3ON5A 3B1JA 1Y81A 3WGHA 2VNAA 4BGUA 2OZPA 4R9SA 5KVQA 3DHEA 1WXDA 2Q4BA 2EV9A 4ND1A 1QKIA 3JQ8A 3QVSA 3MWEB 4HFNA 3VH3A 4URFA 2GN4A 4PZCA 1F17A 3GZNA 5DDIP 1BXKA 3GVCA 4JLWA 3KXDA 3ZWXA 4UVDA 4II3A 4BO1A 1HLDA 3NGLA 4YQZA 3DOJA 4FJ0A 3ENKA 4ZD6A 4Q3AA 2QRLA 5CAEA 3JQAD 1ZSNA 4P4GA 1O8CA 4KDFA 3G3EA 1GZ4A 1EVJA 4BS9A 3JYQA 4RGBA 5TGDA 3HZZA 1ZK0A 4HUJA 2B5WA 2JFGA 4XA8A 3JQBC 3C7CB 4L4RA 3OQ1A 4XYGA 1S6YA 1WNTA 3L6OO 1BRMA 2X6TA 5THKA 4D45A 2E49A 3GAZA 1HRDA 4LCJA 1IE3A 2HRZA 4DIBA 2OBYA 4GWGA 5JDIC 1LRKA 1KVSA 1LXCA 1CRWG 1PZGA 3FNGA 2A94A 1T2DA 1UXHA 1VRWA 4OXKA 5B12A 2ET6A 3WMXA 1MC4A 2JCVA 5JYDA 5CPFA 4EDFA 4XR9A 1GYPA 3PLRA 4S3MA 3UN1A 3ZV5A 3W1VA 2HMVA 4CUKA 5JYEA 3KTDA 1I0ZA 1X1EA 2P68A 1V35A 4IY1A 4FIZA 5G4KB 1UH5A 3TL3A 1HE2A 2AQ8A 1MUUA 4JP3A 3UCXA 3DOOA 3HUDA 5FF9A 1CEQA 5AYVA 1EUDA 2EW2A 4ZA2A 3CMMA 5HS6A 4BV8A 4XGIA 3RQSA 4AICA 1ZO8A 2ZKLA 3HJAA 2OP1A 1LRLA 3I9NA 2R00A 2ZB3A 4RVGA 1PJ2A 3OFSA 2AXQA 4AJPA 3KEOA 1BTOA 1N7HA 5EQFA 3PHHA 4BNJA 2PGDA 2XF8A 1C0KA 2B69A 5DZSA 3TN7A 5IDYA 3GAFA 2WSBA 2YUTA 3Q2IA 2TMGA 3S8MA 2OHXA 5B4TA 2PD4A 5JO0A 1E7WA 5L7YA 1U8FO 1SB9A 3O03A 3PJEA 3Q3CA 5CP8A 3ZWOA 4WK6A 4PLWA 4NJMA 2NVWA 1LDYA 1IYZA 5IDQA 1EE9A 4D46A 3FBTA 2DUUA 4ALNA 1GU7A 1EK6A 4J9UE 5A06A 4HX5A 3MJEA 2I65A 2FR0A 4H16A 3L4SO 2RHRA 4U6SA 4KUGA 3K9QO 3H2SA 3WLEA 5LCXA 1YWGO 4FJ2A 1DFGA 5H82A 1ZXLA 2E48A 4IDCA 3RU9A 2Q45A 3DZGA 2VYVD 4CV3A 1YB4A 1E5LA 1F14A 3UAGA 2C7VA 2GUGA 4KQXA 3WQSB 1YS4A 3IIEA 3QVWA 1NQ5A 3PLNA 1RM5A 3G0OA 1B15A 1Q7GA 3N7UA 6ADHA 4J1SA 2JFHA 1A5ZA 3FTPA 4XX0A 4W82A 4YA6A 3JQ9C 3F3SA 3PDUA 4Y8VA 2UUOA 4LRTB 2BLLA 4AJOA 1RM0A 4Z0TA 1L7DA 4WOKA 1GUYA 4I9UA 2PD3A 1QYDA 1SO8A 3ZCXA 5F1KA 4N5LA 3W8EA 2EP7A 3IS3A 2C2XA 3D4NA 4H15A 1Q0LA 4JXKA 4LK3A 3N58A 1NQAO 1ZXBA 4WCDA 3DZFA 3RCBA 1NAHA 2IXAA 2D5CA 3PZRA 3GEMA 4WKGA 3VPHA 3KUXA 1DC3A 1BGVA 4OOFA 1BXGB 1TLTA 3R3SA 3AFMA 1WZEA 1HL3A 4PG8A 3GMDA 4BKUA 1PGPA 3UF0A 3DZHA 9LDTA 1U4OA 3MJTA 4BB6A 2I3GA 3PJGA 2FY8A 1KEVA 3HG7A 1E5QA 4HFRA 3V2GA 2X0IA 1K2WA 3NX4A 2WM3A 5A5EA 4A03A 1UZMA 1NX6A 3UH1A 1BG6A 3HN2A 4XRGA 4Q3BA 4IDFA 1PS8A 4W99A 1P9LA 1GTMA 4B4UA 4ND3A 1SC6A 2B5VA 1DIBA 3IAHA 1MX3A 3BTVA 4WNIA 1NM5A 1Z7EA 3I9JA 3JD2A 1LSSA 3BHMA 4JJGA 3OIFA 3C7DB 2EJVA 1YJQA 3O38A 4EEXA 3W4JA 4YJHB 4E5NA 5BSFA 1EBUA 2HU2A 2NLOA 1DJNA 1MGOA 2QHXA 4IQ8A 4IUYA 4FD3A 4RORA 3SBOA 3UICA 3NTOA 1Y8QB 4CM8B 5BSHA 3QWHA 1DIHA 1HLPA 1TT7A 4ND5A 3VZRA 3WGOA 3TL2A 4QO7A 5B1YA 4BNIA 1FXSA 4EITA 3F46A 2C59A 1ULUA 2WYUA 3QW2A 1I3MA 2PKQO 1JU9A 4EZBA 4YR9A 5CHEA 2VUSA 4CM5A 4R4JA 5DF1A 4DPLA 3F4BA 1PJ3A 3UXYA 2Z1MA 4IDGA 2PH5A 3RVDA 1Z74A 3RBXA 4ID9A 2ZB7A 2X0JA 4P4NA 1YGYA 1PX0A 5JY6A 4BUCA 5AVOA 1F8FA 1X14A 3TWOA 1YB5A 3LF2A 5IAAA 5I7FA 3KYCB 4A7PA 2B37A 3VZQA 4Q3CA 4QEDA 2IZ0A 1DC4A 1DDOA 1H2BA 1HSOA 2DFDA 3HSKA 3U4DA 2E82A 2WMDA 4B4OA 3ONEA 1QYXA 3PXXA 2I6TA 3DBRB 4LCEA 1ADGA 6LDHA 4JIGA 2V6MA 2X86A 2JD0A 2FMUA 4MVJP 4NK4A 3WJ7A 1DHRA 4OIMA 1LC3A 1IL0A 5G4KA 2GN6A 4DL9A 1B8PA 1OI7A 4AJEA 4AJ1A 1E7RA 1Y7TA 4GMGA 4X54A 3ABIA 5BT9A 4CMEA 1DEHA 4FDAA 1O89A 4CLEA 5IG2A 4E5KA 2ZYDA 3BMCB 4QXMA 3INRA 4R41A 3S2EA 3JTMA 1AXEA 4I5FA 5A9TA 1I30A 3EK2A 2AG8A 2Q2QA 5F1OA 3DBVO 1UP6A 4HNHA 3IL2A 4IXWA 3B1KA 4MVJI 2YYYA 4I08A 1LEHA 1UZLA 4MP3A 3G49A 4KMSA 2H5LA 2Y0CA 1PGQA 3IKVA 2QW8A 4WJZA 2DPHA 1SOVA 3KBOA 3AY3A 2XOXA 5KJEA 4CQLB 4UVHA 5I7EA 3O8QB 1XYGA 3ZU4A 1SNYA 4RF3A 3X2FA 4CV0A 3RC9A 3C1AA 1X7DA 2JFFA 1P1JA 3A28A 3LU1A 5ILGA 3U49A 4BO2A 4DREA 4JROA 2VWGA 4BNNA 3K5PA 3VVCA 5KOIA 3I9KA 3LT0A 4MIEA 5A1TA 5IN5A 4RF2A 1UXKA 3PJDA 4MVJM 2FRDA 1QV7A 1W4ZA 2RH4A 4FCCA 1N8KA 3RUIA 1R0LA 3PI7A 2UUPA 1I3NA 1PSDA 4E5MA 3L9WA 1YOVB 4AJ4A 1ENPA 4UUMA 3U9LA 1WZIA 1I32A 3KLPX 2HUNA 1LDMA 3FD8A 4PG6A 5ICMA 3KOUA 4R5HA 3F9IA 4NBUA 5G4LA 1H93A 2WE8A 4OQYA 4F45A 4YAIA 5H81A 1HDGO 1O0SA 2BHLA 3KEQA 1DSSG 1PTJA 4AJHA 1DRWA 2VCYA 1TT5B 4FS3A 3V8BA 2HSDA 1V0JA 5CEEA 2UVDA 1PZFA 4WUVA 2WEKA 3JQBA 5K6AC 2DLDA 4JGBA 4PLPA 3HNPA 3PQDA 3QWBA 3RU7A 1FDUA 4LMPA 2CUKA 5G0TA 5TS3A 3DAGA 1BMDA 1VI2A 2HO5A 3ETEA 3GN2A 2YHUA 4XJTA 2BFOA 3OQ6A 1PJQA 1QLHA 3TOZA 4DXHA 3EW7A 2CMDA 2RCYA 3CMCO 4O1MA 5JDIA 2DQ4A 5TT1A 4YWJA 1Q1NA 1WMBA 4FFRA 1DXYA 3IUPA 3S1LA 3JD1A 2DBRA 4FJ1A 4BL5A 1DBVO 4R3WA 3HE3A 3ZU3A 1XCBA 4MKZA 3M6IA 1TA4A 4N7RA 1KYQA 3H5NA 4UVEA 3ADOA 3QVXA 4BO9A 3GQVA 4PRKA 4BO3A 3U5TA 4XD2A 1HKUA 4TQGA 1XG5A 4AJNA 2NQTA 3FHLA 4A0SA 1DAOA 2CVQA 5JBIA 2X4GA 4XR4A 4OQZA 1JQBA 3CSDA 5GZ6A 1BXGA 4ZRNA 3DR3A 4YT8A 3GG2A 1EUCA 3D4OA 4M89A 4C4OA 4CV2A 2F1KA 5IDXA 1U28A 4PFJA 1E6EA 3MJ4A 4GX0A 2C7GA 4OXNA 3D5TA 2PK3A 4XCVA 1KY5A 3IUSA 4UVIA 2IZZA 4W9NC 4J4BA 4XGKA 4RL6A 3RC7A 4IMPA 1PS9A 1E92A 2V65A 1Y1PA 2P91A 4YPOA 3RUAA 1VL0A 5JCXA 3GZ4A 3OJ0A 1HDYA 3KHUA 1L7EA 2AQKA 4GX1A 2X1HA 4KWHA 3E9QA 2JKVA 3ZV4A 3B70A 1WPQA 4YJHA 3ZNQA 1SB8A 2G82A 2Z1NA 3GFGA 1GZ6A 2ZK7A 5J23A 1Y8QA 4Y6SA 4CM8A 3DMYA 4RVUA 4CLOB 4K26A 1P31A 2Y1GA 2PZLA 1PJTA 1R37A 1FK8A 2B4QA 3I83A 2IYPA 3UUWA 4BNZA 2QZZA 1ZVMA 3EY4A 1ZNQO 2VQ3A 3D3EA 3WGIA 3WBFA 1E6UA 1TI7A 3H2ZA 4LW8A 3GGPA 4R01A 2AW5A 5DP2A 4Q9NA 3I23A 3FR8A 4GKVA 1NWHA 1MB4A 2CZCA 1E3IA 3FN4A 2I5PO 1Q7CA 4UUPA 4BNFA 3PIIA 5KNLA 3FPCA 4PG7A 1P1FA 5U4QA 2X5JO 5L95A 1WDLA 2P4QA 3KSUA 1Q0QA 4P4LA 3KYCA 3VH2A 1SAYA 4G65A 5JC1A 5TRTA 1C1XB 3JQ9A 2YHIB 1LBEA 3L9XA 3VTFA 3ZU5A 4BNKA 4WGGA 2FWMX 4BMSA 5GZ1A 3PVZA 1MC5A 3RSHA 3DBRA 4HFJA 2DM6A 5I7SA 2VHXA 1Z75A 5JW6A 2D2IA 2EG9A 3JQEA 1PU2A 3JSAA 5T57A 2W2KB 3HWRA 4E2WA 4Y9DA 3PHJA 5KJCA 4B7XA 3I9OA 1E3EA 5DULA 4XYMA 2GERA 4BGEA 3A06A 1M75A 1D4FA 4FFOA 1UXGA 3BMCA 4XB2A 1H9AA 3LDHA 1CQIA 3O26A 3H9QA 2VRCD 3K96A 1U7HA 2ZJ1A 9LDBA 1G6KA 4R1NA 4S1VA 1H6BA 4NBWA 2Q50A 3VVBA 3QY9A 4IJUA 4E5PA 1NVTA 4KTVE 5IF3A 2GGSA 4NBTA 2DT5A 4YVFA 3TRIA 4E3ZA 3V2UA 1U4SA 1JWAB 3PIDA 3PP8A 4J43A 4QUKA 3DWFA 5CG1A 4DMLA 2YW9A 4BKQA 4CQLA 3HADA 2IEBA 1B2LA 2DKNA 3O8QA 1F06A 3E9MA 2Y1CA 1UXIA 2ZATA 4G5HA 1KEPA 1HETA 1VSUA 4R69A 1X1TA 1P74A 3JYPA 1OFGA 2HQ1A 1LUAA 2HMWA 5EMHA 1NNUA 1V3VA 3LZ6A 3H3FA 3RBVA 3GK3A 1NPYA 2X23A 4H7PA 4YEDA 2O23A 3RUFA 2DAPA 4UAGA 2PV7A 3T7CA 4D42A 4MVJG 1R16A 2EKPA 3KVOA 2YJZA 4BQPA 1G0OA 3BA1A 3K8ZA 2RIRA 1YOVA 1IPEA 5HBRA 4XJSA 2VUUA 4WECA 4G2NA 3ZNNA 3NKLA 1F0YA 4YJDA 1VJ1A 4PLTA 4J3FA 1EEHA 4JK3A 2AEJA 3LF1A 2FN7A 4CM9A 4FOSA 1U3UA 4PLGA 3RC1A 4UREA 4BHTA 3R6DA 5KKAA 3HHPA 5A03A 1NR7A 4YXFA 1TT5A 1QYCA 4JP2A 5L53A 2E4AA 1J5PA 1PIWA 3WTCA 3WICA 3WIEA 4AJKA 4RQUA 3U62A 4EGFA 1IUKA 4MVJH 4E33A 3UKOA 2BRUA 2GPTA 2NUAA 3FBGA 3TZKA 1O94A 4GMFA 1V3UA 4NNJA 4OSPA 2Q2VA 2HJRA 3ROMA 4IJWA 3RKRA 2QRKA 1PEDA 3HDQA 5LDHA 4GSLA 4K6CA 5B4UA 3C1OA 2Q46A 3QVOA 3MEQA 3FNEA 4ZVVA 4YAGA 1HXHA 1VLLA 4PLVA 2AEFA 2FPGA 1A9ZA 1LDGA 4D3DA 4RPHA 4KWIA 2EKQA 1KETA 4YB8A 3JYNA 1A27A 2ZYAA 1XQ1A 4IDDA 4N5MA 1SCUA 2NM0A 2X9VA 4BNGA 4GGPA 4PZEA 4HY3A 4DRYA 2QIOA 1VC2A 5DCUA 3RJ5A 1GUZA
chains in the Genus database with same CATH superfamily
4R8KA 2E2WA 5ALZA 2I6SA 4GH5A 1E0SA 3ZV6A 1RRVA 3DLAA 4FFMA 5JU6A 2JGAA 4X9XA 4KUHA 3R7FA 3A2KA 1GCIA 3MJRA 3WYFA 1JSXA 4RDXA 2CWWA 1CUGA 2G08A 2GM3A 5AQEA 1GGJA 1ZNYA 2L82A 2PRKA 3D3NA 2G5CA 4QNNA 1NA5A 3QEOA 2H31A 5LDDC 4IIEA 4NHOA 2C99A 5DSXA 3L05A 1ESNA 3TZQA 4KQ9A 4KPUB 5BMVF 1EFKA 5K0GA 4EA6A 1W4BA 3AHHA 4GYJA 1R4MB 1P4RA 4PAOA 4Q18A 4Y67A 1Y5LA 4CEJB 2XUAA 1QCZA 3AR7A 3IOBA 4MGHA 1DLIA 2B78A 3W6ZA 4ZI7F 4FHZA 5LXTB 1ISSA 4WH0A 5LQCA 1FLVA 3HXPA 1SCAA 1Z4JA 4BNTA 1A8IA 1QOQB 2C8JA 3OESA 1E32A 4XIJA 1G5FA 5EWMB 4LSGA 3WNDA 4OAOA 4GXQA 4AVYA 1ACLA 1N2GA 4FFPA 1FE8A 2I67A 3E48A 3PDIB 2QE7D 4MA4A 5JZVA 1QDLB 3QRWA 3VPGA 4II7A 3ZHOA 1JBKA 4E4RA 4Z1MD 1GQ2A 2ZJ0A 1O95C 4LKRA 1QOZA 5B3AA 1OD6A 2UYGA 2DT8A 3DLBA 4EAAA 4OV6B 1T3LA 2F2TA 4EUKA 1X9HA 2WJJA 1CJKC 3DZIA 2VDUE 2DBYA 3RV4A 1RJDA 4X3CA 2VJQA 3IYLW 1IVSA 1Y9JA 2VAXA 1KOGA 5E4FA 5ES3A 4PSAA 3DTVB 2YXEA 3BD7A 1X86B 5K2MA 3MMZA 4JA2A 4LC0A 2HN9A 3KJNA 4CKWB 4WLFA 4A8PA 2ZB2A 4QPJC 2Q5CA 2ZYTX 3Q6IA 3HB0A 4EHLA 3H0EA 3IQFA 3H5IA 5K0FA 1ECPA 1RPNA 3QOYA 1SWVA 1RI3A 4BFTA 5K6AA 4P7JA 2AFRA 5A5DA 2HDHA 1EFRD 4JITA 2VF4X 2V7UA 3K0FA 4EKEA 2ZTUA 4CMGA 4AULA 1D2CA 1GZVA 2EERA 1E4VA 2HNBA 2MSNA 3HWWA 3WHLA 4YUAA 1J0CA 1Y1RA 2XODA 4Q1EA 2EZ4A 3IHKA 3IUNA 5ALEA 1E77A 2DZDA 5KNCD 1O4VA 1GEEA 1WTAA 1IWPB 1YL7A 2DVMA 3ST7A 1NBHA 2FPPA 1L5OA 3A4YA 1HBJA 2ADMA 2H3EA 4CBVA 4CI9A 3OEHA 2ZIXA 2YXNA 3SVTA 4WCFB 3WA7A 1ADYA 1GL3A 2ZM5A 2FZWA 2OLJA 1K3UB 2H8KA 3ZHVA 4X44A 3QBJA 1NOJA 5AI8A 1P4HA 2JAQA 1YL5A 1BH6A 1UP7A 1NN5A 5DYTA 5F51A 2PSEA 3VR6A 3ER9A 1RQLA 3EA5A 4BAGA 4I66A 3H65A 4EVQA 2QSUA 3MJCA 1KMIY 4IFEA 4HEA1 4MZXA 3K4QA 4G56A 2SKDA 4JC8A 5HRUA 4RA9B 2GRAA 2IXTA 4RHEA 3BHNA 2J09A 2VJKA 4WZZA 2JJ8A 2WSMA 2R96A 2EKBA 5A05A 2GUWA 4D92A 4K8RB 4C2TA 5C7OO 1KYTA 2JI4A 3MJDA 2PPLA 3VPSA 3G0DA 5BSGA 2VHWA 3BORA 5D8DA 1ZP6A 4WLUA 1TJNA 2OOSA 2JATA 1J56A 5IAOA 3M83A 4DLXA 2XEXA 5GMOA 3SPXA 3WLHA 2ZAIA 3AL0C 4IIHA 3IPXA 4KHZA 5E9QA 1EESA 2WABA 1XHFA 3AU9A 4GPD1 4MROA 4IUDS 5F1YA 1WAMA 4KQ1A 4GPBA 1P1KA 2Q1WA 4J0IA 1GD1O 4OHVA 1Q74A 4P1ZA 4L8LA 3FOFC 4QVKA 3GRYA 2CD9A 3DS8A 4PVDA 4TLEA 1CBUA 1FYFA 1SOUA 1SHKA 4HGQA 2XDYA 2DY0A 3H7IA 4RGYA 1DO8A 5JJIA 2XE6A 3DE2X 3T7KA 2GQ0A 3MGBA 4O0MA 4J1TC 4QDKA 2P6RA 1Z0FA 3ETHA 5HJ7A 3V8PA 2DCUA 3P20A 4GUDA 5KVAA 5AESA 4HGPA 5GWXA 1MPXA 1UOOA 3OZWA 3VAAA 2G5PA 3SP1A 1UKAA 4FFBB 5KSOA 1R0XA 1AKQA 2N75A 3KKOA 3JZAA 4O4IB 1P6XA 2I3DA 1LWNA 4QLOA 2JGIA 3B82A 1J9GA 2C2GA 1XNHA 2FPMA 1EDEA 4IF6A 2H2GA 1ZN2A 2M6RA 4MPRA 3VI4B 1U2SA 3PCTA 4YIKA 1EAYA 1ZH2A 5IZCC 4LOLA 4RMJA 4A6DA 2SKCA 4P93A 3RRZA 1SUDA 1TYAE 1R12A 1REQB 2QR2A 4K5QA 1EI9A 1UL1X 3C3JA 4N0PA 1B3RA 1GNRA 4HT3B 2P9GA 1E98A 4YFVA 3DONA 2VTBA 1DAGA 3R7NA 3C8UA 3C48A 2BTQB 2C3OA 3SBDA 3WB9A 5DBGA 2QLBA 1DBPA 2J31A 3C41J 3BIOA 1W36B 1PZNA 2BBOA 4KBFA 1NWCA 4B71A 4D4MA 3PQ3A 4DLLA 1QGAA 3MWKA 5B7NA 1KJQA 1X8LA 2FG7C 1MENA 2ONYA 4U0KA 5KVSA 1PG0A 1U0EA 4ARUA 1EG2A 1OGYA 2BN4A 2C57A 1B8VA 2Y27A 3IUQA 4P83A 3NOXA 4Q5IA 5IM4F 4F1JA 1L7MA 1GFSA 2R6R1 1M6WA 2P9EA 1KC3A 2P5YA 4D9MA 4DR3B 4R8VA 4MVCA 3RT9A 1PFVA 3B36A 3CN9A 1U2DA 4GE3A 3RIXA 4URVR 4MR9A 2X42A 4YASA 5HK8A 4S2EA 5GOZA 5LBTA 2CK3D 1G4AE 2APJA 5BQPA 1RAEA 5JAMA 1NBEA 3MTQA 1YBMA 1M72A 2HZBA 3TK1A 5CBPB 4OJTA 4ZXFA 1RHQA 2GXQA 4M54A 5DHUA 3SK0A 3D1VA 3QU9A 3AF5A 4X94A 3NJ8A 3SEFA 1FP2A 2HTFA 2VJYA 1NBME 4UBOA 4CI0B 4P92A 3RK4A 1IULA 5MFPA 3HCDA 3VZPA 1KI7A 1RWBA 2F3TA 4FR2A 4KITB 3U16A 4OJKA 2YN4A 3ENVA 5ESXA 4HH0A 4ZEWA 5PNTA 5LYJB 4A4DA 2YTZA 3K6JA 3R4CA 5TC4A 1B74A 3AEUA 2FA9A 2C5EA 1BC5A 4IJ6A 2PX3A 4KE9A 2E5LB 4Z4GA 3PEYA 2BV3A 3FPLA 3AXSA 4JGIA 1FSGA 1PK9A 3NNDA 4NCJA 2EIXA 3SQMA 4X6XA 2IYFA 1V9LA 3D5QA 4EUHA 3OX2A 3W8FA 3U4GA 4MMZB 1JWLA 4XYBA 3O0DA 2VQDA 2DLCX 5C5IA 3S44A 2GBGA 4ID3A 4CGYA 3H5RA 4CR8A 3QTBA 2OVFA 4O4HF 3VH1A 3RTAA 4AJJA 2CNOA 1PD0A 4PSKA 3I6IA 1U8EA 421PA 3C5VA 2BFEA 3L5OA 2UVPB 1EK2A 4I4TA 1QB8A 4PBSA 1OXVA 2XVZA 4BNHA 1XQ6A 3U17A 3JS5A 4JUAA 4MRSA 3V42A 4AM8A 1HYHA 2B1QA 3PQFA 1VI5A 1IPFA 2G1KA 2XUPA 4EGCB 2FU5C 4NCAA 1II0A 4E4YA 1V8PA 2ZR8A 2IUUA 3AILA 4FYVA 3K0CC 2CDAA 1Z0JA 3HFSA 3IP8A 4DLBA 2OCAA 1KPIA 4MV7A 3BHIA 4OSOA 2OXIA 4RVOA 5ER9A 1L4GA 3NIDB 4JB3A 2PT9A 4DQXA 2BKVA 3A1SA 1P17A 2C96A 1F2TB 3P2MA 1FQKA 3HB9A 5C5CA 2CXSA 5KX5F 5JH7F 1XYVA 4H0NA 2GT1A 3PD1A 2HT6A 3FOZA 3M6WA 3I9FA 1OZGA 4GLFA 2BMJA 5ALFA 1HRKA 3ZCSA 3FWHA 2ZIWB 5BRJA 5TE9A 4MUNA 4MS1A 3U4HA 4M46A 1ZOPA 5FQOA 3AESB 3N2KB 2PX5A 2Y05A 3DFUA 1JA1A 3FCOA 1C8BA 3H84A 3OLQA 4LYAA 4X63A 5HMLA 2DR3A 1F5SA 4CHGA 5EWLB 4D8VA 5LWQA 2FRXA 4XASA 3F47A 4KPGA 1Y6RA 3DNPA 3GARA 3LUJA 4LECA 3WQHA 1XLTC 3KYBA 3GUYA 4FFSA 5H80A 4IJKA 5ILOA 5E2AA 1B6GA 1Z45A 4BKRA 3BMOB 4UTNA 5JVDA 2PJUA 5AKYA 4DJTA 5AVQA 1Z39A 3CONA 4G0PA 2O1XA 4MWTA 2VYNA 2VK2A 4NK5A 4BEJA 1CJMA 4RO0A 2A59A 3ND7A 5C1BA 4PBTA 5L9AA 2CJPA 2A0FA 1KY3A 1GEGA 3T5CA 1IXRC 2PL1A 4DY4A 4HADA 1LBHA 3W7BA 1S01A 3OJEA 4ESHA 4DB2A 2P5UA 2QNBA 1LPAB 3FUVA 3OF2A 2UXCB 4Y6OA 2DYKA 3QU4A 3MOGA 4LIPD 2BTOA 4MS4A 2R8PA 4ZHQF 1V4NA 1J4AA 4GGMX 4C4XA 1G1AA 1H6CA 2MINB 5IANA 2BHRA 3FMPB 4RKQA 5EPUA 1BMQA 1WW3A 2P2LA 1T1SA 4G9BA 3WL3A 2IXBA 1NLFA 3CLRD 3D6NB 5AXAA 1Q1AA 1FFXA 2J9YB 2XZPA 1KRWA 4BMYA 3HM2A 3TOXA 3WLMA 2IGBA 1T5LA 1JEQA 3EFBA 4YRDA 5G2OA 1ZD2P 4QKQA 4DCCA 3G1TA 3BBLA 4ESVA 5DTIA 2IXFA 4PGFA 3FJOA 3WOVA 1AXGA 3S70A 3ND6A 3T9EA 1HYQA 3N2YA 3DBHB 1CHNA 1R4ZA 3DFMA 5D51S 3M9WA 2AVDA 5B36A 4N5DA 4FI3F 3GLFE 3ZDBA 1S3IA 3K70C 2A35A 2ORED 4NU5A 2DETA 1UOPA 3K1AB 4XZ3A 5EQTA 3UHOA 2ZUCA 4E94A 1QPZA 1XEWY 2IIQA 1JKMA 3ZW8A 1C3VA 1L0BA 2ZI3A 4LF7B 4TRNA 3WK7A 5KWVA 1VCHA 4UEOA 4WVLA 1AK1A 2QG9A 4NZYA 4RV5A 4W1PA 4K0KB 1XDUA 4E3WA 3H1FA 5DCWA 1Y7IA 3D8SA 4TOIA 3NUZA 3ZDZB 2ZBQA 2BC9A 3DEYX 3U31A 3FDXA 5JXJA 4R51A 2BYTA 3ZWAA 2CNWA 2TMYA 2BH2A 2Z5LA 1Z9BA 2BGMA 3NYIA 4FHEA 4HVAA 4RTQA 2HRQA 3G9TA 1XGKA 2B8EA 3G9QA 4GOND 5IXYA 4XDYA 2X6QA 3IJRA 3MILA 4RZQA 1GYRA 1YCHA 2OC4A 3K73O 5C81A 5JMWA 1JDJA 4HX9A 2WUDA 1JI3A 3EXHC 3G8BA 4QXQA 1WLSA 3GEDA 4PN3A 4B47A 1JAHA 2OAQ1 1G4HA 1N6KA 2ZR0A 4O2BA 4F96A 4IICA 3LP5A 4K05A 5E3IA 1M6VA 1U8UA 5HCIA 1B0UA 4G67A 3WLQA 1WHSA 4BGVA 5ELMA 3Q12A 4FX2A 1JKJA 1JB9A 1RD4A 4INZA 2Z1DA 3S4YA 4BECA 5KKCA 2I22A 1UDAA 2YS6A 3UVEA 4DEXA 4OKNA 4X6YA 5K3SA 3UOGA 3OOJA 2BDUA 4F3RA 1AGYA 1FTNA 1VHQA 3GLHE 2H48A 3RTEA 1G18A 3CVJA 4LHXA 4UE2A 3SIWA 4RSGA 4AZ3B 1R9NA 4MYDA 3QVKA 1KBQA 1XMVA 2CXXA 1ADFA 1CZLA 2P2CA 5GM2A 1U11A 1W2WB 4KWTA 3VTZA 4IKOA 3SC4A 2AOVA 2PLRA 5TB5A 1XZFA 2X7HA 2JJ2D 3IPCA 1W0JD 4RETA 3FYUB 4WEOA 1X7YA 1WSDA 4D9KA 5LIPA 2GD1O 1NQWA 3C5WP 3EIUA 1UKBA 4IS3A 3PJRA 1JIIA 2NTVA 2PA0A 1B41A 1BU5A 2FUKA 4JA0A 5KTKA 2QTMA 4TZ6A 1GSIA 2GZ3A 5LJIA 4FTWA 3ZWDA 3D64A 1PLKA 5E9WA 3U44A 1N3BA 4KVGA 5FNVA 2ADFA 3G0GA 4RZXA 5I01A 3ENWA 4MDHA 1OC2A 2XCIA 3LSYA 4M49A 1SR8A 3LBNA 4G41A 4OHOA 4X8MA 1L5NA 4R8MA 5HZMA 5I9MA 3I6QA 2FSUA 1N2OA 1JVBA 3B9BA 4B9EA 2P6UA 1D1PA 1CF4A 4A1FA 3D6UA 3NOOA 4DPMA 1ES9A 2BOVA 1LNQA 1NATA 4D41A 4GR9A 5CXUA 5KAMA 1QE5A 4XYLA 1QIFA 1W1UA 3F6YA 1SWWA 4OMDA 3LT4A 3OLYA 1CP2A 4U0JA 1SIBE 2JZOA 2Q1SA 2G70A 4PTYA 4F86A 2E4VA 2HSEA 2Z83A 3AF0A 5H4HA 1TJYA 2W8BB 3IV7A 1Q16A 2H1FA 3SCZA 2VUTA 3VO8A 4ZGWA 5AUOB 2XHEA 1EWRA 4BNDB 1J7KA 3ZIUA 3S1SA 4NZNA 3ROFA 2Y1LA 4M7OA 2YQ5A 4DMGA 3WXBA 4DMRA 1ULHA 1CY4A 4OJMX 4JQYA 1MF7A 3AETA 4PF1A 3JAWA 4R8LA 4TTIA 3AWDA 1NZFA 3L7NA 5IKMA 2V58A 5DRTA 1RYNA 5JBQA 2IOFA 1X80B 2W93A 1VHDA 1BX3A 3ACCA 1GGHA 1U8YA 3DAPA 3I72A 2PQ0A 5I5GA 3EXG1 1QHHA 5GY7A 3RC2A 4B3FX 2I6UA 4JLKA 1NBMA 1XTJA 4J1TA 4CQNA 3N87A 4AL4A 2PFGA 2G40A 4P36A 2FF7A 4YCAA 3D2BA 2IS2A 1FFHA 1OI2A 1Z2DA 3R7AA 5H9WA 1QTRA 4JT9A 1GRRA 5EJEA 1G8SA 4DMMA 3L04A 4U7JA 3ZGLA 2IH5A 4N03A 4AZSA 4HDRA 1Y4UA 4BKOA 1Y5RA 1YKFA 2O2DA 3GA7A 5DW3A 2W70A 3LOQA 1OTXA 4B7UA 2Z43A 1JLKA 1QE0A 1C9NA 2VF2A 4HEA6 1KYZA 1JSCA 2DPGA 4NAUA 3EHDA 5AD1A 2Z95A 5KPJA 1Q0RA 3LT5A 4M7PA 1WMEA 3FNQA 3B89A 5EZQA 1GPAA 2H11A 3W05A 2JCBA 5C0OE 4CR7A 4YYZA 3EJ6A 4M1TA 4V0QA 2Z04A 2WF6A 3K6RA 4RVHA 3CY6A 3U0BA 4MUYA 2VHQA 2X1LA 3E18A 3L4KA 1GZSA 1PCXA 1VYVA 4GZ6A 1D2MA 1U0LA 4M1OA 4RSMA 5ELLA 4JI5B 2NTNA 3KOOA 4MITA 4UM7A 1GDDA 2XNCA 5C8YB 5K4GA 1MFPA 3ID6C 2A84A 4I50F 2JBHA 1OZAA 3L4BC 5GPBA 1TLFA 3IIKA 3ZCPA 5A02A 1IZ0A 4I9NA 1QG0A 4K2HA 5A9SA 2D0OB 1WZCA 4RX1A 3CLHA 3KJEA 2CBGA 4IH1A 4UCFA 2YR0A 1TVEA 2IKSA 1ESCA 3WDKA 1E9DA 3HYCA 5TPZA 1KDYA 1AKEA 5ICSA 4Y1GA 5IWAB 5CIWA 1YS2X 2WIBA 2JLUA 2Y76A 3PQEA 4XUEA 2NVUB 1G6Q1 1W0CA 2DE0X 1PT9A 4J9VA 2X15A 3CUUA 2WOJA 2J5KA 4P4TA 1HDOA 1SA0B 4EHDA 2X9QA 2WA1A 1JAXA 2AZ4A 1YQQA 2GPBA 3ZIAA 1LPBB 1UK6A 1WXXA 1LSJA 2HLNA 5JD3A 1DDGA 1GPH1 1RBZA 1Z2PX 2H63A 3LCCA 1IK6A 3R7LA 3WKCA 3DMPA 3QVGA 3NBKA 3LCVB 3RHTA 3RS8A 3UJ7A 3LG2A 1XZKA 2ID8A 2PWAA 3U09A 1R0BA 1GR0A 2HCRA 2OCPA 3OIYA 1EDZA 1KP2A 1FYWA 2KMLA 3Q6NA 2QUKA 5FBKA 5C34B 3TOCA 5JHGB 5E6RB 1E1QA 4IDAA 4FUTA 2HJHA 1T29A 1V9SA 4KNVA 4OMUA 2XQIA 5DHQA 1BVUA 4CHTA 1VBKA 1OFUX 2WG0A 1Q1EA 4CM9D 5HM8A 2Y1WA 2YKGA 1Y8RA 5FL7D 5J5AA 5J47A 3CUSA 4B17A 2IT1A 3KTOA 1G21B 4GD3Q 3WG9A 4B3RB 3BMNA 4O1IA 2IC5A 3H5AA 4BMNA 3JXEA 4EBFA 4LF9B 1E1CB 3TW0A 1E2QA 4BLTA 3KT0A 5JMPA 4HB0A 3D2LA 3FNBA 4NH4A 2FH5B 1M8PA 1I4EB 4AROA 3R5KA 4HRVA 1KAMA 1XWWA 2HK8A 1W73A 2OM6A 4FOPA 3FYSA 4IS2A 4WXHA 4AT1A 4U7FA 1PJ8A 1WUYA 1GPMA 1KMHA 3E82A 3OTGA 3DV0A 1X7XA 4MH0R 4BO7A 5AQ1A 4H4CA 3G79A 3D3WA 4IZ6A 3ONDA 4A0FA 4B4KA 4EUNA 3NWPA 4F46A 3AVTA 3S6JA 5ALYA 4B4VA 3BSFA 1K75A 1QGZA 1QYRA 4Q3DA 2VRNA 3K0CA 2H29A 2O7VA 5DXFA 1Y1KE 3UAOA 1J8QA 4MZDA 5F98A 3W3AH 4P0QB 1WF3A 1HWYA 1A71A 2C5FA 1YA4A 3OA2A 3TE7A 2WJYA 5DCLA 2ZSUA 2GVZC 5CB8A 1IY8A 4GKBA 5KVCA 1SVOA 2WQZA 4Z9YA 2XWSA 3GLFA 2UVQA 2PUVA 3P9IA 1L8XA 3WJ2A 5IJ0B 2NZ8A 1YDMA 2REQA 3GGOA 4X1KA 1ZJWA 1DC6A 1QH8A 4PNPA 3TGLA 4CF6A 4PSDA 4JENA 2ZJ2A 1UFKA 3KDSE 2HK9A 4JJKA 4YPVA 1ZLYA 3DE7X 3TPZA 1EWVA 5H8WA 4ETIA 1SUCA 3B3GA 5I4CA 3S81A 2CBXA 2RI6A 2G9VA 3I2IA 5EE0A 1A4IA 3UMMA 5HDQA 5IT5A 2ZB8A 3K5HA 3UAVA 2YIJA 3OM0A 4ZGGA 4XX1A 2LWIA 1O6FA 2QM3A 5ALDA 1P77A 3JWIA 2F3RA 1XLTA 2G71A 3NV9A 2YZGA 4G97A 4BC1A 3VYSB 3JV7A 5IAJA 4QGFA 2G1PA 1FX1A 3R0VA 4YHHB 3QM1A 4KYIB 2LW7A 3V2HA 3EIXA 3QF4A 2JLVA 3CX7A 2WJHA 1KIMA 1V37A 1A4RA 1T36A 2IYVA 4DIFA 1QH1B 2ZT6A 2QV0A 1M2KA 1NQUA 3FTDA 3AEZA 4FB5A 2GS9A 2NV2B 1E3JA 1GQYA 5GP1A 5LQMA 3OHPA 4Q02A 4KUEA 3T5DA 5TNXA 3Q7QA 5LZ2A 1B0AA 5A3QA 2IEDA 4JR2A 4PCVA 1Q3TA 3GVPA 3MIIA 2PCLA 4AKSA 2P11A 3QLJA 3SC3A 1G1MA 2AMJA 2WR8A 1AGXA 1ZAYA 2PBZA 2WT8A 3GDGA 3I34X 2RHTA 5EMJA 3ZWWA 1KQFA 3VDQA 1TMOA 4NRDA 3VPFA 3GLHA 1KKMA 4E1VA 1Z6AA 1N75A 5JBNA 4FUQA 2XIJA 1XPUA 5KINB 4NR0A 4WNAB 1EM8B 1U8AA 4U7TB 3PEVA 5CYOA 2V0GA 3V4RA 2NSDA 1AKTA 3AR6A 5TT0A 3D3KA 3BAFA 2AN3A 2GHIA 3UAXA 1VGRA 3RO7A 2W2QA 1ULSA 2GOYA 1EQUA 4NDNE 4Q66C 1KMQA 1K89A 4QYMA 1JH9A 4LX0A 2IFTA 2GYUA 2H1VA 3KL4A 4C07A 1DWOA 1Q0SA 1TEHA 1KZ6A 1C30B 1L3CA 1C9DB 3WFIA 1AUXA 4MLDA 1F8UA 4G0MA 1QMGA 2IA5A 5ALXA 1U1CA 2BR3A 3HKBA 4NYIR 1J8VA 1GL6A 1UXOA 3H3JA 2XTNA 2H57A 4GLLA 1JSLA 3FUTA 3DEIA 1CR6A 4C21A 2P0YA 3D8NA 5DNWA 1EHCA 3A14A 3VU9B 4QFDA 2WNHA 3GMIA 1QPGA 3ZXIA 3AP1A 4K6FA 5EIOA 4TZKA 4FYKA 1AS0A 1E0JA 3QNMA 4PHGA 2HX1A 2PIAA 5IKOA 5NULA 5IYZA 1R8QA 3VJRA 1E2JA 3L4JA 1XYYA 1G8PA 1GUBA 4BDTA 1H2HA 1VBFA 1W87A 1BDMA 1MAVA 3GJ4A 2PSFA 1DLJA 3OCYA 4A2WA 4F3TA 5JAUA 4BLWA 1KXJA 3EXHA 2RB5A 4UD6A 3LWDA 3OEHD 4I81A 4UBJA 1KHTA 3ZJ5A 2IH4A 4JVOA 1I7DA 5C4MA 3EOBI 2NU8A 5C7LO 1USUA 2AKEA 4FDVA 1P2TA 4R2JA 5BQ5A 2W2PA 5AJZA 5F3DA 3ZVMA 4RAQA 4XFDA 5LZ7A 2E85A 1MOQA 5AI6A 3VR6D 3AKZA 2XADA 1A1SA 4MV0A 5AUQA 4HPXB 2RK3A 5C53B 2Y1FA 1NVGA 2R6JA 3NC0C 5T6BA 5CLLA 1KZ7B 4LPKA 1DJQA 2Y0DA 3E3AA 4E2ZA 4M6WB 3U48A 2VF5X 3BCSA 3ZE0B 2EGGA 4LV8B 4F4IA 2W43A 5J2TF 4DV3B 2WAXA 2P2DA 1PR5A 4QDTA 2IYXA 4W5WA 4Y98A 4IP0A 2ZFUA 4YJGB 3FB4A 1A82A 3FROA 3I42A 4EUEA 3R3HA 2XDQB 1N2HA 2JRLA 2OFWA 3OQMA 4CETA 1N33B 2Y2VA 2R62A 2ZE5A 1LQUA 2ZAOA 4C6TA 4PPNA 3H13A 3UMCA 2GSWA 4CMIB 2MSWA 4IRXA 1QNLA 2FEMA 4ZEOA 5LOVB 4JNKA 2F8SA 3B5EA 1R9JA 1XTPA 4IDHA 3LNTA 4YT4A 1TQ4A 2YVKA 3H9GA 1D8TA 1NN1A 3JARA 4OM8A 5EESA 3SIPA 1VMDA 4A1OA 1T9AA 1DEXA 1UDBA 3VO2A 4CM4A 4DC0A 3TPCA 2GTIA 5FOXA 4S2UA 3C3KA 1XZMA 1PF7E 3AIIA 5E6SA 5ICEA 2CW5A 5JAIA 5AVRA 4BAUA 1X7WA 4NESA 1DKPA 4UXJA 5FULA 4BP3A 2K2WA 2Q0QA 3AUFA 4V0RA 3A6PC 5MDHA 4KQJA 3QUSA 1ZL0A 1Z6XA 4OB6A 1DMRA 1SEPA 3TJRA 2F64A 1YDEA 1IY9A 3UUGA 4YDQA 1ISJA 1FU7A 3TKYA 1C80A 1K8XB 5C8XA 2X0NA 3JALA 1ECBA 2BE9A 3MTEA 2CFIA 1MR3F 4FS8A 4M4SA 3I2KA 3O5AA 1OTHA 1CV2A 2BEUA 4IHJB 3H9JA 1AQUA 1D6NA 3ET4A 3NYWA 3DNMA 4WBSA 3LM8A 2C2WA 3R5FA 1E4YA 1JHYA 4ZO7A 3EDRA 4FINA 2PMWB 4D80A 3FLEA 3FOEC 3AH8A 4D56A 3ELBA 1QGUB 2CL6X 1TTHA 1KS2A 3BEDA 5J63A 3WDSA 4BFVA 3GI1A 3KWLA 4EG0A 4DV1B 3C3CA 3R1IA 4JYPA 5HQJA 2XV1A 1B93A 4I5EA 5CCBA 3ESYA 1ULBA 2NW6A 2BKXA 4LBVA 3OUZA 3WL7A 3TLCA 2BFNA 1PV2A 2HREA 2Z8YA 2LR0A 3PNKA 5A3VA 3ZHCA 4UXHA 4NJEA 2JFUA 1BW9A 2JNWA 2XYRA 3DEHA 1P91A 3H97A 4L57A 3GMTA 3UAWA 4ZYWA 4Q37A 5KYXB 3NWBA 3O9ZA 4DBLC 1IXZA 3V8MA 1KA9H 5AI5A 1XKLA 3BYZA 2WU4A 1WCIB 4GPEA 4HR7A 4L08A 1XSEA 1RQGA 5ALMA 4B8ZA 3CZMA 3AERB 4EQ6B 4NVRA 1CRQA 4PLCA 5D87A 2C9ZA 5DU2A 3RSZA 3PGA1 2XW6A 4I4TF 1OE0A 4J8PA 1L5LA 2ECOA 1F38A 1TU4A 2R48A 3UA4A 1E1MA 4ZOLA 3W8RA 2YQZA 3NAQA 1G9SA 4P3PA 3VKFA 5BT8A 2NU9A 1ARZA 3Q2KA 3P0FA 3FRJA 1XAJA 1GPJA 1OBVA 1KOLA 3MOSA 3VPBA 1N9GB 4B3IA 2WILA 3JAKB 1WWKA 2PKEA 1X1SA 3I12A 3L4BA 5DOZA 3DB1A 3DO5A 2NZJA 2QUHA 2DRIA 2C78A 2ZJ5A 1OWNA 2D00A 2HMUA 5HPYB 3WV4A 5BR1A 4D44A 2G0TA 3ZBPA 4ZK2A 3SAJA 4Q1AA 4Y6RA 3QZUA 4CMBA 4CEIA 2X0EA 2JJQA 4URXR 3PK0A 3AM4A 3CE6A 5CPBA 4IIDA 4LOIA 4UNQA 3TBFA 4BGIA 4ZICA 1MFZA 1Y9AA 1WPXA 3WYAA 1O0CA 3KJXA 3OKAA 2CE2X 2YZ7A 2IIPA 3KKQA 2WFLA 4XDHA 2V9ZA 1V4BA 3F3KA 1A2BA 1JJVA 1KZ9A 1JIJA 4YRSA 1P6UA 1QTIA 3BTSA 3G7SA 4JLPA 3KR0A 3THWB 1QZTA 3MCZA 4GZ5A 2GSDA 3P9RA 3WDLA 4EGJA 3ABZA 3GU3A 1IBRA 1ZA1A 1SU4A 3NBFA 4EFNA 1ZSVA 5KYGA 2VP5A 5L3RA 4DMKA 4P7BA 3AF6A 3KIPA 1Z12A 3KWJA 2BI8A 5JS8A 4TKMA 1JPJA 2EKZA 3PD0A 1IBMB 1YL6A 1Z68A 5JVDF 2CF6A 2FLVA 1Q0UA 3GH3A 1DAFA 3U1BA 4FWTA 2Q49A 5EXTA 5KYYA 5HVNA 2BFFB 3WQBA 1VGQA 1Z33A 4B4WA 4DBLE 3L7DA 3M6VA 1P7PA 3M6LA 3RJ9A 4IR7A 1HH4A 4PG5A 1DU4A 4EFKA 3UMJA 2IOQA 3QIVA 1NW5A 1Z06A 3NDRA 4BMZA 5KNBA 1P1BA 1LBTA 2XPCA 3JATB 3PNPA 5GONA 3AVVA 2J3EA 3C4QA 5DM4A 3BERA 4OJQA 1KE2A 1OXBB 4B6OA 2YDXA 3BB4A 5HKAA 3QBEA 2GCGA 2QL5A 3DJYA 1PWYE 2B0JA 2QD1A 2R87A 1KRHA 4BNWA 2WWGA 2EEZA 1T3SA 4LG1A 3SOZA 2GBFA 3BREA 3BM5A 4BFUA 1F12A 4FDMA 4FZVA 4OO3A 1V1RA 4A5OA 5KOJB 3B1FA 2RGBA 4BNFA 1TO1E 4LF8B 5DASA 4JI6B 4NDAA 4CU5A 3ER6A 1V71A 4A15A 1E6KA 1WUJS 1MIHA 1RRFA 2PGLA 3EGDA 4X00A 2VYND 1GTZA 2QTVB 3BK7A 2AN9A 4ZALA 1ESMA 1QZ3A 2PX8A 1A2OA 4I0WB 3QWIA 1CJBA 1X7ZB 1J49A 1N2CE 4W7HA 3QU5A 3EARA 2XNSA 5CGZA 3VR4A 1SC3A 3RIEA 8ATCA 5J3JA 4WXYB 4YAOA 2EOAA 2B83A 5B3KA 4QJ3A 2W90A 3ONNA 2QI9C 1R00A 3HP1A 3OSUA 3UHAA 4IFIA 2IHTA 3OZ7A 1NFRA 2PZMA 5EN4A 3MHTA 4N3BA 3RK0A 4O6VA 3C97A 5BWBA 1ZGCA 3A3NA 4X65B 1SXJA 3E0XA 3KZVA 5LA6A 1MXHA 2FAXA 2BBSA 1DTWA 2ZUVA 4EWLA 1WOMA 1RQPA 4QD3A 3ENNA 1PJLA 4H4EA 1C50A 1XLWA 3LLSA 2A0UA 5MN5A 2WU1A 2IYNA 1WDWB 5EIEA 3FUWA 1T6ZA 3X3HA 2VLBA 2WDZA 3HCEA 4ZO9A 3C1UA 3T4UA 3SYLA 1W85B 1AO0A 2RJOA 1QKJA 2R2GA 4KN8A 3A1DA 4Q9HA 1A9XB 4PCAA 4PHCA 4ZVQA 1T5HX 5BNZA 2QMYA 3I0NA 4MYTA 2VC2B 3JVDA 4GXNA 2WJZB 3TOVA 3NAGA 3ZBUA 2DCMA 2QGZA 5BR7A 4KLZA 5BN1A 4O2BF 4QNMA 3JZFA 2OWEA 5EZ5A 1XWIA 4WKPA 4UFPA 4DV4B 4BBZA 3BGWA 1X1DA 1U3VA 4N39A 4DOMA 3LXRA 3SBXA 2FPWA 5FWXA 4OU4A 3SZMA 1LZLA 2I8CA 5TMEA 4WN9A 3ZI4A 2CXOA 1PQUA 1X15A 1PVVA 4BKMA 3U6BA 3RS9A 3UMRA 3G89A 1Z29A 1KI6B 4OQFA 3VTAA 1E20A 5BQOA 1G3RA 2FJ0A 3QF7A 5AIAA 3VYVA 3UATA 1T9ZA 3AB7A 2CNWD 2HMSA 3O7WA 4EEZA 1L6IA 2EARA 1KFCB 1VSVA 3C14C 1WSBA 2ZUUA 1PT7A 3P2OA 4H7FA 3TIGA 1M2VB 2AMLA 5TQ2A 3R7SA 5LNK6 3B20A 3UPDA 2B2NA 4JLJA 5AICA 4JUCA 1M8JA 2D1SA 4RYDA 1GLVA 1CWUA 2AD5A 3AFNA 5FDFA 1ZFNA 2EDCA 4IINA 4JLAA 2Y68A 4AY4A 4HMQA 3DOEA 1WY7A 3P0HA 1KHHA 3VZSA 4EYOA 2ON6A 1VM6A 5L7TA 2GA9A 2Q0XA 3C24A 1GPKA 3KXLA 5CDGA 1BHQ1 2QL6A 2GKOA 2PSJA 1A96A 2IL1A 2OV1A 4RY0A 4YRQA 1GTG1 1XAGA 3I5XA 2HPVA 3O4FA 1TYDE 1VG9B 1WV1A 2C04A 5FNVF 3VZDA 2ZJ4A 3GFBA 4YRZA 1LRJA 2Y1OA 3SJAA 4TXNA 4AJ2A 3EGOA 4RIGA 5KTPA 1KBZA 1ZLXA 1TGVA 4Q4AA 4X90A 2J4DA 2AKAB 2ZRGA 4H3KB 2CHUA 4FNAA 1AH2A 3H87A 4IEEA 1A7UA 2EZ9A 2QYOA 2Z2IA 2QXUA 5HFNA 1NXQA 4MV6A 1GT6A 2FK7A 3E9DA 3R77A 2X3UA 4FIDA 4WZBB 4M21A 5THXA 4CG2A 2PMBA 1DC7A 1YF3A 4B3MB 4IDEA 3EXEB 1P8AA 4X71A 1RZRA 4UAVA 2PL9A 2Z58A 5CFLA 3CLKA 5MGBA 2Z2XA 5JI3E 4CEHA 2R85A 5KWSA 3Q6MA 1XL0A 2R751 2RMKA 5DEOA 3TIVA 3V1UA 4MWSA 1K98A 5FIUA 4AIRA 3LPCA 3VISA 3KQOA 3ABOB 1AXRA 3BSSA 1VLMA 2I4NA 1NUPA 3PFFA 3PQ4A 3MS7A 5SZKB 4DCPA 3QUQA 4LSWA 2W6ZA 4XWAA 4CLRA 4RZHA 3ZEIA 1EX6A 2IBMA 5B37A 2H2HA 2II6A 3GNSA 4N40A 1AE1A 2QJRA 1HTTA 1T1JA 2LIVA 1GV1A 1UIMA 4CVNA 4IH9A 2I2WA 3GRRA 3H11A 3I4FA 4L4UA 1XXHE 2FPRA 3Q3JB 4PS0A 4RELA 3T1QA 4J4HA 2P7IA 3V8EA 1VLVA 1MVNA 3S3TA 5GINE 4EHIA 3DBOB 3T61A 4C4YA 1BJTA 1FFEA 4H77A 2IOHA 4IGFA 3KYIB 3D7NA 2IF0A 1SUWA 1TRHA 2V74B 2YV3A 3P9PA 2Y93A 1P45A 3UANA 4URWR 3W1EA 3UT6A 4KK4A 2J9FA 2YV2A 4WJLA 3CLUC 4KNYA 2DWQA 2QG4A 1C0PA 1YBAA 5EJAA 4OHZA 2WMYA 2I3AA 3CTMA 3L0SA 2B35A 4CDMA 1PP4A 2AZDA 1Y48E 5L4LA 5A4DA 5TF0A 4GWKA 1Q92A 3CKMA 4MQ6A 5GTDA 4GMXA 2CJYA 1TF7A 1J8DA 1UPXA 1RLTA 2GJKA 2JLZA 4YRMA 3P9YA 3QKIA 4MW4A 2AEMA 2W4IA 1MQAA 1ZK3A 5BSUA 2P90A 4FD2A 5BMVB 2G0NA 3QMVA 1M6YA 1PR4A 3MTJA 3UV6A 1BO6A 1DCTA 5FUXA 1F7UA 2IUYA 3VNVA 4D5EA 2QBYB 2ID7A 4RD4A 3TX6A 1JSZA 5B3JC 2WT4A 4MEBA 3RD5A 4ZI7B 1QONA 3JRNA 3EULA 2GPJA 3EIFA 1XRSB 2ANCA 2QTRA 2DHEA 3C5HA 4YTEA 5FUYA 4D3YA 4EOGA 3W5SA 1IOLA 2VP9A 1I13A 3C43A 4K9OA 4GPTA 4LXGA 4N5IX 1LS1A 2FUEA 1J23A 2A4KA 2F9FA 4QTTB 2GN8A 1YQEA 4UE6A 4RTJA 1YS7A 3CUKA 1TUBA 2FPOA 2VNJA 1M76A 4M2LA 3ZGZA 5EG5A 3PQ6A 2GCOA 3EB9A 3EFOA 4G4SO 1VL8A 4UBLA 4Y2GA 3WO0A 4TXMA 1J06A 1KU0A 4L9WA 3N5CA 3PG5A 3BXEA 3NT5A 3PVSA 1JAZA 4KXMA 1G16A 4R3NA 1SVWA 2XQGA 3WNBA 1PSWA 1JHDA 5F2NA 1E60A 3FE2A 1YC2A 2GD2A 3I53A 2Q0HA 3KYDA 2JAPA 3ZW9A 2XWPA 3O74A 1XTTA 3IAS6 3OPYI 4FT4A 2PT5A 4TLAA 2XUOA 3PPIA 1LVHA 3IR5A 2X0FA 3VI3B 1UJBA 1X38A 3KQNA 1HE4A 1L4MA 2HFKA 4ZQFA 3O2NA 1DBWA 3D4LA 3OIUA 1EIWA 3CLTC 1HSZA 1I3KA 1NM5C 3FSJX 5IJZA 2H59A 3TD9A 1WCWA 1LJUA 5DTEA 3DYIA 1N6RA 3T3EA 4OIFA 3KQPA 2D06A 3FDZA 4MIOA 3KOMA 1H8HD 1ENZA 1T5SA 2OCGA 2H2IA 3F1LA 5TPZD 3ZHQA 2VS1A 4B73A 4DE5A 3O8OB 4YFYA 2VOJA 4KREA 1KFEB 5ERGB 2QX4A 5ADHA 1NDUA 3RUCA 4KH0A 5SZIA 1UC5B 4HVCA 5LD2C 3FOBA 1R0KA 3D9QX 4BWFB 1F8GA 1KDTA 3BZWA 4BN5A 2HRDA 4C4AA 7ADHA 2VRCA 1P1IA 2NO6A 3GH1A 4QOIA 3NANA 1ONNA 3ZC3A 1MAUA 3ORQA 5L3ZA 3G2OA 4G4GA 4F6RA 1J0DA 3PIRA 4KVFA 1JHZA 3VMMA 3LLCA 4LVCA 5FI5A 5GJVC 2ENUA 3HEAA 4C1BA 2UXDB 2HJSA 2EZUA 1WUTA 3GBVA 1Q7TA 1V3QE 3AG6A 4L5IA 2VQSA 4HMOA 2P9YA 2Y1XA 4ABYA 3D0QA 4BP9A 2CDCA 3GLGE 5TDHA 3VPAA 1P3JA 3W8NA 1BX0A 2NQ8A 3LTEA 3HCAA 1A97A 3CLSC 4RFLA 5K01A 1P7YA 2P9ZA 5DBEX 4F9EA 4JAVC 2AX3A 1PFQA 1IJKA 2A67A 2J0EA 2O2IA 3FW1A 2DQSA 4DLNA 3CCCA 5CVVA 2OQVA 2UXBB 1R3DA 3HO8A