4M49A

Lactate dehydrogenase a in complex with a substituted pyrazine inhibitor compound 18
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
331
structure length
331
Chain Sequence
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of 2-amino-5-aryl-pyrazines as inhibitors of human lactate dehydrogenase.
pubmed doi rcsb
molecule keywords L-lactate dehydrogenase A chain
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Homo sapiens
total genus 116
structure length 331
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4m49A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4m49A02
2WYWA 2DAPA 3U0BA 5A9RA 2EF1A 3PJEA 2DQ4A 3RBZA 3DTTA 1W6UA 2Q2VA 1VM6A 4PZDA 4QFDA 3OIGA 4R1TA 4R54A 3H9UA 1ULSA 3F6YA 3FR8A 3KEOA 1QLHA 2ET6A 1HKUA 3I9KA 5AXBA 4NFHA 3O03A 4AFNA 1ORRA 3F47A 2WDZA 1LDGA 1G0NA 4JBGA 1T2CA 1I0ZA 1B26A 1EE9A 3VKVA 4B79A 3RAJA 3NDJA 1V3UA 4QFCA 1IZ9A 3RC2A 1RJWA 2FOIA 5HA5A 4OM8A 1JTVA 2GLXA 3CMCO 4N54A 3RUHA 4RVFA 1HXHA 3INTA 4YWJA 2VT2A 5F3RA 2X0NA 1J5PA 1RKXA 2IEBA 3WQQA 5IDQA 2V6BA 4GBJA 2PD4A 4DYDA 5LDHA 3AK4A 1R0LA 4HXYA 4L8VA 2VRBA 1YWGO 2IZ0A 1SOWA 3OICA 4BKPA 1HE5A 1YOVA 5CPBA 4UEKA 2Q46A 1Q2XA 2CF5A 2IXBA 2NLOA 4HP8A 3ITDA 1GZ6A 4DBZA 3BZUA 3OIDA 3X2FA 4C7JA 2JHFA 4I5GA 3O8QA 1LXCA 3B70A 2C2YA 2E4AA 3LT0A 3RC1A 1TT5A 3GAZA 4MP8A 4DMMA 5I7SA 4II3A 2DM6A 4R5MA 5K0ZA 1NWHA 1IUKA 3QA9A 4E13A 4FD3A 4E5PA 2O7SA 3JQ7B 1NQTA 2A35A 3ITKA 3PLRA 3S2GA 2JD1A 2OP1A 3H3FA 4OGWA 2OP0A 4AVYA 1U1IA 3P7MA 4FOOA 3S1LA 3OA2A 3JQAB 1T2FA 4BKUA 2X5KO 5DN9A 4ZD6A 4Z3KA 1DFIA 4RORA 2VYVA 3TN7A 1GUYA 1R66A 4PG8A 3BMCA 2J3IA 2J3KA 4WGGA 3VZQA 5ILOA 4UVEA 2GCGA 3IC5A 4AJKA 1PIWA 2PA3A 4RCVA 3ZU2A 3PYXA 4YAGA 4ZQEA 3NX4A 2ILTA 4B7CA 5U1PA 1P1FA 1KIFA 2X4GA 2X9NA 4NBWA 4B3IA 1WDLA 5C5IA 3EYWA 3SXPA 1EVJA 2RH8A 3T4EA 4JIGA 3VOSA 1ZMOA 4BUCA 4AJEA 1Q7GA 1LLUA 1CJCA 3ZWAA 1ISMA 1DXYA 3JD3A 7MDHA 3QVSA 3I9NA 1ONOA 4DYVA 4XB2A 3KYCA 3I83A 2Y1GA 3DBLB 4XGKA 3H9GA 3LC2O 2HMSA 5GZ3A 1KY4A 2YFHA 4CM8A 3L9WA 1PS8A 2H6EA 3C1OA 4YT5A 4FW8A 4IS2A 4E2ZA 1I33A 2A94A 3KYBA 2C7VA 1PWZA 3JQAD 1LEHA 3GEMA 3UCFA 1QSGA 4TWRA 4PLWA 1Y8QB 4CV3A 4EJ6A 1QG6A 3C85A 2BI8A 4YCAA 5T64A 4UUNA 2OXIA 1P1RA 4J7CA 4ZQGA 1Y7TA 4GPD1 4LCJA 5EPOA 1NTOA 4A26A 4DRYA 1R4MA 3A06A 2FR1A 4YYZA 3OBBA 1UZLA 3H4VA 2I5PO 4RVHA 1MX3A 2NQTA 1ZK2A 4AJ2A 1TXGA 1HRDA 3VPFA 3CMMA 1AXEA 1JQBA 3U09A 3G0OA 1OC4A 3GFBA 4BNXA 3RKUA 4YJFA 2J8ZA 2HK7A 5G0TA 3ZWNA 3BHMA 1B14A 1XELA 3Q0EA 4CM7A 4Y98A 3ZH2A 2ZQYA 4TROA 3FNGA 5C3MA 5EESA 2RHCA 3CINA 4QO7A 1WDKA 4HNHA 3E5MA 3ANNA 2XXBA 4XQ9A 3ZCXA 1SAYA 1E0DA 4EI2A 4CUZA 1SNYA 2P68A 3ABIA 1OI7A 3RD5A 3ZWVA 5JDIC 4IDBA 1GU7A 3D5TA 4K9DA 5B37A 4DLLA 1C0KA 4BVAA 4L73A 8LDHA 2G1UA 2GZ1A 4ZRMA 4L4XA 4H7PA 4F46A 1FDTA 2CDBA 2BLLA 4HWKA 3DAGA 4CM4A 5FEUA 5BQFA 2EKQA 1PTJA 2NQ8A 2PZKA 3RASA 4DA9A 5KKCA 3BMQB 2CZCA 1P31A 4J43A 5DP1A 1DLJA 1E3EA 2CY0A 4EJMA 4MPDA 1KEUA 3WS7A 4OMUA 3BMOB 2YV2A 1O0SA 3BTUA 2VRCA 4BQPA 3EDMA 2F1KA 1ZEJA 1OC2A 4MO2A 4CMIB 3DBHB 4NFSA 2CVOA 3B6ZA 5A9SA 1GYQA 4XQGA 2ZIZA 1UZMA 1DIAA 3ZWOA 2OHXA 2WE8A 1BXKA 4CM1A 2OL4A 2ZKLA 3INRA 1SMKA 4OOEA 3FPLA 4P8RA 4ALNA 2GO1A 2EERA 1SC6A 5A05A 1TI7A 2BRUA 1H2BA 3L0DA 3ZNOA 4YQYA 3E6AA 1ZK1A 4R41A 4B8WA 5TNXA 2F00A 1B16A 3STHA 3LDHA 4NU6A 4RF5A 4E3ZA 4MVJG 3LT1A 4ALKA 4YT8A 3JQ6A 5I7EA 4OXYA 4OOFA 1FXSA 1XQ6A 2AMFA 3HSKA 2GR9A 3L4SO 3O4RA 4TRJA 3I4CA 3D5QA 3FHLA 5A1TA 4PRKA 2VYNA 2D5AA 1GUFA 5L7TA 4MIEA 2PWZA 4YAJA 4I9UA 4MVJD 1NVTA 2X22A 2D8AA 3AFMA 3G1UA 1ZK3A 3ZWWA 1E1NA 3VPXA 4R1UA 4BO3A 5BSEA 2ZYAA 3DAFA 2W2LA 1JLLA 3U9LA 1ULUA 4E4YA 2DBRA 4PLVA 2P5UA 3ZI0A 4RVUA 4DTIA 4BIIA 3AOEA 5KJFA 3VZPA 4NK4A 3AM4A 2FWMX 1YKFA 3FNFA 2J3JA 3AY7A 4BNVA 4ND3A 3FR7A 4TRMA 4TZTA 4BO4A 4ND4A 1YL7A 3PJDA 4QUKA 4MVJF 3VZSA 4ND1A 3WJ7A 4Y6SA 5I7FA 3DR3A 3H8VA 4U6QA 4GX0A 4QQRA 2UV8A 2B4TO 1EMDA 1HYHA 4MJLA 1KOLA 4Z0PA 1KVQA 3IS3A 1OOEA 3PLNA 4FFNA 1I2CA 5DNAA 3DMYA 3KV3O 4LVCA 3OJFA 1HL3A 1MP0A 4XX0A 2GRAA 2NM0A 1A72A 2VZ0A 3GDFA 2C5EA 3GA0A 3V2UA 2R00A 3KEQA 1I24A 4YTEA 3BYZA 3OQBA 4BO5A 4U8GA 1GYRA 5KVQA 2DBZA 2P9CA 3NGXA 4GH5A 4KQWA 4FCCA 4CLRA 1E3JA 4XQEA 4RPJA 3RC9A 1ZNQO 1M76A 1I2ZA 4OYRA 5JCJD 2EJWA 1SPXA 3F9IA 2QIOA 3AI1A 2FMUA 4W7IA 3V2HA 1NFRA 3DFUA 4PIVA 1M66A 3MJCA 1LNQA 5JS6A 3OJOA 2X7HA 4LVUA 1N2SA 2NVUA 1JDJA 3KETA 4H3VA 1GADO 3GQVA 2HMWA 4CMKA 1FDVA 4JJFA 2JHGA 3I3OA 1N1GA 1X7DA 3AU9A 1LRKA 1QYDA 3IDSA 3NKLA 3RFTA 1K6XA 1HF3A 3KLMX 5EINA 4CQMB 3EHEA 4IUYA 4YA6A 3TFQA 1J0XO 3GZNA 3KBOA 4PGFA 4ZA2A 1ZSVA 3AI3A 4YQZA 3LT2A 4DXHA 4U0KA 2O3QA 4O1MA 2BFOA 5TJ9A 3HDQA 4N5LA 3NGLA 2GN6A 3TOXA 1D3AA 5A9TA 1LA2A 5G0VA 2Y99A 2NACA 4LGVA 3QVTA 4RDHA 4AJLA 5JY6A 1C1XB 3H3JA 5IF3A 3JD4A 3NJ4A 4B3JA 3GAFA 5KJEA 1QRRA 2VZ9A 3PDUA 3EGOA 3K8ZA 2TMGA 3E5RA 1NP3A 4QEDA 3N74A 1HEUA 3FTNA 3MOGA 1TEHA 3GNQA 1Y81A 5L51A 4E5MA 3GG9A 4YPOA 5T8KA 3OJLA 1UH5A 1LLQA 1PZHA 4NBVA 3ONEA 1EUCA 3WDSA 3DZHA 5JC1A 3JQ9A 1HDOA 1A9ZA 1U3WA 1EFKA 4RF2A 1Z73A 3TWOA 3ASUA 4PLPA 3D3WA 1X7GA 1EFLA 2HCTA 3KZVA 3DONA 4FGWA 4G81A 1DB3A 1E3WA 4BNTA 1BHSA 4CQMD 1AE1A 4Z3DA 2PNFA 3SLKA 5JAIA 1NVMB 3NT2A 3ZWMA 1PGOA 4IJUA 4U6SA 2Z1NA 3RUIA 1UXHA 1ZIDA 1LUAA 4P38A 2RBEA 1PEDA 3H5AA 3JYOA 3L77A 1HTBA 4BV8A 4LSWA 1UP4A 5ER6A 3WMWA 2BI7A 3GEDA 5TLSA 4K1LA 1AGNA 1ZKMA 3KRTA 1I3KA 2DTDA 2J6IA 4NBRA 4CLOB 5TX7A 4CLXA 1XIVA 3JQDA 3GVXA 1E1KA 5DOVA 1PL6A 2RCYA 3GY0A 2B5VA 4IDAA 5H83A 1B8PA 4GQAA 1ZUD1 3ZHZA 4M55A 4BGVA 5BNIA 1LJ8A 3LZ6A 1P0CA 3CSDA 3R6DA 4N5MA 3ST7A 4NK5A 3WQRA 3K2EA 2Y68A 5CP8A 1CETA 4TMFA 2RAFA 1T1RA 4GKBA 1IB6A 2O3TA 2Y1CA 1GPDG 3N7UA 1Y1PA 1Y5MA 3QP9A 1L7DA 2ZATA 4X54A 3PQFA 4YB8A 5ILGA 1X0XA 4R16A 2G5CA 2P4QA 1GQ2A 1ADBA 1N7HA 3TL2A 1IHYA 4F6LA 1YJ8A 5JC8A 1N8KA 2WD7B 1NR7A 3H2ZA 4G65A 4J1QA 2X9GA 1XKQA 4N18A 5CDGA 1Q7CA 2GNAA 4XRGA 5F1PA 2HLPA 3LLVA 3Q9UA 5H81A 2FPGA 3QE3A 3VVCA 3IIEA 2HJSA 2H63A 1V8BA 3F1KA 5HWSA 1XU7A 3HUDA 4GGOA 5AOVA 3WGOA 1BDBA 1WP4A 3BXXA 2DKNA 1U28A 2NTVA 1EUZA 2FSVA 3Q2KA 3WYCA 3D64A 4KTTE 1LU9A 4YJHB 1ZK4A 3B1FA 4YDRA 1GR0A 4PRLA 1NFFA 4NDNE 2DU8A 5EL0A 1Z82A 1U3UA 4GMFA 1E3LA 2PGLA 4JROA 3CZMA 3Q2IA 3DEYX 3O38A 4A10A 2I76A 5ITWA 1BXGA 3L4BA 4GI2A 4PG4A 2ZB7A 1DEHA 1NNUA 1DIRA 1NYTA 4JX8A 1X0VA 2PKQO 4HBGA 5DOZA 1NHWA 1VSUA 2V6GA 2GN9A 3WGTA 3GZ4A 1OZAA 3UW3A 1P1IA 2WE7A 2R00C 4BNHA 2PD6A 4MOWA 3NYWA 1VL6A 2Q1UA 3K6JA 4PFJA 5KTKA 4DMLA 2BGLA 4IGEA 4PG7A 1U2DA 4PVCA 4Q9NA 4MIOA 4LRTB 1DC6A 3RIHA 1B7GO 1GFSA 2H5LA 3WOHA 2B69A 2O4UX 2PD3A 3OM9A 2C20A 4JK3A 4WLNA 5A5FA 1LTHR 1Y8RB 3U5TA 1IYZA 1E7WA 2UVDA 5JAZA 3LLSA 4CMJA 1WPQA 3JQBA 4WCDA 1LDNA 1NPYA 2X58A 4KDEA 3GR6A 4ND5A 2WEKA 1KERA 5GZ1A 4HADA 1AN9A 4R9RA 4HFNA 5EERA 5TF4A 2CUKA 1YXMA 3C8MA 1P45A 2X5OA 1KETA 3E03A 4EBFA 5IDXA 1YO6A 2GSDA 4FB5A 2VQ3A 1IZ0A 4MP6A 4EW6A 3FN4A 3L07A 4GX1A 4DL9A 5DCUA 1E1LA 3NT4A 3SJ7A 4XYLA 3GT0A 1F17A 1EBFA 3RUCA 4BNGA 1X1EA 1ZW1A 2IYOA 4PLYA 1HLDA 4BS9A 2VHYA 1EUDA 1VJTA 2EHDA 2QYSA 4FC7A 1LRLA 4CL3A 4HFJA 4D0SA 2PLAA 4GMGA 1LQUA 3TOZA 1EQUA 2OZPA 1WDMA 3SC4A 4CV1A 1T2EA 4IJVA 3QSGA 4ZICA 2PZMA 1PJ4A 1V35A 1U7TA 4RVDA 2FR8A 5T8KC 4BNUA 1HE3A 3GGPA 3VTZA 4NNJA 1E7SA 1PS0A 2HK8A 3DOJA 1YVEI 5JLAA 2GGSA 4YVFA 3JQ9C 5AXDA 4D41A 2B4QA 5B1YA 2HU2A 3F5QA 1D8AA 2C29D 1NWCA 2O3SA 3QQPA 4WCFA 4CM3A 4BGEA 5FF9A 1IOLA 1DPGA 1I32A 4BKQA 3PHLA 2I3GA 4OQZA 5FWNA 4G5HA 4EYEA 2CVQA 2I9PA 2ZYGA 4PN3A 1U4SA 4E2WA 1E6EA 2C54A 3GN2A 2XAAA 3RWBA 4WOJA 4FFLA 3TNLA 2JJYA 4RF3A 1BW9B 1YONA 3RBXA 7ADHA 1T24A 5BT9A 4DPKA 3VDRA 1VSVA 4NH4A 5A3VA 1P0FA 2W8ZA 4NIMA 1JA9A 1DC5A 1SEPA 3PJFA 3WTCA 3BTOA 4P4LA 1YRLA 2O4CA 2CFCA 1VE9A 3WSVA 1PZFA 2HQ1A 3ENKA 3GOHA 3ZWBA 4BNZA 4RL6A 1DC3A 3OEWA 1O6ZA 5L7WA 3TJRA 4RLSA 1VL0A 2PZLA 5COQA 3ZHXA 5K9ZA 4R68A 3KYDB 3WLEA 4W6ZA 4YJGA 1YBMA 4B7UA 2Q1WA 4HY3A 3PK0A 1O89A 1QORA 3G79A 1EVIA 3K2BA 1FF9A 1Z7EA 3I9OA 5DBFA 4EEZA 5JO9A 1YB4A 3MWDB 2WM3A 4OHUA 4B4UA 1Z7BA 1T1SA 3NTOA 1BG6A 4MDHA 3E82A 3SBOA 3DZIA 2IE0A 2FRDA 3ZWPA 3DC2A 2XPCA 3PIIA 3JQFA 4PLHA 4Z6KA 4A2CA 4BGUA 2PFGA 1UDCA 3I6QA 4K28A 4ALIA 3JCZA 1HDCA 3K92A 4IDFA 5JXWA 3PQDA 1DIHA 1PGPA 3CTMA 1MUUA 3WGGA 2ZQZA 2CNBA 1PL8A 2FR0A 4I9NA 3VTFA 2Q1SA 4KWIA 4J7UA 5CFZA 4WJZA 1SCUA 2Y66A 5HS6A 4J7XA 5EMHA 2DPGA 4IMRA 3W8FA 1IL0A 2IZ1A 2ZTLA 3HDJA 1UDAA 4TRRA 5A5EA 3HHPA 1LDBA 1N9GB 4CQLA 3VHRA 3AWDA 3GEGA 3UKOA 2X5JO 3RU7A 4MKRA 3WMXA 3ADPA 2QRJA 5ENDA 1LRJA 4CMIA 3A9WA 5KCZA 5G4LA 1YS4A 1HDYA 2GPTA 2NTNA 4BL5A 1C1DB 3P19A 4M54A 3AU8A 3GPDG 4CM6A 3VH4A 4PLTA 3K30A 5TGDA 1H6AA 1EK5A 5T67A 4IIUA 2DLDA 3BMNB 4J4BA 1ARZA 4IBOA 2AE1A 4LRSB 3DBRB 4J0EA 3ZNPA 3GRKA 1B8VA 3QIVA 2IYPA 3GVHA 2OORA 1DRVA 1BXZA 4YRBA 4Q3CA 1ZVMA 5DDIP 2AQHA 4FQ8A 3A4VA 4UAGA 4PZCA 4M87A 4ZQBA 1YH3A 3TQHA 3PRJA 4EJ0A 4ESOA 2X0RA 1ZZEA 4ALMA 4AL4A 4M86A 3EVTA 4H15A 1HDXA 1VKOA 3D3EA 4B7XA 4E2YA 1ZBQA 2V6MA 1IE3A 3H65A 3AW9A 3IAHA 1QKIA 3L6OO 1ZEMA 5AYVA 5L3ZA 1NFQA 2RIRA 1BSVA 4UEJA 1R4NB 5MGBA 4OJNA 2WYUA 1S6YA 4TVBA 1J49A 4LSMA 2EKLA 3MTJA 3VH3A 3L9XA 1BDMA 3V8BA 4RQUA 2LDBA 4WLFA 4WLEA 2BKAA 4R69A 1N92A 4IDCA 1MV8A 3MJEA 3JQBC 4Y9DA 3HB5X 2HMUA 4L0QA 1M6HA 1PJBA 1WMBA 3S2IA 5IFLA 4JJIA 1YB1A 1RM0A 4CMCA 1F8GA 4J2HA 1GEEA 2YW9A 3M1AA 3TZ6A 2VOEA 2QX7A 3NTQA 1U9JA 4WE3A 5TC4A 4OL9A 1YJQA 4IMPA 5IZCC 4WEQA 4TKMA 3JYNA 3U4DA 4C4OA 4CPDA 4CV2A 4EZBA 4XIJA 4IIVA 3PHGA 5I9NA 3UUWA 1C0LA 5JO0A 4J1NA 4DUPA 4BMNA 4U7WA 3FNHA 2J3HA 4PZEA 1ZXLA 2AQ8A 3SLGA 4CMEA 3DAPA 3Q3CA 4ID9A 4D42A 3WR5A 2D59A 5IZ4A 4XYBA 1XWFA 1E7MA 1LC0A 1ISFA 3T4XA 4XQCA 3AM5A 1E7QA 1PZEA 5JE8A 1ENPA 5U4QA 3I52A 1E7RA 4XGNA 3UAGA 1DJNA 4DVJA 3KSUA 3WIDA 4XRRA 3E48A 4DQVA 3V2GA 5KVCA 1I2BA 4O59O 3PXXA 4RGBA 4BO7A 1SO8A 1BGVA 2WJPA 1HDRA 3KHUA 3OQ6A 1EDOA 3ZU5A 2HO5A 3IJPA 1ZK0A 2VZ8A 4II2A 4ZQFA 5TSDA 2NWQA 1YOVB 3JSAA 4WCFC 1F14A 2PR2A 1GY8A 4JQCA 2BHLA 5AXCA 4RVGA 3PWSA 2BF7A 2OUIA 5BSFA 3UCEA 2FHSA 3E1KA 1GZ3A 1TT5B 3ANMA 4DPLA 4CQMA 1NQ5A 3A28A 4FBGA 4E12A 3AJRA 4MVJI 3W4KA 4ZVVA 2SCUA 3AM3A 4YAIA 5F21A 4FN4A 5IAAA 3SJUA 3K9QO 2RHRA 3MTGA 5DBGA 3CH6A 4FIZA 5EN4A 2W4QA 2IZZA 4CLDA 3UOGA 2H9IA 5ITVA 3FF4A 3AUAA 3JD2A 4PG5A 4JP3A 1QYVA 5A3JA 2GZ2A 4DREA 3BMCB 1E5QA 3QWHA 4PLGA 3DHEA 1DRWA 5I7VA 2QHXA 1FDSA 5HBRA 5DULA 4J90A 2Y0CA 4G2NA 3PYMA 3D4OA 4FJ0A 1HDGO 2O3UA 2GERA 5A02A 1KVUA 5LCXA 4JBIA 1YE3A 3PP8A 2X0IA 3ZV3A 2DPHA 4TRNA 5FYDA 3DQPA 3M2PA 3WSWA 4WEOA 1JKFA 2DVMA 3I5MA 3WFJA 2HRZA 4UULA 1DIGA 4RQTA 1JVBA 2EV9A 4GWKA 3PHJA 5JPIA 3KYCB 3IP3A 1X14A 1ZO8A 4XYMA 3COSA 2NVBA 4A03A 1H94A 5GMOA 4R4JA 3NDIA 5KJ1A 4CM8B 1HE2A 3FTPA 3FBTA 3IKTA 3E8XA 3H9QA 1MG5A 3P5SA 4DLAA 1GQQA 1CRWG 4A73A 3MWEB 3EY4A 3SVTA 3V1UA 4J9VA 1CEQA 3B20A 3RUAA 2JD0A 4DQXA 4EITA 1YBVA 2VYVD 5J23A 2OBNA 5KNLA 4BB6A 2HJRA 4XGIA 3TPCA 3IOYA 4JGBA 4IS3A 4BMSA 5JCXA 1K3TA 3ICCA 2ZK7A 3AUTA 1HT0A 4O5OA 2AG5A 5DCYA 5B12A 4OXNA 1NAIA 2P4HX 2HMTA 3DBVO 3QY9A 1KS9A 4LW8A 2IRWA 1O95A 1R4MB 2WD8A 4ALJA 1SEVA 3HQ4O 4ROSA 2AEJA 1HLPA 5DCWA 1QYWA 3JTMA 4UUPA 1GV0A 1A7AA 1D4FA 4IDDA 3EAGA 3IMFA 1SZJG 2QQ5A 1QYCA 4CM9A 1FJHA 2I66A 4L74A 1GUZA 5JDCA 4IY1A 2HSDA 2EIHA 1MXHA 2IXAA 3LC7O 4FPXA 5B4TA 2ZYDA 1EZ4A 2WWRA 3VKUA 1WAMA 3FNEA 3W6ZA 4NBUA 4Z9FA 4XKJA 4BMVA 4XYEA 1TVEA 4M89A 2FPPA 2BFPA 4NJMB 1JKIA 5B4UA 3IP1A 1IHXA 1A5ZA 3I9LA 5A03A 3GG2A 3KVOA 2PGJA 3DB2A 4ZN6A 3EC7A 3GH3A 4QO8A 2I6TA 2PH5A 5CDUA 4YAKA 2POQX 1EBUA 5G4KB 1L7EA 2W2KA 3WWYA 2B36A 4J49A 3TZQA 4IZHA 2VWQA 2C7GA 2VTEA 1K5HA 4P4GA 3ZNQA 1P1JA 3FI9A 1H0KA 1CQIA 1K0UA 1KEPA 4CM4B 1V3TA 1I5RA 2EJVA 5HS4A 3JYPA 1XGKA 3OEYA 1HWYA 2C07A 4QX6A 2YDYA 5IDYA 4R3WA 1ONNA 1LSJA 4LK3A 1WVGA 3U62A 4IDEA 2A9FA 2YHIA 3H5RA 4HFMA 4DLBA 5I9LA 2D2IA 1W0CA 1JKJA 2Y1EA 2ZTMA 4WKGA 1ADFA 4TSKA 4Z9YA 4ZJUA 1RWBA 1XG5A 3HDHA 2Y1FA 4CR6A 4TKLA 3ZHBA 4PLCA 4YT2A 3HNPA 3VC7A 4DBVO 4CMEC 2DC1A 2AEMA 2NU9A 1Z45A 2NVWA 3W4IA 4AJJA 5A9SB 2AQKA 4BNYA 4N7RA 1EQ2A 1NXQA 2B37A 2HMVA 3UICA 4MKXA 5B4VA 1AXGA 5JY1A 4RPLA 3QWIA 3T7EA 3VZRA 3E9MA 2Y93A 4YRAA 3TSCA 3UHAA 5C7IO 3E18A 4GVLA 2AA3A 4D7AA 1GCUA 3OJEA 4RVSA 4IPTA 3WBFA 4I08A 4R5HA 3HE3A 1DJQA 1Y8RA 4YACA 3DO5A 4Y6RA 1U8FO 1DSSG 2H1SA 3JQ8A 4NFYA 4WLUA 4CMGA 1CWUA 4DQUA 1GDHA 1MGOA 3OSUA 2CMDA 2BMAA 4FC6A 4Q39A 3WG9A 2J5QA 4Q3BA 4D3SA 1XDWA 4WLVA 3B1JA 3UGKA 1DRUA 2YDXA 4U0JA 2Q49A 1ENYA 4D3FA 3Q11A 1LSUA 3QVWA 2OMEA 5KVSA 3DTYA 1RYEA 5EIOA 2EW2A 3AY3A 1LSOA 4LISA 2IDZA 2CDAA 4BB5A 1NBOA 2NU8A 5L95A 4EGFA 1N5DA 3QWAA 3C3XA 3GUCA 5AXAA 3NAQA 4MVJE 4INAA 3Q9NA 4EUHA 3ZWXA 2FPIA 3TDKA 2NV6A 3N58A 1W8DA 2VUSA 1I36A 2DT5A 4PG6A 1HZJA 3BTVA 4PVDA 1YB5A 4BO8A 4I9HA 3LC1O 3G1TA 2IEDA 3GF4A 3AY6A 2D4AA 1QR6A 1YQDA 2I99A 3VPSA 1E6WA 2I67A 2TMDA 3M6IA 9LDTA 3GUYA 4Z9XA 4GGPA 1T26A 4NMHA 3ZU3A 4BNWA 1T4DA 2JFHA 1XU9A 1BVUA 4R1NA 2Z5LA 4CMBA 2X1HA 3H2SA 5GZ6A 1R37A 1O8CA 4EUEA 3PI7A 4CLRB 1WNTA 1V3VA 3DFZA 2VYND 4FFRA 4R51A 5KOIA 5CAEA 1OAAA 1A9YA 1PQWA 1Z6ZA 1X1TA 2X9VA 5L7YA 1UXGA 4Y6PA 3SC6A 3V1TC 3F4BA 3AOEC 2YQ5A 3RU9A 4LMPA 1HSZA 2EEZA 3OETA 3WYEA 2FY8A 1LSSA 3GMSA 3U4HA 1KVRA 1ZFNA 2D1YA 5BSHA 5CDSA 1ID1A 3NJ8A 1KVTA 1J6UA 3S2FA 2NVUB 4ITUA 1HSOA 2CVZA 4YAEA 1VJ0A 1UJMA 3WTBA 4R9SA 4D3DA 2UYYA 1PJCA 4J16A 4Y8VA 3S2EA 4E0BA 2AHRA 2P5YA 2OGUA 2Z95A 1N7GA 3KYDA 2YFQA 5KKAA 3R3SA 1LX6A 3W4JA 5DBIA 4E33A 3ZHYA 1RM4A 1P1KA 4CJXA 1TA4A 5CEEA 2D3TA 2X8LA 9LDBA 2E6UX 3GZNB 1P74A 4OH1A 1FDWA 4R01A 4CMAA 2BFMA 2Y0EA 3C24A 5JAQA 1C14A 5AVOA 2E49A 1MLDA 4J6FA 3SEFA 3IL2A 5JNLA 2JFFA 5KJ6A 1I3MA 3JQGB 1A4UA 5JDCC 1IPEA 1LI4A 2Q2WA 2GN4A 1JAXA 3DOCA 4O63O 1MC4A 1Q0LA 4JBHA 3C1TA 4UUMA 1RM3A 5C7OO 5ICMA 4MKZA 3VAZA 1FMCA 1NASA 1YQGA 1BMDA 1YL5A 3RQSA 1T25A 5ADHA 4FJ2A 4E6PA 2Q2QA 2I3AA 3GNSA 4L76A 5HTOA 3I1JA 4RV9A 1DO8A 4D43A 1M75A 2UUPA 3ICPA 3WNQA 1ENZA 3JQ7A 4ZHSA 3CKYA 4Z0TA 4NJOA 1YQXA 4OO3A 1MB4A 1ISHA 2CD9A 5EQDA 3RUEA 3JQAA 2YQ4A 2E48A 3C7AA 4FFPA 3DOOA 4I5EA 4RO0A 4S3MA 1N9GA 2R6JA 1WZEA 3RJ9A 3KSZO 4IM7A 4RF4A 2VUUA 2HRBA 3PGJA 6ADHA 2WMDA 4J2OA 5LDGA 5CG2A 2Y1DA 2NADA 1M67A 2OOSA 4E21A 2QYTA 2X86A 4J0FA 4E5KA 3D3WB 1B3BA 1GCOA 4QXMA 2WYVA 3GHHA 3I6IA 4XWYA 5F5LA 2EP7A 3OQ1A 4EUFA 3G3EA 2NUAA 2GASA 3V1YA 4WK6A 1XR3A 3DBRA 3ZV5A 2BGMA 2QRKA 4ALLA 4Q3NA 3DZBA 1NQAO 4W9NA 1EK6A 2JCXA 2P2SA 2PZJA 4NG5A 5KWEA 3AOGA 1FK8A 3PZRA 5DZSA 2AXQA 1UDBA 1Y9EA 2GF2A 4MVJM 1CERA 2C2XA 4B4OA 1DLIA 4IQ8A 4CUJA 2B0JA 3DBLA 3GGGA 1ISIA 4ND2A 4HUJA 2A92A 1SOVA 1I30A 1JAYA 2GD1O 2J5KA 5TQVA 1DDOA 5JYDA 4WNIA 5A4DA 4DGSA 1PJQA 1PJSA 3KM0A 2E37A 4IJWA 4K6CA 2O23A 1A27A 1BVRA 2CSUA 5ER9A 4MINA 3C7CB 1E77A 3PGXA 2ZCUA 3RJ5A 3TZCA 3BHJA 1SB9A 1UXKA 4U5QA 2WSBA 3HZZA 4OKNA 4PCVA 2IODA 2NU6A 3LU1A 1Y8QA 4B8ZA 3QVXA 1NM5A 2YYYA 3PQEA 3ZWYA 4CUKA 1NX6A 2Y1OA 1M6WA 2NNLD 4NZ9A 1GQYA 2VWHA 3D0OA 3FWZA 4RZIA 4PLZA 3I4FA 3GN1A 3ONDA 3IUSA 2UAGA 1HE4A 2VT3A 3TZKA 2EP5A 4QTZA 3U49A 1H2HA 2B35A 4FOSA 3ROQA 2G17A 2W98A 3UVEA 5A04A 1A71A 4WNCA 3WYBA 2V6FA 5IN5A 3DZJA 4K26A 3WX0A 1RYDA 3KTDA 1Y6JA 3EZLA 3JYLA 3RUDA 3WGZA 3NTRA 3PFFA 4MIYA 2VUTA 4W7HA 3HJAA 5F1OA 4CLHA 2GZ3A 3B1KA 3WFIA 4GWGA 1Z74A 1D1TA 5CPFA 5A06A 4OXKA 1TT7A 3BTSA 2BFAA 4GSLA 4BGIA 1QP8A 3DHYA 3PYLA 3R3JA 4FFMA 4B3HA 1BXGB 2BGKA 4EDFA 2VN8A 4GAEA 3ZGYA 1IULA 4R3NA 1OMOA 4FR5A 4GKVA 2PTGA 1U4OA 1MG0A 1CQJA 1Q0QA 3GC6A 4IINA 3LK7A 3U4IA 4XR4A 4BNLA 5DT9A 3S55A 1S7CA 2EGHA 3ETDA 1I3NA 3BMQA 4JN6B 3JQCA 4L75A 4E32A 4CL8A 2FZEA 1PGQA 1PX0A 1PZGA 3RROA 5IJZA 3BMOA 1Q0HA 4AJHA 4URFA 1PR9A 1UXIA 4FS3A 5JMWA 3I23A 4MVJA 4B4WA 1HZZA 1XLTA 4UUOA 5IXSA 1VLLA 3QJ5A 1XCBA 3RKRA 2O50A 1EE2A 1P33A 4I8XA 1K6JA 4J1SA 5JAMA 1NR1A 2I65A 2C0CA 2P9GA 3FD8A 2G76A 1ADCA 3FRJA 2C59A 1GZ4A 3DBHA 4KUGA 4BKOA 5CEFA 4HX5A 4C7KA 1LBEA 1PJ2A 5JBIA 4M1QA 2VHWA 4OSOA 3RCBA 5TT0A 5L9AA 1Q7BA 3WXBA 3L4BC 1UXJA 3JD1A 3VPHA 4M8SA 5C7LO 4F6CA 2CDCA 3TRIA 1X15A 3D4PA 2DTXA 3AUSA 1PQPA 4CMHA 3BHIA 2FP4A 1LDYA 3PDJA 1KYQA 4ONEA 5F5NA 2ZJ0A 3U3XA 4E5YA 1ZMTA 3GHYA 3UH1A 2AG8A 1GV1A 3P2YA 1XHLA 1PJ3A 4AJ4A 3OP4A 3I9JA 5L53A 3NRCA 1V6AA 2PY6A 5I9MA 1GD1O 4DPMA 3PZBA 1PGJA 2OFPA 2YZ7A 4GL4A 3MJVA 3RSHA 1QV7A 2BD0A 1R0KA 5KJCA 3PPIA 3PHIA 3MJTA 3TFOA 1LDEA 5LC1A 1U3VA 5JCJA 3CUKA 1VL8A 2HK9A 3JQEA 3ZNNA 4YJDA 1LQTA 2D5CA 3KO8A 4TZKA 5THKA 3ROMA 3X2EA 5KIAA 3TZHA 1PQUA 4ZRNA 4NPCA 3ENNA 3VDQA 4FFOA 1G1AA 1R12A 4QT0A 1I8TA 3JV7A 4I5DA 3O26A 1KEWA 3LF2A 4ILKA 1A7KA 1VKNA 1LDMA 3CZRA 4NBTA 3RFVA 5CG1A 2AE2A 5I8WA 1NPTO 1UP6A 4WCFB 3GVIA 1U7HA 1IY8A 3OIFA 3EMKA 3WNVA 1W4ZA 4UREA 4P22A 4TQGA 1VJ1A 3FCOA 1DBVO 4D0RA 4RJTA 4RPHA 2C82A 3OFSA 3HB4X 1AUPA 2CF6A 3HFSA 1ZH8A 3PWKA 4KDFA 1WZIA 4W9NC 4HV4A 1KEVA 2YV3A 1H9AA 2ZTUA 3ZV6A 3VH1A 1C0PA 3IJRA 2ZB3A 4A7PA 3JYQA 4XCVA 1I3LA 4KMSA 1PU2A 4FSHA 3NDRA 1DFGA 3S8MA 4DC0A 3ZU4A 2UDPA 4YJGB 3W8DA 1ZJYA 3HWRA 1RPNA 4F3YA 3SX2A 1UP7A 3PVZA 4NJMA 2DBQA 1DFHA 5TT1A 5L4SA 1R15A 4AJIA 4NR0A 4AJOA 1JN0A 2YUTA 1GAEO 1U3TA 4L9RA 2Y0DA 3PHHA 1BRMA 3O8QB 3A1NA 4NU5A 3D1LA 4AG3A 4CODB 2HUNA 5G4KA 3HG7A 3EVNA 1NAHA 2OBYA 1Z75A 4BV9A 4QECA 2G0TA 3RVDA 4BHTA 8ADHA 2DUUA 3CEAA 3R1IA 1XA0A 1H6BA 4IQGA 4BNMA 3DHNA 1QMGA 1ADGA 1T2AA 4HFRA 5L40A 1H6CA 4TVOA 3DL2A 4A27A 3GNTA 2PKQP 5IXYA 5TIIA 3DMTA 2O2SA 4MP3A 2Y67A 4OSPA 1VI2A 5BNTA 3R0IA 2D0IA 4YBZA 2GDZA 5DF1A 5EQFA 1E6UA 3ONFA 3MJSA 3IKVA 4WUVA 3OECA 5H82A 4CQLB 5ICSA 1C1XA 2JFGA 2AQIA 3VH2A 1UAYA 3ON5A 2Q45A 3VVBA 4A0SA 2Y05A 4IDGA 1GYPA 4CR8A 3H6KA 4Q3DA 3ZV4A 1B15A 1PS9A 1WXDA 2NU7A 1K2WA 4UVHA 1QYXA 4MVJP 3INGA 2BH9A 1V9LA 4WECA 1GPJA 3WGYA 4R1SA 3ZW8A 4DC1A 1YDWA 4NQZA 3JQFC 3DZFA 3U4CA 2VWGA 1D1SA 2ZTVA 1B0AA 2VHVA 1Y5RA 3LQFA 3QW2A 1U5AA 5FFFA 3QHAA 1XYGA 2LDXA 1KVSA 3KOUA 3ORFA 3UN1A 3WWZA 1ISGA 3Q1LA 3PTZA 2DBVO 2EWMA 4XZ3A 1LLCA 4L4RA 5FI3A 1E3SA 5JFOA 3DWFA 2PV7A 1DOHA 1Y9AA 4GLLA 4UVIA 1K89A 1D7OA 5MDHA 1ENOA 4KWHA 3NT5A 2JCYA 1JU9A 3ADOA 2R2GA 4AJ1A 1N1EA 3HN2A 4JLWA 1PJTA 1R16A 3KB6A 4E30A 2OO5A 5THQA 3WGQA 1G6KA 4QSMA 2DFDA 3ETEA 4IQ0A 2VNSA 3ASVA 4CLOA 2B83A 1UR5A 4HNGA 3I9MA 2BELA 3GGOA 3K96A 1MXFA 4XIYA 3BAZA 1DIBA 4D79A 3KXDA 4RPKA 4E31A 3WB9A 1NQOA 2ZB4A 1YL6A 5G0UA 1KY5A 2Q99A 3QWBA 4LCEA 1A4IA 4IXTA 3QVOA 5EJ2A 1ZSYA 1O9BA 3MJ4A 3ZZNA 1JWAB 5TS3A 4EEXA 2JKVA 2QZ9A 5T57A 3O9ZA 3PIDA 1F12A 5F1KA 3WJAA 4E5NA 3GK3A 4YJFB 3AFNA 4UVDA 3W8EA 4BNIA 1O94A 2B4RO 4F45A 3MEQA 2WD7A 3OJ0A 4CM5A 5JYEA 5JSFA 3OHSX 1RM5A 3D4NA 4WOKA 4BO0A 4RPGA 1QLJA 2P9EA 4O6VA 4XR9A 1X7HA 4FDAA 4D44A 2X6TA 4OQYA 3RBVA 1XQ1A 1MA0A 3DZGA 3WIEA 5CDYA 1EVYA 2YJZA 4H16A 3RC7A 2G82A 3F1LA 3RI3A 1DAOA 2HDHA 4YXFA 5L4NA 3HDYA 4YJHA 2PH3A 4WASA 1W73A 4KP7A 3OA0A 3G17A 4M49A 4AJNA 1AHIA 3ULKA 3CIFA 4B4VA 3HFGA 5ENVA 2V7PA 4J4TA 4W82A 1BWSA 4IZIA 4IJKA 3QRWA 2Q3EA 3ETGA 1R0SA 2O7QA 4Y67A 3WGHA 4ZQHA 4HKTA 1F0YA 1C3VA 1ZXBA 2QW8A 1YBAA 2VOJA 4JP2A 2QZZA 1MC5A 4KZPA 2XXJA 1ZSNA 1P77A 3L6EA 4BO2A 4AICA 4BNJA 5K6AA 3CE6A 4XYGA 4GX5A 1NHGA 4XJTA 3MZ0A 1P3DA 2EW8A 1WW8A 4NHEA 1TB4A 5CDTA 3NEPX 1EVZA 3PJGA 4RZHA 1B3RA 2WTBA 3FWNA 4JJGA 1T2DA 1XEAA 1L1FA 3UFXA 2EKPA 3JQGA 3K73O 3H9JA 1HYEA 4P4NA 4MVJH 3V5NA 1EDZA 1H5QA 4OKIA 4XDYA 4Z0HO 3HN7A 2YY7A 3BA1A 5BNFA 4ZU3A 5G0SA 2O48X 1PR3A 2GUGA 1OBFO 3EZYA 2EGGA 4BNKA 1H6DA 1QV6A 1WLYA 4N5NA 2ZB8A 4W99A 3OF2A 2J5RA 1E5LA 4FGSA 5T6BA 4A5OA 4DIBA 1SBYA 3GDOA 5U9CA 2Z1MA 2GYYA 1ZCJA 1J4AA 5IDWA 2XOXA 2JCVA 4NI5A 1ISJA 3NV9A 3PWZA 1OFGA 1M2WA 3DDNA 2FN7A 2Q4BA 3VPGA 1HETA 2VRCD 2Q50A 2YHUA 3PFWO 4I1IA 3TL3A 1TLTA 4D46A 3P2OA 3DMTC 3M1LA 5IN4A 3ZN2A 1QXSA 1GTMA 1UAGA 5HRUA 1PL7A 1CDOA 2ZJ1A 3ANLA 2ZCVA 4KOAA 4FJ1A 3T7CA 5TRTA 3IQDB 4CR7A 1PSDA 3G49A 3GLQA 4JNKA 3OH8A 1E3IA 2EG9A 1LLDA 3HADA 1O5IA 4BNNA 5I8ZA 3LSYA 1I01A 4WLOA 1MFZA 2FZWA 2O2YA 4IGFA 4KUHA 5T5QA 1IPFA 1DHRA 2EXXA 5COBA 4W4TA 1F06A 1BTOA 3WQSB 1UZNA 3WLFA 1GL3A 4BKRA 3EUWA 1KC3A 1PWXA 2DTEA 1JVSA 3RFXA 5BR7A 1DHTA 1H93A 2VNAA 3ZW9A 2NSDA 1NPDA 3AI2A 2UUOA 4XA8A 5DP2A 5JMPA 2HKIA 2PGDA 1BW9A 2NTJA 2RH4A 4PLFA 4XJSA 3F46A 2DUWA 3GVPA 1DAPA 4AJPA 1ML3A 2QG4A 2JL1A 2Q4EA 3WICA 5JW6A 5COAA 1I10A 4OAQA 2V65A 5C37A 2W2LD 1K6IA 1R6DA 3GVCA 1NVGA 2O3RA 2JD2A 3Q6IA 1WMAA 3M2TA 1KC1A 3K31A 5KVVA 1YDEA 2VHXA 2QRLA 3NUGA 4J4HA 1KBZA 3CXRA 3GMDA 2A4KA 2W2KB 4J91A 3KSDO 5CHEA 4ZGWA 2JAHA 4J3FA 4BQRA 3RUFA 4K6FA 1DC4A 3E9QA 2B5WA 1U8XX 3JD0A 3OMLA 1P1HA 1U5CA 3C1AA 4KUEA 3CPSA 3EK2A 1JW9B 1P9LA 4BO1A 3GFGA 4DIFA 2P91A 4YT4A 3LVFO 3F4LA 4KTVE 2YHIB 4DWVA 1JWBB 4Q3AA 2O3JA 1P44A 4GX2A 1LC3A 3H5NA 3BIOA 2AEFA 1MFPA 3WBBA 3LT4A 4CM9D 2GN8A 4D45A 3GDGA 4GVXA 1CIVA 1GEGA 5G0WA 2JAPA 3E9NA 4XEHA 1SB8A 3DXFA 1E7YA 3QLJA 4J1TA 1VRWA 4JCOA 2AW5A 4Q3EA 1B8UA 3ROKA 3ROPA 1YGYA 3IUPA 2PK3A 1E1MA 1FDUA 3GPIA 5TJHA 2VTDA 3A14A 1PJLA 1EEHA 4UEOA 5L45A 4O0LA 4LN1A 2XF8A 1AHHA 4XB1A 4KQXA 4BNFA 4XD2A 4S1VA 4IXWA 1C1DA 4BO6A 2PKRA 4BOYA 4YR9A 3UF0A 3MOIA 3MCVA 3UXYA 1E3WB 3JQ8B 1ZJZA 3AUUA 3BMNA 3ZDFA 5AQ1A 1T4BA 3UCXA 1G0OA 5HM8A 3EW7A 3H7AA 2VCYA 2YV1A 3FBGA 5IG2A 3LF1A 4E2XA 1HYGA 1H9BA 1UUFA 1WWKA 1VPDA 1F8FA 3QWFA 5K6AC 5GY7A 1HDZA 4GSKA 4L4SA 4UVGA 4WPGA 5ES3A 3WGIA 4BO9A 1CF2O 3L6DA 3F3SA 3KUXA 3C7DB 4YEDA 6LDHA 4XDZA 5IZCA 5L4LA 2Q1TA 5G2OA 4RDIA 3FSRA 4I5FA 2X0JA 1Q1NA 3LYLA 1R4NA 5BSGA 3K5PA 4DIOA 5CEJA 2X23A 1B2LA 1VC2A 3F5SA 3FPCA 3GRPA 1V0JA 2E82A 4JXKA 3KLPX 1U2GA 2FSSA 4J9UE 3H9EO 4RLHA 3TF5A 3PEFA 4OIMA 1ONPA 2C5AA 5FI5A 3QV1A 3ZWCA 4YRDA 3W6UA 3DZKA 5JDIA 1CYDA 4LMRA 1PGNA 4CLEA 2VWPA 2W90A 3D7LA 1XSEA 2HAEA 3W1VA 1E92A 1C0IA 2DFVA 1X13A 2VHZA 4GLOA 4CV0A
chains in the Genus database with same CATH superfamily
4EGCB 2DAPA 3HY4A 1XD8A 4N7MA 3U0BA 4PR0A 5A9RA 5B3LA 2DQ4A 1MABB 3PXCX 3CN9A 1VCIA 3X1ZA 3ZDAA 1TTPB 3N2GB 3OIGA 4NV3A 4Y2GA 5EP4A 4DV5B 4R54A 2ATXA 2HUPA 4JS0A 1ILEA 2HEGA 3KEOA 1GSHA 1RI3A 1EP3B 1P1CA 1UMCA 1JTFA 1BU5A 5DSTA 2FW7A 5AXBA 1T43A 3G8DA 1A2OA 2YXLA 4IEFB 3U39A 5B5SA 4E94A 1NVBA 4E6EA 3LHFA 5MN4A 1SWVA 2FW9A 3QLEA 1ZS9A 2EL9A 1G0NA 3UFBA 4AULA 1U0LA 3LM8A 3FHJA 3VKVA 4F5DA 2R1VA 3RAJA 5A5DA 2C8JA 1A3CA 4H77A 2E9SA 4QFCA 3PGKA 4EW1A 5HA5A 3T3EA 2GLXA 2GD2A 5HF6A 1PBNA 4RVFA 2PSEA 4GHWA 4KXLA 3INTA 4Z0NA 2P6RA 4YWJA 3BCUA 2QP3A 1J5PA 3MHPA 1T9HA 3NGMA 1D03A 5CIWA 3O4GA 5IDQA 2V6BA 3SE0A 2PD4A 2JGAA 5JD4A 3T1OA 4KN6A 4Q4AB 1KZ4A 1M1YB 1WDTA 5CYFA 1R0LA 4YASA 2BGRA 1ULTA 1B00A 1YWGO 3M9WA 2RKOA 3H86A 3KZKA 1A98A 3HMQA 1MO4A 4WI1A 5AHWA 3FTFA 4K40A 2NXWA 3MGKA 3CUUA 4H0NA 1ZD5A 4HP8A 3J81A 1TIKA 3UJ7A 3ITDA 4DBZA 3DLCA 3BZUA 3B9PA 4H6PA 5J2UF 1KK1A 2IUTA 2ON6A 1L4YA 2WHQA 3KDSE 1V8FA 2C2YA 2E4AA 5JD6A 4V0SA 1DDGA 1TT5A 4MP8A 1SH7A 2JLBA 1PO7A 1ZCBA 2BJWA 4EHJA 5THXA 2NTEA 1V1RB 4R5MA 1ESDA 1X9GA 4ACBA 5AUOB 5K2OA 1RZ3A 1GRNA 1RE1A 5CH3A 2H4WA 5JNUA 3BQMB 2QVCA 3ZD7A 1L5RA 2BE9A 2H1FA 2CEKA 3ITKA 3PLRA 2JD1A 1RWPA 4OGWA 2UZ1B 2ZRFA 4AF7A 3TTYA 3SYMA 3G0CA 4FOOA 1WU8A 2E18A 4B80A 4JI5B 1GTRA 5DN9A 3PKIA 4Z3KA 4RORA 4KQKA 1N0HA 1FC0A 5KSYA 2IX9A 4RQAA 4GOXA 4POAA 4NH0A 3ABRB 2MCFA 3WE7A 4F7WA 2VT6A 4PG8A 2BMFA 5JMOA 1Q22A 4Z8YA 4WGGA 4DLPA 4AWAA 2G9NA 3PENA 1WP9A 1WV0A 3BCRA 5EMLA 4AJKA 1TVCA 3OQIA 4RCVA 1KEEB 3ROTA 3C39A 3PYXA 2TMKA 2C4MA 4HAIA 4YAGA 4BEBA 3RABA 2ILTA 4B7CA 2G04A 1P1FA 3HU1A 1WMEA 1NUTA 2FW8A 3SXPA 4AMUA 2ZANA 3AY0A 1EVJA 3I04M 4HRXA 2Z4SA 2Z2ZA 3VOSA 1OXTA 3DXYA 4C4XA 4B6GA 5IYZA 4FZVA 4OQLA 3W5CA 3I39X 1ZMOA 2WKWA 3EG5A 2R1TA 4UNSA 5CXSA 5P8WA 1N0UA 1ISMA 2YFYA 1A77A 3KEMA 3SP1A 3HLYA 3QVSA 3CLRC 4NMMA 1T0IA 3WLKX 4EB6B 1Q20A 5MGNA 3GX1A 1VIDA 2J4DA 3HU3A 2GLTA 2XNJA 4GPTA 3O0DA 3O8LA 2YFHA 4P5DA 3SIRA 2A88A 1NN0A 2QVXX 4TQUS 3ZHRA 3L9WA 4TXHA 2F90A 1QO9A 4IDQA 1ZUNA 4E2ZA 2LCIA 4YT5A 1FW6A 5IAEA 3N2IA 5BMVA 4LX8A 3LGXA 4AY6A 4K9OA 4S05A 5G53C 5DXAA 1EFRD 4G4SP 2AG6A 3BRWD 3F6EX 5DGIA 5C80A 1G3UA 1C1HA 4U3JB 4YK7A 5C4IA 4H1HA 3RSCA 3LQ1A 1R74A 4TVKA 1QSGA 4PLWA 4UFNA 1E4YA 4CV3A 4EJ6A 5JQWA 1V8DA 3MTDA 2BDTA 3BIWA 3FLEA 3KOYA 4ZOCA 3KUCA 1C7ZA 1LTKA 3R5FA 4JLSA 3QEBZ 4ES6A 4LJSA 2H2WA 2ID9A 1NJGA 4JR1A 5DHAA 1IEXA 1U1GA 1VHTA 3OKAA 3U7HB 4FDVA 2Q9UA 2CN1A 4Z8XA 1T0JB 4D82A 4E15A 4YYZA 1JEQB 2Z04A 4KDRA 1SUFA 4EX7A 3C2QA 4RVHA 4WX2B 1CLUA 2LNDA 2NQTA 3ZIUA 3P0RA 2IYZA 1TXGA 2C5FA 2D5BA 1HRDA 1QIDA 4N82A 4PC2A 5LBIA 1AXEA 1WQ4A 2AUTA 3VPFA 3WRYA 2WG2A 4Q05A 5HGXA 2QPLA 4NZYA 1OC4A 3GFBA 1VYUA 4AN1A 1QIGA 1E1CA 4KN9S 2HK7A 4WD3A 5G40A 3ZWNA 4P82A 1B14A 2P2LA 1XELA 1J2JA 4RIGA 2QE6A 4XUDA 2YZMA 5KYYB 5GJCA 5LQJA 2ZQYA 4TROA 7REQA 1G20A 2VF8A 3IEUA 5EESA 3KAQA 3J7TA 1KJZA 3Q3HA 4RIFA 4FKBA 4MUBA 3NBMA 4HNHA 3QY0A 1U2GC 1GU1A 2V97A 1SAYA 2MHCA 2NG1A 4EI2A 4Y1FA 4CUZA 1SNYA 4KQEA 5EZQA 2JGRA 1VG9B 2Q5EA 2JI8A 2X5NA 1GU7A 1ABFA 2IPMA 2QAIA 2VDWA 3A04A 3CUWA 1MPTA 4GQIA 4I1OA 3EMDA 4L73A 2JI4A 3RS8A 2G1UA 1XP8A 3X43A 3A70A 4F46A 3AVTA 3DOUA 3F6BX 3ETNA 4L7QA 4F1WA 4CL0A 1R0WA 1PTJA 3RASA 4BBAA 4UU7A 4HTFB 4DA9A 4DLYA 1YDGA 5DP1A 1DLJA 4N40A 5JALA 1EVQA 1JYSA 5SZHB 1ST2A 1KEUA 3BL5A 5ALHA 2VBIA 3BMOB 3BTUA 2Q5JA 2X4IA 1XWWA 1ATIA 3KDPA 5KTTA 3GFSA 4BQPA 3EDMA 3L7YA 3ABZA 4HZUB 1ZIPA 4RTRA 4IJQA 5K0CA 4MGHA 1OC2A 5ECGC 3I6BA 3U7RA 2VRNA 3DBHB 4NFSA 1VRCA 2CDNA 3I72A 3WQHA 1ZWLA 4AZWA 2H7VA 2WKRA 1VE7A 3ZY5A 4DSOA 5F2NA 1UDRA 5FPKA 4DV0B 1A9XB 4ZI7B 2PUAA 4XQGA 1Q14A 2ZIZA 1UZMA 1DIAA 5LNK1 2POCA 3TD6A 2WE8A 3CV3A 2OAQ1 5LXTF 2HNKA 2OL4A 4M6WB 2IY9A 3PG5A 4UNIA 3EXAA 4OOEA 3EDOA 4P8RA 1AK9A 2H11A 4MKGA 2EERA 3EQ9A 4PF1A 2WJ6A 3GV0A 3KKEA 1F1JA 5DN6A 4MI1A 4JJKA 2W6NA 4JYBA 1KZGB 4WJKB 1NYRA 3VBEA 3OE5A 4BFZA 1B16A 4LYDA 1QFZA 3RDPA 3L1KA 1SU6A 2XCIA 3LT1A 1KMIY 3HCFA 3NPMA 3JQ6A 4ALKA 5JV5A 1CE8B 1ZOPA 4NU8X 1XP5A 1Y4UA 1S2NA 3HSKA 2D74A 5M3BA 3O4RA 3S3TA 4TRJA 1JT9A 3TNFA 3V7UA 9ABPA 4CI9A 3NXSA 4EMBA 2VUIB 1AURA 1T2VA 2D5AA 1LPBB 3MAAC 1QJCA 3EGVA 3K0CA 3QUBA 2WB4A 2YXDA 3RG2A 4M22A 1NVTA 4CNQA 3L7BA 1IG3A 2XA2A 4ZOLA 2W6QA 1E1NA 3Q12A 1R8SA 3EUFA 4FYHA 2VDLB 3VHXB 1XJ5A 1EZZA 3QGMA 4BNDB 3DAFA 2GPJA 2W2LA 3P4YA 2WHRA 1T9BA 4HDMA 1JLLA 3U9LA 4L6IA 2FW1A 2CL7X 3ZI0A 5ELMA 4DTIA 2A5GA 1CX9B 2TMYA 3BRSA 3IUMA 3LDUA 3AL0C 4Z1MD 2PU7A 3M3HA 1SIOA 3DA8A 3FUTA 4N8SA 4OU5A 3LQKA 2O05A 3AY7A 4BNVA 4W6QA 3FR7A 3GRFA 2HIAA 1NXSA 4M1MA 2CB0A 3PJDA 4GE0A 4QUKA 3V4LA 2QRNA 1YR9A 1FPQA 1RJEA 3WJ7A 1LCIA 3GLVA 3DYBA 3AIIA 4PINA 4KU4A 4NL4H 4PZUA 3DJYA 4R9NA 4IIGA 1FTYA 1HYHA 3BQNB 4FHGA 4ZJZA 4F21A 3B1VA 2AK2A 3H2GA 4CWAA 4DEYA 4P08A 5AP9A 2HSGA 1V39A 4BU0A 3KV3O 2V4MA 3BBPA 4I9FA 3CJQA 4O4HF 4Y2TA 4PN7A 4PHGA 4PAGA 1CQWA 2NM0A 4I55B 2IYVA 4JL5A 1Z07A 3GDFA 2C5EA 3DDWA 1WJGA 4QLOA 2AI1A 2QXYA 3F6SA 1SQ5A 2AWOA 2DWOA 4CEIB 1RQRA 3OQBA 3WRXC 4TMZA 4BO5A 5KVQA 5JQGB 2XOKD 4QPZA 5JH7A 5BWOA 3LUCA 4KRXA 4E5DA 1MU0A 1M76A 5JCJD 1FFXA 1SPXA 2LIPA 3AI1A 1P8AA 2GAFA 4W7IA 3DMDA 1YZQA 5I9IA 1ZDMA 1KAGA 4J7AA 1R88A 3MJCA 2JLZA 2MTBA 3OJOA 5KQRA 3MTEA 1Q5PA 1N6HA 2VLBA 5C9ZA 1N2SA 1OQAA 2NVUA 1WHSA 4BZQA 4XGQA 3N0RA 2FPUA 5DWQA 1YFJA 3IV7A 5DYNA 3A2MA 3S44A 1V5WA 3DHVA 1N1GA 3T15A 1JQKA 2X4DA 4XUGB 3M5DA 3UHFA 3F7TA 5MN5A 1L5ZA 1UKVY 1OR8A 2VUHB 2BMDA 2VXOA 5LYJF 1YA6A 4YA6A 2LV8A 3LCUA 3DTNA 4HQLA 1IN1A 3KBOA 3IV9A 4ZA2A 4JYCA 1GSOA 3P32A 5SZJA 3ET4A 3ZKWA 1KJIA 1XDZA 2O3QA 3LW8A 4GOOD 5JNWA 3VNSA 2B8JA 1NUUA 3TTSA 1DAEA 1D3AA 1GA4A 2BM9A 2ZE7A 5KWJA 4YY3B 1JWLA 3NBYC 2E5WA 3WLTA 2VPZA 2IY7A 4JU8A 2F48A 4LGVA 3QVTA 4QPNA 5FRDA 3U3JA 4YCSA 5LP1A 4EMTA 1C1XB 4BX9A 2QU8A 3NJ4A 2ORYA 2OV2A 4G25A 4IMJB 1C4OA 1FLAA 2JFQA 3L8YA 4PCUA 3PT9A 1JEDA 1H2FA 5BY2A 1HT1E 1FU8A 4S0ZA 3CE9A 2QVLA 5KOJB 1J1UA 2XD9A 3SGLA 3QOWA 3K8ZA 1L9XA 1NP3A 1E9SA 3REOA 3N74A 3MOGA 3DE5X 3EGCA 3GNQA 3P5BA 3UJNA 1W0KD 2F59A 3TXAA 3QIAA 4MCJA 3ZHQA 1Z39A 1PZHA 4Y2JA 1R5JA 5KNCH 2BHSA 2GD6A 2G5PA 4H4EA 2B6HA 5EXEA 1PBTA 5JC1A 5E8JA 1I7SB 2DWPA 4X1YA 2WWYA 3GGDA 3RANA 4DZRA 5BV8A 1TEZA 1MO6A 5K4HA 3D3WA 5IM5A 4EKEA 1TDJA 3WKAA 4DDUA 1M2OB 5JS2A 3RODA 2WWIA 1J0BA 1AE1A 5J63A 2PNFA 1BU8A 1UBFA 3EISA 3R0ZA 5JAIA 3TLZA 3UJAA 4Q1EA 2PNJA 5JROA 1X74A 4U6SA 2GKOA 2Z1NA 3RUIA 1UXHA 1FJGB 1LUAA 4Z4GA 1DQYA 1H2AS 3EBLA 1PEDA 5JVDF 2I0FA 4B3GA 4L8YA 4DV3B 2FX3A 4X1OA 1NVAA 3AC0A 3I2KA 2PCLA 2AYYA 2ZJ2A 4B3RB 1XAJA 3QOYA 1NJ1A 4G0QA 4JVMA 2ZM6B 5TLSA 5FQNA 3KRTA 1ZKMA 2H1IA 4MXDA 4MRMB 1I3KA 2AZDA 3D7KA 4R8VA 4J0IA 4EABA 4AG5A 2PGOA 2IKSA 4ZREA 5DHRA 3ADDA 1TM4E 1PP4A 1XKXA 4GNKA 1XIVA 1Z6XA 2GVNA 4GBED 2Z83A 5REQB 2XUOA 1E1KA 4HNQA 1VJ5A 2RCYA 3GY0A 4IDAA 5DOVA 2WPDD 3HH8A 4GQAA 1UK9A 2PVPA 3ZHZA 4C6RA 3F3KA 1UCFA 2L69A 1XVVA 1YULA 2RI6A 3CSDA 3LP5A 3ST7A 2GJ4A 4F4JA 3ZZTA 1AC5A 4E4TA 3CX7A 3NOQA 4RXUA 5KX5B 5CP8A 1CETA 5T4FA 5K7SA 1NVFA 1ELOA 1Z28A 2RAFA 2FFBA 1D2NA 5AI4A 3N7UA 1G7CA 1P7VA 4ZVUA 2EQBA 1Y1PA 3MT7A 3DD1A 1UBHS 1EVKA 4HSEA 4DV2B 1CUDA 1CU1A 1P7PA 4JT9A 4X54A 4GC9A 1SZDA 1T5HX 2WIGA 3TL2A 1V1JA 2NZ8A 3HGMA 5K51A 2C88A 1NR7A 3H2ZA 1GG5A 1GPBA 2ZE5A 1XTUA 1QFJA 2WUVA 1CZKA 3P96A 3MN1A 3PXDA 4N18A 2E85A 4QUEA 3VBCA 3UT0A 1SKQA 1V9SA 4TYPA 4ZDJA 2GNAA 2YBEA 4XRGA 2PUTA 5ITSA 2YJ3A 3JWEA 1UBOS 4HDAA 4ENWA 3Q9UA 4FGUA 3USCS 5IT5A 4LS3A 1SUPA 3R0VA 4NF2A 5CLGA 2P67A 2HJSA 2H63A 3ZY4A 2BE7A 3SXJA 1JT2A 2AOUB 2NIPA 3HUDA 5EKXA 4HC4A 3AEQA 3WGOA 5CB4F 5CB0A 4MCIA 4ZVQA 3L8FA 4MR7A 4BLPA 2V3WA 1WA5A 4F3TA 3FWPA 4YJHB 4KTTE 3K9CA 5EAIA 1ZK4A 1K8ZB 2QY9A 3OZVA 1DT3A 1GR0A 2VJNA 2PTHA 4PRLA 2B61A 1CP3A 3RVKA 1QVVA 3D9QX 4NDNE 4RHUA 3DPIA 4CBVA 3KQWA 1FXWA 3HJTA 1EPUA 4F38A 1JG1A 5GOZA 1Z5ZA 2OMKA 4MGKR 2FDCA 1QGZA 5CM9C 1SXJE 3TAXA 4BY9E 1IY1A 2P65A 2BOVA 3L4BA 4HAZA 4TTQA 1G2IA 5E7JA 4PG4A 3V8VA 5HZHA 2JCSA 4BLVA 2O8FB 3IHLA 1VPTA 1DIRA 3AF3A 4KH1A 4KVFA 3CLTD 1X0VA 5E7IA 5EXPA 3TINA 1VRVA 1QU3A 1NHWA 4I5IA 3WGTA 1ZCZA 3U19A 4KQJA 1NP7A 2XYHA 3GZ4A 1OZAA 1KQFA 1FBTA 1Q7RA 3BC1A 4EEZA 3I8SA 4LHVA 5CFPA 5CCBA 2WE7A 1WW2A 2ZIFA 3L8DA 1Z0FA 2PD6A 1SC3A 4K9KA 3RS2A 3BXZA 1MB0A 3VNBA 4EKIA 3UFXB 1ISRA 1VL6A 2Q1UA 5FI0B 4DMLA 2XT0A 1NI3A 3IQIX 1I14A 5KYNA 1MRSA 4IGEA 4KLNA 1U2DA 4PG7A 5ALMA 4BUJA 2OAGA 2Q6VA 1WVIA 3CF4G 3OY7A 4Q9NA 5B64A 2E21A 4HVLA 4MIOA 2VJKA 5L3QA 1UEXC 1QF6A 3IVXA 1LV8A 4YRSA 1G20E 1Q19A 4MZDA 1KU0A 5DK6A 3HRKA 2PD3A 5DI3A 3S7TA 3ZJ5A 3I2FA 1IH8A 4B47A 2CZQA 3WDKA 2E5FA 1GKKA 3V4PB 1LTHR 1RTKA 1M54A 3U5TA 2JRCA 1A9QA 1ZC4A 2IUFA 3C0KA 3W05A 2GAJA 3ZK8A 1EFRA 3LLSA 4ERXA 3I9V1 3JQBA 1YRAA 1I13A 2WVJA 1E18A 1RMQA 2ZUUA 4GUAA 1XFDA 2X58A 5CTJA 3COYA 5FNVF 4EO4A 1I1QB 2D4HA 3UWOA 3PKZA 4EDHA 2R9VA 1KERA 4O4JA 1QOPB 2RJOA 3PI6A 2MINB 4HADA 2WP0A 5JEEA 5C1OA 4EB8A 3NKVA 2HL6A 3VSBA 4CKWA 1VGVA 1OI2A 2VP4A 3SHFA 3SZLA 4ZCMA 2J45A 2FHPA 4CE6A 4O08A 4EBFA 1M8FA 1OLSB 1ZR2A 5HEKA 4B34A 5CU7A 3LY5A 3OZDA 4FB5A 2OXFA 2VQ3A 4ZGGA 1IZ0A 1X7ZA 3C4QA 5J5VA 5IWCA 5JASA 1Z47A 3L07A 5E6RB 1E1LA 1P9NA 3NT4A 2JLAA 4NG4A 4DS3A 2G0AA 4EPXA 2RGUA 2HZBA 4NABA 1F2TB 1X1EA 4K81B 2DZDA 1ZW1A 1G21E 1WULS 5FT9A 4RTPA 4PLYA 1GFWA 1XE3A 3SQLA 4CL3A 2EFHB 2VA8A 1POWA 5CT5A 4B2IA 4TL8A 3NVDA 4R2IA 1Z5NA 4FSDA 4V02A 1CIJA 2OZPA 3KVYA 3OUZA 4G5GA 4LC1A 5JSYA 3SC4A 4EHAA 4EY3A 1MJNA 5GOTA 4RX1A 1W5EA 1FYEA 1V35A 2V74B 3J7AC 2FR8A 5EMNA 3QBJA 4HAYA 5T8KC 4Q02A 2IHUA 2JZOA 1E7SA 2WJJA 4NNJA 4W9RA 4ZI5A 3DOJA 3H0KA 2XDWA 5EWLA 4L5AA 4LNAA 4J2TA 3QEMA 4XASA 1WO8A 4EYKA 1Y7IA 5B6IA 1NMYA 1VQ1A 1D8TA 4HQRA 2XYQA 5AXDA 4YIHA 3A4MA 4QPCA 2J32A 3ND8A 2IH2A 3O8OA 4I1VA 2J9FB 3DVLA 4Q12A 1Z5VA 3F5QA 1D8AA 1VCMA 2C29D 2D0DA 2O3SA 4WCFA 5BSVA 1U6JA 1TJ4A 1WUIS 1IOLA 5FF9A 4BGEA 4F2DA 2I3GA 4OQZA 1L7BA 1Z62A 1QM5A 3UJ3X 2CVQA 2BF4A 2ZYGA 3A4TA 4E4RA 4PN3A 3PD1A 4L51A 3TIXB 4E2WA 4K2HA 3GN2A 3RWBA 3SX0A 3ICOA 2IZ5A 1YONA 1FTNA 3A1CA 2LKCA 4M9ZA 4IIFA 3VDRA 1JDTA 2J85A 2V9CA 5IPFA 5A3VA 3HDGA 1P0FA 3NH9A 2IOHA 2VG8A 2RB5A 1G5PA 2W8ZA 3RTBA 4Y2PA 3V1MA 4D4HA 1JFFB 1W93A 2NZXA 1OT3A 3WTCA 1XQVA 4M1WA 5AKEA 4QT4A 3BTOA 5DM0A 4P4LA 2ZRNA 4XXHA 2O4CA 2CFCA 5FBRB 4P1ZA 3WSVA 5LMNB 2GDJA 1EH5A 3KXIA 3G9UA 2Q3BA 3NWEA 4TV9A 4JJ6A 5EG5A 3T9EA 3WJ2A 1RCUA 5L7WA 1ZOLA 3UANA 3OAAD 3HS3A 1VL0A 2PZLA 3A6GA 4HNAA 4RLSA 1CUJA 4YJ3A 5DSZA 3KYDB 3WLEA 5IJWA 4B7UA 2CLOB 3VU8A 1IXKA 3NC4A 1U0GA 1JIIA 1O89A 3DP7A 1BGXT 4ISCA 5EKDA 1F48A 1D7AA 1DQNA 1ODKA 2HQBA 1OAOC 2H18A 1FF9A 1UJBA 1A5SB 3I9OA 4WLEA 3A31A 3GJQA 4WY2A 5DBFA 1DP4A 3N9IA 4GC5A 3NHYA 4KXMA 5H3CA 4OHUA 2Q27A 4DW8A 1P91A 3T3MB 2OKCA 1FNNA 3RYFB 3NTOA 1B93A 2Q9AA 6GPBA 4N12A 1Z0IA 2X4LA 1A9SA 1EX7A 4P3OA 5HF5A 4LAFA 4XTCS 1QRSA 4L5CA 4FU0A 4PLHA 5K8TA 3K6SA 1O96B 4YAOA 3H2YA 4BGUA 3KE8A 3SPXA 4FDLA 3K92A 1EDDA 3FUCA 4ALIA 5JXWA 3PQDA 4LF4B 2G28A 1JUDA 3FRIA 1SKAA 1PCXA 3WGGA 1IWPB 1PL8A 2A9JA 1NR5A 4C3ZA 2Q9BA 3V7YA 4KWIA 4RJIA 3RVMA 3KT0A 1MVOA 4JITA 1DEKA 2A6PA 3BWBA 4IMRA 1CB0A 3W8FA 4JWKA 2ZTLA 3IA2A 1LDBA 2DHDA 3JR3A 4CQLA 3AR7A 2GJKA 2R8ZA 3H0CA 2WJAA 3DE2X 4JI1B 2FSVC 4IXNA 4JOBA 4MKRA 3RU7A 3E05A 5ENDA 3LY7A 1FX0A 1TUBB 3R3XA 4XM2A 4B4DA 5EVJA 2BM1A 1YS4A 5LQNA 4RETA 3RVNA 2CNKA 3VI3B 2AFHB 4LRXA 3G8AA 5FH9A 4UHDA 3ET5A 1T10A 3ED5A 2JGLA 2QXTA 2NVOA 2OBMA 2R68A 4KLAA 4FTWA 4J4BA 3ASYA 1FLDA 3TZLA 1ARZA 4DG9A 3QM1A 4J0EA 3HP7A 1QIEA 4DCVA 1GTSA 3HN6A 1JZTA 3GRKA 4G9GA 2W4MA 3ZNPA 3QIVA 3VDNB 2IYPA 4JR2A 5LA6F 2OORA 1BXZA 1H9CA 4Q3CA 4P7BA 5F76A 5DDIP 1YFZA 2Y6VA 1MENA 4OMFG 1M34B 1XTPA 1W2HA 4D6YA 4HDQB 1M73E 1NZFA 2ZR0A 3A8TA 3P4XA 1AS2A 1QVWA 1RHQA 1VGQA 2C4HA 3D2BA 4KQ6A 4ZQBA 4ZV4A 1L5SA 3PRJA 5F78A 5CB6A 1R8JA 2W6JD 1N1MA 5DGHA 3C5WP 1ZZEA 1FUIA 5JD3A 4Q4DA 4M86A 3RSGA 3ZE7A 3FUVA 1ZUHA 4TXLA 4MDYA 3HVIA 3LUKA 3HU5A 4MA0A 2RD2A 5LP6B 1M3SA 2V6MA 3IAHA 3KP1A 3L6OO 4PZ9A 1LW6E 1YNOA 2W6OA 4V24A 1B8OA 1NFQA 1JYEA 2ASVA 5A6SA 4OLBA 3R7NA 2QTTA 1R4NB 4LYAA 4OBWA 1M74A 3UB4A 4JD5A 3VAYA 1US8A 2IHTA 1E61A 1Z06A 2Q07A 3E1GA 3QKRA 4W5JA 1UIRA 1DARA 4G84A 1U0RA 2Z4RA 4C05A 3VH3A 3K9LA 1TUIA 4A1FA 4AMVA 2HIGA 3L7JA 3UV3A 3OTOB 2X1MA 4IMIB 3HXOA 3R76A 4UUBA 1T3ZA 1VPEA 1KH2A 3MJEA 4KVZA 3Q88A 4P98A 5CHYA 5ERGB 2BFEA 1C7IA 3AQ4A 4CZ2A 3IAM6 5D2CA 2VXBA 1D2MA 1JPJA 2HMUA 3E3OA 1EM8B 4L0QA 4BBPA 4M21A 3TIFA 3PQCA 5IFLA 1SY7A 4AY4A 1YB1A 4MLCA 4BDSA 3RYCA 1RM0A 3L7OA 4CMCA 3OLYA 3VVMA 3ZHCA 4P3XA 1QZXA 3M1AA 4HEHA 1FSPA 1NNLA 3NI2A 3LECA 5KAMA 2JEYA 4G86A 4XX1A 4YRJA 4HATA 4D74A 1ZRSA 2D2FA 1U9JA 2ZE6A 1IEVA 4HAXA 4L1KA 2WICA 4DC9A 5KYWB 1XTVA 1GGNA 1N5LA 1MEOA 1PWYE 1ZOIA 2R8OA 4R7TA 3U4DA 4CPDA 4F2WA 3HR7A 1Q57A 1ZIXA 3TLEA 4FBLA 4N7BA 1Q3KA 4RKYA 5JO0A 2IU0A 4N6NA 4MRSA 4HLUA 4DT1B 4IIJB 1JQJC 1MOZA 2P4EA 3FNHA 4BMNA 2O8BA 1TO1E 2AQ8A 1R5OA 3UHOA 2PX5A 4DYHA 5EJ8A 1TLFA 3RFUA 5JAPA 2AYXA 4D42A 2HSWA 3WR5A 2DG2A 2P3SA 3R7BA 2VSYA 1L4BA 4IKPA 5IZ4A 4ID3A 4XYBA 2ZDGA 2PWYA 1E2BA 3ZE9A 4ZDKA 4UE6A 4XARA 4IOKA 2I78A 3AM5A 2ONZA 4OQPA 1W4BA 4WK0B 3IP9A 4ZAGA 5U4QA 1UJ4A 1E7RA 1IJBA 4M1EA 4LVNA 3SQMA 1DJNA 3W3ZB 4XRRA 2W8BB 2B7CA 3F7OA 5J1TB 2XCSB 5KVCA 4CTJA 1Z2EA 1JJ7A 4JVLA 4BO7A 4D0GA 1II8A 1BGVA 1JR2A 1HDRA 3HBAA 2HO5A 2O7RA 3AF1A 3BULA 2VZ8A 5TSDA 4EFLA 1X7XB 1YI0A 5IMSA 3QXJA 5DNEA 1OWNA 4JL6A 1Y48E 2H9YA 5TXGA 3FMVA 3L5KA 1ZJJA 3AL2A 4W8HA 4KZKA 2BF7A 1E5DA 2HXSA 3R5SA 2C31A 3EVEA 4M88A 3GEIA 2ZLBA 2CW5A 2WA2A 3OJCA 2V7UA 1VECA 3P52A 1YJCA 4MQEA 1EGVB 1FL9A 1RZUA 2HY7A 2GOYA 1PQYA 3AJRA 5BYJA 4OQDA 3SQNA 3ZQKA 1SHZA 2F3PA 1FQJA 5IAAA 2FRVA 3U37A 3MTGA 1PNQA 1G8GA 1TIPA 3TI7A 5EN4A 4OP1A 3PE4A 4O1IA 1WG8A 4HGZA 4RELA 1QK5A 4JP3A 5MFPA 1GPMA 3I8XA 2VTVA 3KKKA 2OSBA 4B17A 4QXRA 1BOOA 1XFAA 2VQEB 2GZ2A 3LV8A 2IS2A 1E5QA 3IAS1 4JQOA 1LF5A 1TQDA 2GEFA 4HWRA 1WE2A 4BDTA 2WLSA 1JHQA 3NCTA 1FDSA 1U0OC 2AYZA 3K9WA 1NVWQ 2CHVA 1DC8A 2WPDA 1M2NA 2ZAOA 3H1FA 3UBTA 4JYPA 4EELA 2IQIA 4G2NA 1SVMA 4PZLA 3FX2A 3PYMA 4QOEA 3F78A 4RTKA 3TW8A 4A8PA 1C3LA 1RYHA 3WGLA 3TYXA 5A02A 3UOWA 1UJNA 1QRUA 3O73A 1IXRC 1SVUA 3B6MA 2TECE 4JBIA 4OYYA 4PYRA 3GLIE 3W1EA 2X0IA 1P6UA 2CMKA 4KXYA 2A5FA 2ALJA 2GBLA 2J48A 4N0MA 2FQYA 1M72A 5JAHA 3DQPA 3TG2A 3ESYA 1JKFA 4WEOA 1WZCA 3ZZMA 4X61A 1KBQA 3NNDA 1TX4B 2AMLA 3KYCB 4K46A 3TIGA 1U63A 5KYVA 3STUA 1NBME 3IP3A 1CUSA 2FG5A 1INLA 3LRPA 4PX5A 1UPBA 3ESBA 1SWWA 3TDNA 5KJ1A 5FI1B 5CMLA 1G3IA 4UPEA 3FBTA 4F4IA 1JQLB 2WF9A 1N2IA 1MG5A 1ZG3A 2GBPA 3H9QA 3MWLA 4YRGA 3EEYA 3JXEA 2IUYA 1UMBB 4TN5A 2QPOA 5EUBA 2H92A 4BRSA 4MLZA 3B20A 4LG1A 3RUAA 3TMYA 4KJXA 4WXYB 1T3LA 3X2SA 5J23A 2PSSA 1Z37A 3VV3A 3TPCA 3W34A 4IS3A 5JCXA 2YIDA 3IBGA 1Q84A 1MBZA 3DMRA 3K72B 5EXDA 3FY4A 2C4UA 3AUTA 1WCV1 2EJCA 4Q1BA 1HT0A 5B12A 1O0BA 2JCBA 1FJ2A 3H5OA 4LMAA 2Q8NA 1H66A 1NAIA 1YZVA 2P4HX 3KFLA 5DI9A 3T9CA 1RNLA 4B33A 3QY9A 2WFMA 5DX1A 1AUVA 3NIGB 3HQ4O 1X9IA 2AEJA 5FOWA 4OBEA 4FWIB 1CEYA 4XPIA 1TA0A 1WUYA 3T99A 1E89A 1Q7EA 3P71T 1A7AA 1BMFD 4LE1A 1NVVR 3AVOA 3GCZA 4ZEMA 1SZJG 5LBUA 2XSZD 1FJHA 5IRCD 4IX1A 5AD1A 4LXTA 2H5IA 3AHIA 3PFGA 4QDUA 1G8YA 2EIHA 2YNMD 4TTAA 1N33B 5B7NA 4UKDA 2QUIA 5ALIA 5KO2A 3IVAA 1E98A 2ZYDA 1EZ4A 4C5BA 1UZAA 3VKUA 1K63A 1ZH4A 2V03A 4G2TA 4M0KA 5BWNA 5J4HA 2JGFA 4QVKA 6PFKA 2QX4A 3ESCA 3LZDA 4RE6A 2QUKA 2FPPA 2BFPA 4NJMB 3SZMA 3VPDA 4D3ZA 4CEHB 3IP1A 3BWEA 1Y4SA 4QXQA 4CFYA 2VATA 1XRSB 4KNVA 5ETJA 4HL6A 3IEPA 1Q1ZA 2PGJA 4WZAE 2VTBA 3MUNA 1F7UA 3EC7A 4PRZA 1Q77A 1SXJC 3EIXA 2EIXA 3ORHA 3WWYA 1L7EA 2RK3A 2W2KA 4NMLA 2GNOA 4RKWA 3K71B 3TZQA 4B0PA 4IZHA 2VWQA 1J0EA 2C7GA 2R66A 3BRQA 5U4XA 1IY9A 4ZXFA 2FPWA 5H3LA 3ZNQA 3FI9A 2GT1A 3CCCA 1CQIA 1KEPA 4D8VA 5JAOA 2DF8A 1I5RA 4YI3A 5HS4A 2GFIA 1Y6ZA 4QX6A 1ONNA 4A8JA 1ECJA 1PN3A 2QQGA 2Z57A 3ZD6A 1H4QA 2OHIA 1SR8A 1N2EA 4HFMA 4O2BB 1EDBA 4H7FA 5BMVF 2D2IA 2ZBQA 2JATA 1JKJA 3KE9A 3EGXB 4NDZA 4S1PA 5CA1B 5E9AA 4TSKA 5BR8B 1XG5A 3BXOA 1Z22A 3HLKA 1USIA 3SM3A 2Z9DA 4CDNA 3LBNA 5IKOA 3NEJA 4MO9A 4PLCA 4XJXA 5G02A 4PAOA 1D4ZA 1NJ2A 4R83A 5AVKA 1I94B 2X41A 4ENSA 5GONB 4UEQA 3U6KA 1ETUA 2NU7B 4FHDA 1Z34A 4UJ5A 3F67A 2EL7A 4N7RA 3SC2A 3EIHA 3EQZA 5HP4A 1ORHA 4RPLA 5HHTA 2GO7A 3OEHD 3FMPB 3CRMA 3QWIA 3C5VA 3VZRA 3E9MA 3PC8C 3KCNA 4DWJA 4YRAA 5C5DA 1G5IA 3SFZA 2JFXA 1SOUA 1QHYA 2I2AA 4D7AA 1CW2B 1QG4A 2IYTA 1PTJC 3D4LA 3KT6A 4N01A 1OBCA 4I50B 4IPTA 4RYLA 1TKBA 1XNQB 1Y8RA 2CWWA 3I05A 3ZR4B 5B3AA 3MMZA 2H1SA 4NFYA 4BJHB 1YI8A 4CMGA 3OCUA 4QHYA 4CEJB 1MGOA 3OSUA 1N5RA 2CMDA 2J5QA 2J4CA 1N2CE 2FJUA 1FVXA 3JRNA 1X80B 2C7PA 1XDWA 4WLVA 3TQCA 2P9ZA 1DRUA 2LWIA 2YDXA 3CTPA 1CPYA 3Q11A 4H6XA 4JI2B 2GCIA 4D4GA 3BXHA 3C3EA 3P9SA 3TJMA 4UDOA 1X92A 1RWWA 3H4IA 4DCTA 5KVSA 5EIOA 1RYEA 2VP3A 4EPYA 3T7KA 2EW2A 3AY3A 3VU1A 3WL8A 1I7NA 3OWXA 4KXQA 4OXQA 1M2VB 2IDZA 1Y34E 3OQOA 2R87A 5EEGA 4EGFA 3QWAA 4ZWNA 5FPSA 4PXYA 1IHOA 2AB0A 3HFRA 3Q9NA 2YJTD 1V25A 5ESRA 5I5GA 2R47A 1MORA 2VEOA 4DJAA 3SF8A 3W2FA 4A0GA 3N58A 4TXNA 2FMFA 1R9GA 4EYOA 4TKUB 3D6FA 2VUSA 2Y71A 1I36A 1OU0A 3OAAA 2Z6UA 3U7IA 5HQ3A 1E5VA 1W0JD 4E11A 2DEUA 1CS0A 1YB5A 3L6BA 4I9HA 3A36A 1SHTX 4BO8A 5LOVF 2EKZA 4RXMA 1OWLA 5FORA 5C32A 3OZ7A 5AWFC 2I2WA 1ZN2A 2SBTA 3E7PA 5L8VA 4V2UA 1B74A 2D4AA 1Z0AA 1LKZA 1QR6A 2WSLA 4X92A 3RK4A 4A0HA 3GLGB 3RWOA 2HBQA 2PFKA 3RG8A 3REQB 1NJ5A 3VPSA 1SHJA 5HW0A 4LYJA 4P36A 5TQ2A 4DDVA 4TWJA 2Q3LA 3GUYA 3VO8A 4Z9XA 4BLQA 1T26A 2JLVA 3ZZ0A 1NMQA 4NMHA 3KVRA 4I99A 3RYHA 1JX6A 3QFFA 3H42B 1VP9A 1L4UA 2WAAA 4UHCA 1BVUA 3VR1A 1MABA 5FPYA 5GAJA 1SBZA 4LFBB 3N2GA 1XV5A 2OC9A 1PTKA 4DHWA 1RWXA 1KZ9A 2C1EA 2EZUA 2N1BA 2OCIA 1NYQA 3BB4A 3Q72A 4ZQIA 1SUDA 1CUBA 3DFZA 4FFRA 1NUHA 4D02A 5KOIA 2BEVB 3AYZB 5EPUA 3GGSA 1WPGA 4G0WA 4KJZA 2X9VA 3FWYA 3BORA 4Y6PA 1G17A 1TAHA 1PFWA 1XKTA 5F7OA 3ZQUA 2W2VA 1WUHS 2YQ5A 1FFWA 3IHTA 3L6RA 1H0HA 4YCMA 1FYVA 1K68A 1H5NA 1ACMA 1NG1A 1PJZA 3OU7A 1LVHA 3QVKA 4EGAA 3NJ8A 1AIPA 1QOQB 5AHOA 3S2SA 2DERA 1ID8A 2IELA 1HSOA 1I0IA 2JK1A 3DBOB 3L82B 4CGYA 1UJMA 1DTEA 2E4XA 4D92A 2IEYA 2XZOA 1MA3A 1L7NA 4TSFD 3MJDA 4OQQA 2OGUA 3FPJA 3G5MA 2R65A 4Q4AA 4RKEA 1M1YA 1ZMRA 2X8JB 5KKAA 3W4JA 4GKKB 1FDRA 2I1QA 5DBIA 5E9JA 2O2EA 3DEZA 4PONA 3ZHYA 1O95C 4GYWA 4UJ3A 5CEEA 9LDBA 3NEYA 3OPVA 4B6OA 1QZUA 1P74A 3TLGB 1ONSA 3RS0A 4XD7D 5JJCA 2M1ZA 1KMCA 2OFXA 2Y0EA 4KIJA 1C14A 5AVOA 2E49A 5EKTA 3STWA 4F04A 2GETA 4X41A 1MAAA 1C5KA 2JFFA 1ANKA 4QBKA 4F6RB 2DFPA 4YJ2B 1ULBA 2Z4TA 5ICMA 4DJ5X 1MC4A 4M60A 4L5BA 4HLQB 4DAOA 4F85A 4JVNA 1SXQA 4PC6A 1FMCA 1NASA 1BMDA 4JBXA 1T25A 1XJQA 4XWAA 2H2FA 4LJLA 2AC4A 4QGHA 3KJIA 3DDZX 1V1RA 5BRNA 1IB0A 2AR7A 3D8NA 3DT6A 2AH5A 4MPTA 2QZJA 4WL0A 4ZALA 4K9QA 1YJ5A 2A1UB 2Q8PA 1ZRMA 1DO8A 1ZQ9A 3HKCB 3UK7A 1W49A 1JRLA 3V46A 2UZ1A 4JSYA 3DTVD 3SS8A 8AT1A 4MUXA 2NZJA 2P69A 5F64A 2YICA 4MJ3A 3RUEA 4PNHA 4BVBA 4RD6A 3TQQA 1CDDA 2E48A 4BVHA 1BWRA 4LKRA 4YMGA 4S3MA 1N9GA 4ZDWA 2FWRA 3PFKA 3SY8A 2OYRA 4IM7A 4U4AA 1TGVA 4Z86A 4ER5A 1EUCB 1RI5A 2JKYA 4JI4B 3PGJA 1EZ1A 2WMDA 2WKPA 2P2CA 2VJCA 4RABA 1U3CA 1U99A 3SS7X 3OMXA 3GFVA 3EZ2A 5JH7F 4A36A 1B3BA 2FRXA 2FGKA 2WYVA 3GHHA 4NEQA 5JJIA 1EFAA 2EP7A 3A2NA 1NBIA 5DMXA 2Z5FA 3G3EA 3QVMA 2DR3A 4E3WA 3M4JA 5K0SA 3FTQA 3DKKA 1MX1A 2G71A 2VCHA 2HT1A 2VH1A 5EP1A 2IDMA 3GLKA 1T35A 4TTTS 4DM7A 3C6XA 2ZIWB 3M5PA