4MDHA

Refined crystal structure of cytoplasmic malate dehydrogenase at 2.5-angstroms resolution
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
333
structure length
333
Chain Sequence
SEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEEIAFKDLDVAILVGSMPRRDGMERKDLLKANVKIFKCQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTSDDVKNVIIWGNHSSTQYPDVNHAKVKLQAKEVGVYEAVKDDSWLKGEFITTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGIISDGNSYGVPDDLLYSFPVTIKDKTWKIVEGLPINDFSREKMDLTAKELAEEKETAFEFLSSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined crystal structure of cytoplasmic malate dehydrogenase at 2.5-A resolution.
pubmed doi rcsb
molecule keywords CYTOPLASMIC MALATE DEHYDROGENASE
molecule tags Oxidoreductase(nad(a)-choh(d))
source organism Sus scrofa
total genus 104
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 1989-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4mdhA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4mdhA02
4BNHA 3ZDFA 5GZ1A 4J1SA 3F1KA 4TVOA 4KTTE 3SC6A 1G0NA 2C0CA 5DBIA 4YPOA 2NACA 4OQZA 3VH3A 3DBLA 5A06A 5A05A 1IPEA 2C5EA 1MC4A 3BMCA 3I5MA 5DULA 3SJUA 4PLCA 9LDBA 1UXJA 1IULA 1YQXA 1R4NB 3CIFA 2X0IA 1TT5B 5JO0A 1EE9A 3KSDO 3H7AA 5JPIA 4NMHA 2DQ4A 5G0WA 1FMCA 4A0SA 1PJCA 4OXNA 3QLJA 4DMMA 4R4JA 3VDQA 4YTEA 4JIGA 3OJEA 3GK3A 1HKUA 3VPSA 4M54A 4BO1A 1RPNA 3GVXA 5DZSA 1VLLA 5TF4A 4A5OA 4MIEA 2HKIA 5TS3A 2NADA 1M66A 2ZTMA 4XGIA 4EUHA 5I7FA 4I5DA 1PU2A 4X54A 2AE1A 2VHWA 1K3TA 1X0VA 3SXPA 1M6HA 1F06A 1JVSA 1NVGA 1SAYA 3NTOA 3Q3CA 1LDYA 3I9OA 3C1AA 3AW9A 2OBYA 1MB4A 2ZYDA 3I52A 3LT2A 2NM0A 2VUUA 5JMWA 1LBEA 1T2DA 2J3IA 1G1AA 3NUGA 3DBLB 4UEKA 4BO3A 3Q2IA 1WWKA 3L6EA 1PGPA 2X1HA 1HRDA 3BMCB 2G1UA 2I76A 4IQGA 3RVDA 4FOOA 3HUDA 1YBVA 1E7QA 1H6CA 5HA5A 1BXZA 3HDQA 4U0JA 1EFLA 2FZWA 1OC2A 1Z82A 3EDMA 2R00C 4B4VA 4FFPA 1V9LA 1O8CA 1P77A 4DREA 1U28A 4QXMA 4BGUA 1K5HA 3VTZA 4KUHA 3L77A 2YFHA 3DZKA 3MJTA 4JJGA 1LC0A 4GX5A 3DOJA 4R3WA 3QWIA 1QLJA 1OZAA 4WCFC 1V3VA 3VOSA 4L4SA 2J5RA 1ID1A 1E1KA 3H9EO 4NZ9A 5I7EA 1YQDA 3PJGA 3U62A 3KB6A 4CR7A 1MUUA 4NFSA 2SCUA 3FF4A 3NTRA 3PQEA 1GZ6A 2QYTA 3R6DA 4MPDA 2VRBA 4F46A 4HY3A 4I9NA 1YGYA 3JSAA 4E31A 2VT3A 1I36A 4FCCA 2ZB7A 4BMSA 1PGOA 5A5EA 4L76A 2HQ1A 3NV9A 1T4BA 1IHYA 2O2YA 3PQDA 1WDKA 1DC5A 3GDGA 1VI2A 2EXXA 1VSUA 1V8BA 2AEMA 2B37A 4MVJE 2JAHA 2X86A 4P22A 1JKIA 1GYPA 4EUEA 2BHLA 3H2ZA 1UDAA 3N74A 3AU8A 5IDWA 1EUDA 2D3TA 3W8EA 4WCDA 3PYLA 2VUSA 4U0KA 2PLAA 3E9QA 3OA2A 1MX3A 3SEFA 1DRWA 1E3IA 1NFRA 4J4TA 5F1PA 3B20A 3PWKA 1DB3A 1KEUA 2JL1A 1UP4A 4YCAA 4Y8VA 1FXSA 3TQHA 2E48A 4OM8A 3TFQA 3HJAA 1O94A 4NQZA 2NLOA 4S3MA 2GR9A 3AWDA 2H9IA 1PJ2A 2DC1A 3I9MA 2RHRA 4TRRA 3WJ7A 1BGVA 2BGKA 1F0YA 1PZHA 4WECA 2NQ8A 3JQ7A 1DFIA 1AUPA 3C1TA 2HRZA 2R2GA 2Y1EA 4TROA 4WOKA 1SNYA 4FD3A 3I23A 1EUCA 4GGOA 3EYWA 4AJJA 1BG6A 2QQ5A 3AI1A 4J2HA 4CLHA 1D8AA 2IEBA 3AOGA 5ILGA 1PIWA 1Y7TA 1NVMB 3MTGA 3KTDA 2YDYA 1ZK2A 3EZLA 4GAEA 2D2IA 3TZQA 5JC8A 3F5SA 2WYVA 4DL9A 2VZ8A 5HS4A 4PLTA 5L4LA 4PLHA 1Q7GA 3FR7A 5K6AC 2W2KA 1GD1O 4R16A 3GRKA 5JO9A 4NNJA 5L45A 1N92A 2HMTA 2IXAA 3UCEA 4BNYA 3I9LA 3NKLA 4ZRNA 2FR8A 1LX6A 2DBRA 4GX0A 1NPDA 1YKFA 1PJBA 4IQ0A 2Y93A 3NGLA 2X9VA 2C2XA 2CNBA 1HE3A 2C07A 4RORA 4BKQA 1ENYA 4R1TA 3AJRA 4BNNA 2Y1FA 1Z6ZA 4WLUA 2C20A 3I6QA 5JY1A 3ONEA 3JQ7B 1N7GA 4HNGA 4GLLA 4DIBA 1HT0A 4TKMA 2C59A 1PZGA 2B83A 4NG5A 2YW9A 5JYDA 3VPXA 3Q1LA 3FNEA 5IZ4A 2J5KA 3ANMA 3GGGA 5JAIA 3LC1O 4IDEA 2R6JA 3TNLA 4IMPA 4R9RA 1VPDA 2W2LD 2FWMX 4IM7A 5T6BA 4W99A 5TLSA 4MVJA 4R68A 1K6XA 5DT9A 1XA0A 2R00A 3RWBA 4C7JA 1WLYA 4E0BA 1PL7A 1LRKA 3U4HA 1RM5A 4N18A 4CV0A 4MDHA 1E1NA 3E82A 1I0ZA 2W2KB 1H2HA 1H9AA 3DZHA 1QP8A 1DC4A 1GTMA 4BGEA 4RL6A 1P1JA 1X1EA 4WCFA 5FYDA 4B4OA 2PGDA 2I5PO 4QECA 1WNTA 3W1VA 4DPMA 5HTOA 4I5FA 3C3XA 2ZATA 4BQPA 3RFVA 4QT0A 3F4BA 2AXQA 2PKQP 2O23A 1J0XO 2PH3A 1E1MA 4Y6RA 1B16A 3KSZO 3D64A 3PJEA 3CE6A 4OYRA 5IN5A 3GGPA 1UZLA 3DMTA 1I33A 5TIIA 5C37A 4YAGA 1AGNA 4R5HA 1V3TA 4RLSA 1E3EA 4B7XA 2B5WA 4CLXA 3H9JA 2VNSA 1TT7A 3V5NA 2I67A 5ENDA 2JAPA 2FR0A 3GN1A 2Y1CA 3FCOA 3KO8A 1X0XA 4K28A 1LEHA 2AG5A 1P3DA 4RVUA 4CM1A 1MXFA 2BFOA 2DM6A 5THQA 3OSUA 1E3WA 3K2EA 5JDCC 4YRBA 1NFQA 3BIOA 3NT4A 3S2FA 4BNTA 5T5QA 2DBVO 2XPCA 3DTTA 1QLHA 1LTHR 5EN4A 3LLVA 5LCXA 3PXXA 1KVUA 3ADPA 5EIOA 1HLPA 2HAEA 3H4VA 1SOVA 4WCFB 2B0JA 4XYEA 4Y6SA 4H3VA 1C3VA 3WSWA 1IHXA 4R1SA 2YJZA 1LSOA 3L9XA 1BRMA 5TX7A 1F17A 1CJCA 3WYCA 4J4HA 3RQSA 2NVBA 1ZSYA 4RF2A 3RUDA 2BFAA 2Y05A 3CTMA 1B8UA 4YB8A 3PHLA 1Q7CA 3WNVA 1MC5A 4KWIA 1GPJA 4YQZA 1GFSA 2DPGA 3JQCA 4UUNA 3LQFA 1VRWA 1DHTA 2CFCA 4P4LA 4CJXA 3JYPA 3E9NA 3WBBA 2VZ9A 2PKRA 3EAGA 3A28A 3Q11A 5IFLA 2P91A 5LDHA 3MJ4A 3ZWNA 3GZNA 2WYWA 3OQBA 1E3WB 4ALIA 1UAYA 1UJMA 2VOEA 4FC7A 1H93A 3HN7A 4E5MA 4Q3NA 1WZEA 4M87A 2XXJA 4OKNA 3I9JA 3FTNA 3MOGA 4LGVA 4OOFA 4JROA 4CUZA 3RBXA 4Q3EA 3T4XA 5C5IA 4CUJA 1MLDA 1KVQA 4AJIA 1YB5A 4Q39A 2Q2QA 1ZMOA 2O7SA 3FR8A 3OQ6A 5L40A 2FP4A 3M1LA 4ALJA 3DFUA 2WE7A 4R69A 3DO5A 2P9EA 5BNTA 3F6YA 1U3UA 5EQDA 3WNQA 3WFJA 5JYEA 1GPDG 2Z5LA 1O6ZA 3BXXA 4E12A 3OP4A 3K5PA 1NWHA 1YVEI 9LDTA 1F14A 2WM3A 4WUVA 4AL4A 1PSDA 1QYDA 4UVGA 1W0CA 2FSVA 1KBZA 3VC7A 1U5AA 2ZK7A 3GC6A 2RCYA 2VN8A 2DKNA 1S7CA 3GZNB 4PZEA 1IYZA 3ZWWA 1LUAA 3JQ6A 4YR9A 1LDGA 2D1YA 2PY6A 5A03A 3ZU5A 3PJDA 1HDYA 1RWBA 1RYEA 2X4GA 1S6YA 3L6OO 1SEVA 4HFMA 1ZMTA 4CLOB 1X7DA 4PLVA 1VSVA 1CEQA 2EW8A 4RF3A 3HG7A 5BNFA 3O26A 5HM8A 4IDCA 3G0OA 5DCUA 4R1UA 4DBVO 1E7YA 2P2SA 3A9WA 1T2FA 2PV7A 2AQHA 1B8PA 4RDIA 1XR3A 2Y0EA 1E3SA 2CUKA 1F8FA 4KDEA 4BO7A 2E6UX 1XIVA 4QEDA 3ZHZA 2P5YA 3PFFA 1HDZA 2QZ9A 1FDSA 2D5AA 3OF2A 3PZRA 1JWBB 1P1FA 4EJMA 1R0KA 4YT5A 2G76A 5CDYA 5C7IO 2DUUA 3OEWA 1MA0A 4FJ0A 1R37A 4DQVA 3TJRA 3HN2A 5A9TA 2DTDA 4XB2A 3RU7A 5JCJA 4HADA 1SMKA 8ADHA 3PK0A 3IJPA 4ILKA 4GVXA 3GNQA 3ZU4A 1Y8RA 3K92A 4A03A 1UZMA 3G17A 3PGJA 2FHSA 4UVIA 1I3NA 4E2XA 2DUWA 1N7HA 5JDCA 1UUFA 1DJNA 1MFZA 1Y8QA 4D0SA 3DMYA 4UREA 4BS9A 2HCTA 4J43A 4MVJF 1UH5A 1QKIA 2GGSA 4PLYA 4AJNA 2DBQA 1PJQA 3UH1A 4EGFA 4LCJA 2NV6A 4AJEA 1H2BA 2OHXA 2OP0A 4HP8A 1U2GA 4NH4A 4NFHA 1NXQA 4DWVA 4FFMA 4LN1A 5CDUA 5IDQA 4YWJA 3SJ7A 3KHUA 3K31A 3DZIA 3DOCA 4EJ6A 1HDCA 5AXDA 4L75A 3ZW9A 3GPDG 1F8GA 1OOEA 3D3WA 4MP8A 4ND5A 3P19A 3VZQA 1RKXA 2NTVA 4I1IA 3ZWOA 2E4AA 1FK8A 5G4LA 3ZHYA 1HYGA 2RH4A 3EVNA 1YO6A 3DZBA 2YQ4A 2AW5A 2VRCD 1DOHA 2FY8A 4F3YA 8LDHA 4U6QA 4FFLA 4G5HA 3WS7A 1OC4A 1T2CA 1Q0HA 3DHNA 3R1IA 3NEPX 1Y8RB 1R4MA 1RJWA 3UCFA 2HJRA 5G4KA 1JQBA 3OIDA 4K26A 1Y8QB 3ZWVA 2PD3A 4RF4A 3ZWAA 4UULA 2H63A 4LCEA 3X2EA 4YRAA 2C54A 1A9YA 3G79A 3RROA 1H6BA 4OMUA 5ER6A 1UZNA 2IYPA 4N54A 1BMDA 3ETEA 4DA9A 4H7PA 4OIMA 1YL6A 1HE2A 4BO9A 4MIOA 1UXGA 3DBHA 3N7UA 2QW8A 2I9PA 2G17A 2RH8A 4G2NA 3RC2A 5L7WA 2UVDA 2Q1SA 4CMBA 3D3WB 3TZHA 3ZV6A 3U4DA 1HZZA 3IMFA 3ZU3A 2EP7A 4CODB 4XZ3A 4WJZA 4MO2A 1ZK4A 3GOHA 3FBTA 2QYSA 4IMRA 1ISJA 2VOJA 3S2GA 2PKQO 5TT1A 3JQBC 4ROSA 2VHYA 5B12A 3GH3A 1HXHA 1C0KA 1YE3A 1QYXA 4B7UA 4E2YA 1R4MB 1U4SA 5I8WA 2X5KO 2EGHA 4M1QA 2X8LA 3D4PA 1N2SA 2G0TA 3DTYA 5G4KB 4Z3DA 3L4SO 3AUUA 1EK6A 2ZCUA 4BQRA 3LVFO 1I24A 3TOZA 2X9GA 4A73A 4E30A 3PEFA 5BNIA 3WLFA 4YACA 2J8ZA 1N1GA 3P7MA 5IJZA 4O0LA 1WP4A 5TJHA 4IINA 5LDGA 3WYEA 5KWEA 5IDXA 3ZWXA 1EVYA 3DBHB 4ALNA 3JQAD 2NVUA 3WGGA 3V2HA 4AJOA 3PVZA 4XYMA 3FNHA 3GZ4A 3UW3A 2C5AA 4DQUA 3IKVA 2AQKA 3ZH2A 4W6ZA 2YQ5A 3SC4A 4GH5A 1C1XA 3HFSA 1NHGA 3AM5A 3QWFA 3LYLA 4O6VA 5L9AA 4XGKA 2YYYA 4L0QA 2CMDA 4IXTA 4J3FA 3WX0A 2X5JO 2HUNA 1SO8A 3GUCA 4CLEA 4LRSB 1XKQA 4OSOA 4BGVA 2OMEA 3FNGA 4BNJA 3DZGA 2AA3A 3HSKA 4PG7A 1NVTA 1ADBA 3AUSA 2B5VA 4NI5A 2P4HX 3E18A 4RO0A 1GUZA 4YA6A 2IZZA 3ZV5A 3RC7A 2AE2A 4XR9A 3G1UA 3GGOA 2JFFA 3MJSA 5B37A 5CDTA 4HUJA 3UAGA 1BVUA 4KWHA 5T57A 1Y6JA 4FJ2A 3S1LA 4D46A 1GZ3A 5HRUA 2P4QA 2EJVA 4TRJA 4TZKA 5ADHA 3OA0A 5JC1A 3ETGA 2NVUB 3LC2O 4AJKA 1IUKA 2EERA 2GCGA 4M86A 1E5LA 1I2CA 3PYXA 1U3WA 2CVZA 3QSGA 1WDMA 1Y81A 4NBTA 4CM8A 4D43A 4ZQEA 5T67A 3KOUA 4QFDA 1I3LA 3RI3A 3ITKA 4CMCA 1C1XB 1QV7A 1ZK0A 4PCVA 3AK4A 2I6TA 1YOVA 3ZW8A 4OXYA 3ZV3A 1HYEA 3FD8A 5U1PA 3LF2A 4WNIA 3WQSB 4II3A 2X23A 2WSBA 4ALLA 4BNXA 3QVTA 4M55A 4YAJA 3L6DA 4BKPA 3AOEA 1ZJYA 3A1NA 2WWRA 4MP6A 3ST7A 5IDYA 1W6UA 2UAGA 1HTBA 4CQMA 5IZCC 4CMJA 1EQ2A 5F21A 2NU7A 4MINA 5CPFA 4DXHA 1ZXLA 2PZMA 2VWQA 3NX4A 4IGEA 4R51A 2PH5A 1YWGO 2O3TA 4CMGA 2NU6A 4J2OA 4WLVA 3DXFA 4GLOA 2DAPA 3U09A 4LVUA 3FPCA 5TQVA 4BMVA 4GKVA 3DL2A 4MJLA 4B8ZA 5JAMA 3I9KA 4RVDA 1H9BA 1HDOA 3Q6IA 5A02A 4RVSA 5TJ9A 5C7OO 5JDIC 4XX0A 1R6DA 4CM8B 2VWHA 3MCVA 1O5IA 3RBVA 2PGJA 1N9GB 3WTCA 5CG2A 4N5LA 3IUPA 4F6CA 1UR5A 4KUGA 1Z45A 2VTDA 2PD6A 4DQXA 1IOLA 2O3SA 2PR2A 4HBGA 2NUAA 3ZWCA 1YOVB 2OZPA 3BMNA 1LLDA 3G49A 2OP1A 3PPIA 3O03A 3JQBA 3ONFA 1KC3A 3Q9UA 1JW9B 2PGLA 3NJ4A 1L7EA 2EW2A 1U7TA 2X58A 1CQIA 3FNFA 3WYBA 5EPOA 2O3JA 1HE5A 4XQEA 5BSGA 3NDIA 4YYZA 4NDNE 4C7KA 4CQMB 3K8ZA 1A7KA 2Q1TA 3ANLA 1BVRA 1K2WA 3ICCA 3JYOA 4IS2A 3JV7A 4QUKA 5ENVA 1EBFA 5CEEA 5A5FA 3KYBA 1DJQA 4AJ2A 1Y9EA 3UOGA 4YAEA 1J6UA 3RUFA 2Z1MA 4JGBA 3DMTC 4ZVVA 1OMOA 4GX1A 4DLAA 4CM4A 1Q7BA 1Z73A 3BTVA 2VT2A 5COAA 3WSVA 4Q3BA 4YJHA 4JJFA 2C7VA 5TT0A 3LK7A 3LC7O 2EV9A 3D4NA 3OIGA 1A72A 3GG9A 4H15A 1SOWA 2JFGA 5A9SA 3E5MA 3QRWA 4D3DA 3IC5A 2FPPA 1PJLA 3BMNB 3E1KA 3G3EA 3HADA 3R3SA 3ENNA 3ROQA 4AG3A 4L9RA 3WMXA 2I65A 3GAFA 4UUPA 3RFXA 3PRJA 1Y1PA 3C7CB 3HDJA 3TZ6A 3H2SA 5KJ6A 1GUFA 4MKZA 2H6EA 2VYVA 3GVPA 3V1UA 2H1SA 2CVQA 2X5OA 1DFGA 1SCUA 2GN8A 1W8DA 3TOXA 3ZI0A 3PHGA 2GF2A 4MVJG 4DC1A 5KVSA 4KMSA 4CL8A 3GUYA 1GY8A 4PZCA 2JD2A 1A71A 2VZ0A 3IP1A 4MVJH 4CM4B 3VPHA 3PJFA 1R15A 3INRA 4YJHB 5EQFA 1B26A 2HLPA 2ZTVA 4L74A 1VJ1A 1LC3A 4IDGA 4IS3A 4QFCA 1U7HA 5DF1A 2HU2A 4EYEA 2NWQA 5A9SB 4BV9A 1HSOA 5KJFA 1P45A 3PWSA 1B7GO 5GMOA 3H5AA 1QORA 2HMWA 3KSUA 1YH3A 3WR5A 4CMHA 1GYQA 3GDOA 2V6MA 1C0IA 2Q49A 1DDOA 3PI7A 3MWEB 2JFHA 3WIEA 3VPFA 3OBBA 1ULSA 4OOEA 3I6IA 3WGQA 4CV2A 2Q45A 1Q0QA 2P68A 4DVJA 1ISFA 3LLSA 3W4IA 5G0VA 5IZCA 5U4QA 2BFMA 1I10A 3NRCA 1PGQA 2V7PA 4BNVA 2Q1WA 4FB5A 3K73O 4PVDA 2NU9A 3ONDA 3TPCA 4I9UA 1O9BA 1GU7A 1NWCA 1TI7A 1U5CA 2WDZA 2P5UA 4I08A 1GUYA 3H5NA 1XWFA 3RSHA 1DRUA 1LDNA 4B3HA 3DC2A 3DONA 4IUYA 1DEHA 4J90A 4TRMA 5JDIA 1GZ4A 4YT4A 1EDOA 4IJVA 1TVEA 1P9LA 3EUWA 1PWXA 3VZRA 3RUAA 4H16A 3OIFA 1V0JA 4LVCA 2TMDA 3ITDA 1X7GA 2GN6A 4O5OA 4B4WA 4DUPA 3RUIA 5I8ZA 2WEKA 5G2OA 1JWAB 5K9ZA 3JQ9C 4LSWA 5F1OA 5I7VA 2CDAA 3AI2A 3QWAA 5ITVA 1XHLA 1K89A 1C0LA 1XCBA 1EK5A 5CDGA 1JU9A 2Z95A 3VKVA 4CV1A 3DAPA 4J1NA 4UVEA 4DTIA 1QMGA 4CM9A 3GVCA 4E5NA 5AQ1A 2PTGA 3F5QA 4RQTA 1XYGA 2QX7A 4J0EA 4JBIA 3MOIA 4YJFA 1KY4A 1ZNQO 3ZZNA 4E2WA 4BKRA 2OOSA 4RPJA 1U8XX 5JLAA 4XIYA 1KS9A 2EEZA 5L53A 2HMSA 1TXGA 2D0IA 3KBOA 5FFFA 3C1OA 2EGGA 1YXMA 2VYNA 2DT5A 2ZB8A 4WEQA 2E82A 3OJOA 2BI7A 3A14A 3LF1A 1EDZA 1GYRA 4R5MA 4D45A 2DTEA 1PJ3A 2OXIA 4NIMA 1DLIA 1HYHA 1PWZA 2NSDA 4J1QA 2EKLA 1VL8A 4PGFA 4RV9A 3WGIA 5CEFA 1DSSG 4EEZA 2PFGA 3V1YA 1R12A 3VDRA 5L4NA 2CVOA 1HDXA 1MXHA 3GG2A 4B3IA 2BH9A 3KEQA 1R16A 2Q4BA 4CM7A 3UFXA 1DHRA 4AJPA 4BNZA 5TC4A 3GVHA 2HMUA 3WBFA 4CMIB 5JSFA 4QSMA 1BDBA 3SBOA 3ORFA 2Y99A 3NTQA 1T1SA 1DFHA 1AXEA 2CSUA 4YJFB 3C7DB 1N1EA 4ZU3A 5KJCA 3OECA 4OKIA 5KKAA 3V2UA 2HK8A 4KDFA 3F4LA 3K9QO 3QQPA 4D3FA 2BMAA 4OSPA 2C82A 3DEYX 4IXWA 1DIBA 2A9FA 3GLQA 4OGWA 4W9NC 3H6KA 2AEFA 4J91A 4AJ1A 4WNCA 1BXKA 3I4CA 2X0JA 3WICA 1EEHA 1T24A 5ICSA 4RZIA 4NR0A 1IB6A 4R01A 1BTOA 3RKUA 6LDHA 3ZNPA 1T25A 2OFPA 4OQYA 2O7QA 2JKVA 3WGOA 1BXGA 1KVRA 2FOIA 1IZ0A 4IQ8A 4ZJUA 3UKOA 1X14A 4CLOA 1Z7BA 4MVJI 1TLTA 1NYTA 5FWNA 2X7HA 3CMCO 4NBRA 2YY7A 2UV8A 1UDBA 1TA4A 4FSHA 2I3AA 4YAIA 5L95A 4BNKA 2BGLA 4IJUA 3WGHA 4KTVE 4RVHA 3CMMA 2G5CA 1EMDA 3F46A 2IYOA 4UUMA 2NU8A 3AM3A 3AY3A 3WLEA 1SEPA 2VCYA 2CZCA 4BNFA 4NBVA 4FS3A 5IAAA 1OBFO 4J9UE 1CRWG 2LDXA 3GHHA 4D7AA 2CF6A 4EDFA 3KYDA 3PGXA 1NQAO 2WE8A 1PZFA 2O4UX 3JQ9A 3JQFC 3KLMX 7MDHA 3WIDA 1E77A 4DPLA 1BXGB 3F1LA 4OHUA 3KETA 2OUIA 2OGUA 4EBFA 1HEUA 3CZRA 4WE3A 1O95A 4UEJA 1LLUA 3H9UA 4MVJD 2AQ8A 4BB5A 5DOVA 1D1TA 4HFNA 3JD2A 3O4RA 2GNAA 4YEDA 4ESOA 4BHTA 4ALKA 2NTNA 5CHEA 3ASUA 1YS4A 1UXIA 2PNFA 4TZTA 3RKRA 3QWHA 3WFIA 3DR3A 2ZJ0A 4RF5A 1PQWA 4CM9D 1CQJA 1D7OA 4WLNA 4RCVA 3RIHA 2D59A 2EF1A 3VAZA 2IE0A 1NHWA 4U8GA 3OJLA 2V65A 2B4RO 2ZTLA 1XGKA 2HDHA 2VQ3A 1RM3A 1F12A 1Y5RA 1JKJA 1R0LA 2VHZA 4RPHA 3VZSA 3D1LA 3GN2A 4IDDA 4L4XA 3EGOA 2I66A 3KYDB 2FR1A 5DBFA 2C29D 1LQTA 4D41A 1ZZEA 5DCWA 1B3RA 5JFOA 1ZK3A 3MJCA 5LC1A 3X2FA 3ZGYA 1PTJA 4XYGA 1HDGO 4GGPA 3E6AA 2X0NA 1KEPA 3COSA 2QRKA 2CDBA 1ADGA 3PHJA 3JYQA 3STHA 4BNLA 1Q2XA 1I32A 4CMKA 3INGA 1B2LA 4PLGA 3PP8A 2EG9A 1PR3A 1PX0A 2O48X 3GEGA 2EWMA 3DZJA 1NP3A 5U9CA 3EY4A 4BO5A 2OBNA 2ZQZA 4JBHA 1WPQA 2GD1O 4GI2A 4KUEA 2PZJA 1P1KA 3Q9NA 5CPBA 3JQ8A 4MIYA 4FQ8A 2QRJA 5F1KA 3V1TC 3HB4X 2FPIA 3BHIA 4DIFA 3P2YA 4EI2A 1PEDA 1E6UA 3BMOA 3DZFA 4W9NA 4S1VA 4XKJA 2JCXA 3LT1A 3ZNQA 1GADO 1PGNA 3DBVO 2YV1A 4Q3CA 3UN1A 3VVBA 3N58A 5I9NA 1VJ0A 3WXBA 1O0SA 1ZBQA 3K96A 4ND3A 3HWRA 5TRTA 2NNLD 1E7WA 1PGJA 1GR0A 4XQGA 2RBEA 2BGMA 4E32A 3BTOA 3U3XA 4D0RA 2HK7A 5CEJA 1FDVA 3GFBA 2ILTA 4LW8A 4NJOA 4K1LA 1ZK1A 5H82A 3AOEC 4ID9A 4E13A 4Z9FA 1PS0A 5J23A 3R3JA 4YVFA 4UVHA 2WD8A 3OQ1A 4RQUA 4XJTA 1GV1A 3B1KA 2PZKA 3H9GA 2A92A 3HDYA 4NBUA 3NT5A 4Z0HO 1P44A 2J3HA 1CWUA 3PLNA 3ZWPA 1I2ZA 1Z75A 4FFNA 3JQ8B 4I5EA 4GMFA 5C7LO 2WMDA 4XIJA 5L7YA 5ES3A 1X15A 1KY5A 3KUXA 4JP2A 4ZQGA 4FPXA 4NU6A 2FMUA 3BMOB 3M6IA 3H3JA 3BZUA 3C24A 3W4KA 1G6KA 2IZ1A 3U5TA 3L9WA 2LDBA 1T4DA 1HZJA 3KXDA 2ZYAA 4QX6A 1H0KA 1GQ2A 1ISGA 5T64A 2ZJ1A 2VUTA 4JK3A 2H5LA 5AOVA 4ZHSA 3QP9A 4R3NA 4IIVA 1E7RA 3FSRA 3JQFA 1HETA 1LLQA 2E49A 4JXKA 2Q2WA 4JQCA 3ASVA 4PVCA 4FBGA 1E7SA 1ENOA 1ENZA 2GDZA 4GSKA 4I8XA 3S8MA 1JLLA 3T7CA 1ZXBA 3W8FA 3WGTA 4HFRA 4N5NA 3GDFA 4IZIA 4IPTA 1GL3A 3B6ZA 2A4KA 4CR6A 3RC9A 1H6AA 4G81A 1TB4A 5KTKA 4QQRA 3QV1A 4GWGA 4CR8A 4J7XA 3OHSX 3AUTA 3B1FA 4NBWA 4TVBA 3MWDB 3KM0A 5I9LA 2EJWA 2YZ7A 2ZTUA 2Q4EA 3EC7A 2GUGA 2IDZA 1G0OA 1T26A 4BUCA 5EINA 2DPHA 3KRTA 3QHAA 5EESA 3ZV4A 3MJVA 5G0UA 1P0CA 4MKXA 3JD1A 4I9HA 2D8AA 1E3LA 3OM9A 2YV2A 2X22A 3ZWBA 3ON5A 2P9GA 5HBRA 4CL3A 1NNUA 1NR1A 1KYQA 1PS8A 4AJ4A 1PR9A 3O8QA 4Z3KA 1A9ZA 4KQXA 3PDJA 5EMHA 1B3BA 5CG1A 2A94A 4NPCA 3TSCA 2CY0A 5KVCA 4BNMA 5FEUA 1YB1A 1E92A 4J4BA 5JCJD 1BW9A 4PLZA 1WDLA 4IZHA 4XYBA 1WAMA 2Y0DA 2YHIA 3F3SA 4BKUA 1VL0A 4ZQBA 3PWZA 1QR6A 3AU9A 1DIGA 3EMKA 4HV4A 1SBYA 5HS6A 2WD7A 4B7CA 5JW6A 5AXAA 3INTA 3IS3A 4XCVA 3WDSA 1NAHA 2JHGA 2PD4A 4CM3A 3UF0A 1VC2A 4AJLA 3RUEA 1YRLA 5IG2A 1QXSA 3PHIA 1CERA 4BO6A 4O63O 1I30A 5A3VA 3TDKA 1M6WA 5JCXA 2EKPA 3PZBA 5JXWA 1N9GA 1GCOA 1NPYA 3D3EA 2BI8A 4UUOA 2O4CA 3JCZA 5KOIA 4Y67A 3NAQA 4K9DA 4B4UA 4BOYA 4IIUA 3D5QA 2OORA 4WLOA 1YB4A 1I8TA 1O89A 2FN7A 2O3RA 4M8SA 3DB2A 1A5ZA 4XJSA 1JAXA 4R41A 5JE8A 3KLPX 3MZ0A 1GQQA 3O8QB 2EIHA 1KVSA 2Y66A 4II2A 1B8VA 2YFQA 3OH8A 4PFJA 4PG5A 1AHIA 5MGBA 3DQPA 1BW9B 1DLJA 4PG6A 2Y1DA 4D79A 1YL5A 1J49A 1K6IA 2HO5A 2YHIB 1VKNA 4L73A 1E7MA 4YJDA 5IN4A 2WD7B 1FDTA 5DNAA 4FIZA 1ISMA 1QV6A 1PJ4A 3BHMA 3I9NA 5GZ3A 3B1JA 3BTUA 1UXHA 5FI5A 3GA0A 4E21A 1Q1NA 3HDHA 2CDCA 4DYVA 3GFGA 4ND4A 2Q2VA 2WYUA 5A1TA 2GRAA 3T4EA 5A4DA 4A10A 4C4OA 3TRIA 1DC3A 1NM5A 2E37A 2NQTA 2ET6A 3CKYA 3HHPA 5JNLA 3ZHXA 1K6JA 4CMEC 2GZ1A 1ONOA 1D3AA 5COQA 2PWZA 4NK5A 5FF9A 3OJ0A 2BRUA 4IDAA 1ISIA 3S2IA 3GEMA 5A9RA 2IRWA 2YUTA 1CF2O 1N8KA 1DXYA 3WWZA 4AICA 1V3UA 1X13A 1ZSVA 1ENPA 4BO2A 4A2CA 2W2LA 3JQEA 1XSEA 2JCVA 3DOOA 4WPGA 1ZCJA 4DIOA 3JYNA 4BO8A 4EEXA 3HZZA 2EP5A 3L4BA 3UHAA 1LSUA 1LQUA 3TL3A 3EZYA 4FGWA 5DN9A 4PLPA 3V8BA 2ZYGA 3TF5A 2PK3A 3M2PA 1U8FO 4A27A 4UAGA 4CM6A 4PN3A 4Y98A 2ZB3A 4PLFA 4GKBA 2QIOA 5B4TA 1KERA 3C7AA 3CUKA 4A26A 1D4FA 1PJSA 1U3TA 1ZJZA 4U6SA 1XU7A 3TL2A 3WQQA 1IL0A 1NR7A 5IXYA 1ZFNA 1WMBA 5A04A 4RPGA 2BF7A 1CETA 4LMRA 1A4UA 1YDEA 1CIVA 1U3VA 3VHRA 3C85A 4BNWA 4B3JA 1FJHA 1LRJA 1YJ8A 5DCYA 1NBOA 1XQ6A 2O50A 4QO7A 2X6TA 4PRKA 4TKLA 4MP3A 4RZHA 3Q2KA 4BMNA 1ISHA 1RM0A 1Z7EA 2DFDA 3GQVA 4L4RA 4XA8A 3WGZA 3ABIA 4D42A 1ADCA 3DAFA 3SLKA 5JMPA 3LT4A 2JD0A 2F00A 3GF4A 2JD1A 3O38A 3VZPA 2V6FA 1C14A 3WOHA 5JY6A 2AHRA 4FOSA 4TWRA 4BVAA 1EQUA 3DDNA 3MJEA 1H94A 1C0PA 3UICA 5H83A 4BL5A 1QG6A 1C1DA 1J4AA 1DRVA 5KKCA 2AEJA 3D7LA 3DWFA 1KEVA 4LMPA 3LZ6A 4R54A 3QIVA 3UVEA 1L1FA 4IY1A 1X7HA 1EE2A 4XDYA 3QY9A 5F5LA 5C3MA 1ZW1A 1E6EA 2IZ0A 1VKOA 4GWKA 4QTZA 5KVVA 1MG0A 3EW7A 4RLHA 1OAAA 5CFZA 2B35A 1NTOA 4Q9NA 1XEAA 4W82A 1MG5A 1H5QA 1EVZA 4E5KA 5KJEA 5JAZA 3W6UA 2D5CA 4GX2A 1PZEA 4MKRA 3LSYA 3GMSA 3QW2A 3VKUA 3WJAA 4BIIA 4E5YA 1GQYA 4Q3DA 4RVGA 2XF8A 4ZA2A 4CMAA 1U1IA 2DVMA 3H3FA 5EL0A 2XXBA 5TNXA 1E6WA 2W90A 1P33A 1YQGA 2I99A 3FWZA 3JQDA 1OI7A 3FBGA 2AMFA 4YDRA 3I1JA 3SVTA 1J5PA 1KC1A 1WZIA 1XLTA 2AQIA 1P1RA 3GEDA 3HB5X 1C1DB 1I3MA 4IDBA 1LI4A 4NJMA 1DAPA 4FFRA 2Y68A 1HSZA 1H6DA 4CLDA 4CQMD 3VPGA 4IJWA 1B14A 3A06A 3OEYA 4XGNA 2VHVA 4G65A 4MOWA 4XDZA 5ILOA 4CMEA 3OJFA 5JS6A 3MEQA 3NYWA 2TMGA 4P4GA 4YJGA 4E4YA 4JJIA 5JBIA 5KIAA 2C7GA 5G0TA 1LRLA 1NASA 4RPLA 2J3KA 2UDPA 3CPSA 1MGOA 4ZGWA 4AFNA 1JDJA 1LDBA 4BB6A 3W8DA 2GYYA 3UCXA 1NX6A 4J9VA 3FHLA 1WXDA 1LNQA 1OFGA 1ZIDA 4RPKA 1ZH8A 3GHYA 4BGIA 4CMIA 4D44A 1DO8A 1E0DA 4MVJP 3IDSA 3AM4A 4DMLA 1ML3A 5DBGA 2Z1NA 4J6FA 1ADFA 1VM6A 2IEDA 1LA2A 4IGFA 4NJMB 1DPGA 1RM4A 4JP3A 4E5PA 4DLBA 3CEAA 1T2EA 3SX2A 2J3JA 4DYDA 2WJPA 2ZB4A 1XU9A 3PFWO 3C8MA 4O1MA 1TEHA 4XQCA 3RASA 1Q0LA 1MP0A 4EUFA 2Y1GA 3BHJA 1VL6A 3ROKA 3ZHBA 3GRPA 2XAAA 1BWSA 1LJ8A 1JVBA 4YJGB 2O3UA 5I7SA 3EHEA 1DIRA 3K6JA 3MTJA 4N7RA 5B4UA 3HFGA 7ADHA 2UUOA 4ZQFA 3H65A 3ZNOA 2FPGA 2FSSA 2JHFA 2GERA 2WTBA 4Z9XA 3S2EA 4FN4A 4XEHA 4J16A 3ICPA 1UP6A 1AN9A 2RIRA 4EZBA 4N5MA 2IXBA 3UXYA 4WKGA 2AG8A 2RAFA 3PQFA 3RJ5A 4AJHA 4F45A 4Y6PA 2J6IA 3WB9A 4J1TA 3L0DA 2B4QA 3GNTA 1PL6A 3CXRA 4RVFA 1LDMA 5CDSA 1R66A 3ULKA 3NDJA 1HE4A 3T7EA 1SZJG 4IJKA 2HSDA 4YT2A 5JAQA 3DHEA 2I3GA 2VYVD 2GSDA 3WGYA 1CYDA 1ZO8A 1PL8A 4U7WA 4NFYA 4PLWA 1GCUA 3H8VA 3AY6A 3CINA 1B0AA 5L4SA 3IL2A 3EVTA 1DAOA 4JCOA 1MV8A 3QWBA 3AFMA 4OXKA 2QG4A 4UVDA 2GO1A 3NJ8A 3Q0EA 5DP2A 3CSDA 3RAJA 2VRCA 4YAKA 2GASA 4XRRA 3ZNNA 5I9MA 4LRTB 2ZIZA 3K2BA 3JD0A 1NAIA 1SB8A 3ADOA 3KEOA 4O59O 1KETA 4R9SA 3TZKA 3D0OA 3E03A 1FDWA 3E5RA 6ADHA 3ZWYA 2O2SA 4LISA 1YBMA 4YQYA 2W98A 2Q46A 4HXYA 5F5NA 3PDUA 5ITWA 2DU8A 3WMWA 4CQLA 3ENKA 1DC6A 3RC1A 4DBZA 2BD0A 2DFVA 1EVJA 3PTZA 4PZDA 4Z0TA 4YXFA 1EVIA 3DBRA 3S55A 4DLLA 1NFFA 1SC6A 4WOJA 3WTBA 1AXGA 1P1HA 3QVWA 5BQFA 1BHSA 4BNUA 1ZEMA 3AUAA 3RCBA 5K6AA 3WQRA 3QVSA 3DFZA 1T1RA 2XOXA 3BTSA 5COBA 4YBZA 4ALMA 3A4VA 4EITA 4ZD6A 1WVGA 5DOZA 5KNLA 1LSJA 2VTEA 2VHXA 4FC6A 2IODA 5CP8A 3RD5A 1HWYA 4FDAA 5AXCA 4EJ0A 3SLGA 4KZPA 2DBZA 2VNAA 5AVOA 2Y0CA 4P38A 4B8WA 1JTVA 3FN4A 4P4NA 3IKTA 1I01A 3RFTA 3U9LA 4DPKA 1R0SA 4OL9A 4MVJM 4XB1A 3UGKA 4W7HA 3FWNA 1WMAA 4GPD1 2OL4A 5K0ZA 4GQAA 3M1AA 3TZCA 4NU5A 1VJTA 3IUSA 4GL4A 1W4ZA 4NK4A 1D1SA 3D5TA 4BNIA 1T2AA 2QRLA 4DRYA 1UP7A 2UUPA 4JX8A 4CQLB 3ETDA 1JAYA 1I2BA 4GVLA 4OO3A 3TN7A 5B4VA 4BNGA 2Y67A 3DBRB 4RDHA 3GR6A 4AVYA 3ZN2A 5BT9A 2GZ3A 1FDUA 1YJQA 1M67A 2W4QA 3LU1A 4FFOA 1A4IA 2W8ZA 3QVXA 1ZUD1 1HLDA 1QSGA 3U0BA 3PHHA 1BSVA 4KQWA 3BMQA 3U4IA 1HF3A 3JQAA 4M49A 4J7UA 4BO0A 4ND1A 4YRDA 1KEWA 1UXKA 2Q1UA 3IIEA 4XR4A 4YT8A 1KOLA 3RUHA 3I83A 4FGSA 3I4FA 3GT0A 1PJTA 5ER9A 4BV8A 5BSEA 1BDMA 5MDHA 2F1KA 3K30A 3WG9A 1YDWA 2Q3EA 3V2GA 2VYND 4U5QA 4J49A 3CH6A 3D4OA 4Q3AA 5KVQA 4XD2A 3ROMA 4ITUA 2UYYA 4E6PA 4NHEA 4W4TA 4WGGA 5BSHA 1LSSA 4RGBA 3H5RA 4J7CA 1AE1A 4JBGA 5EERA 5T8KC 3GAZA 1I3KA 1DIHA 1NQOA 2J5QA 3JD3A 3EK2A 3PYMA 4HFJA 1XQ1A 3TWOA 4DGSA 2B36A 3GNSA 1QYWA 4WEOA 4CUKA 1MFPA 4BKOA 4LK3A 4CLRA 1K0UA 3TFOA 3PIDA 3O9ZA 4XQ9A 4E2ZA 1JN0A 1VE9A 3FI9A 3GY0A 3QJ5A 1RYDA 4PIVA 4HX5A 3OFSA 1LXCA 1EFKA 3L07A 4TQGA 1GAEO 1SB9A 4WLFA 4Z0PA 5BR7A 5FI3A 2B4TO 2ZQYA 4DC0A 3VH4A 3BMQB 3HQ4O 2DLDA 3JQAB 5EJ2A 1SPXA 2V6BA 1CDOA 2GLXA 1KIFA 2JCYA 4IBOA 2RHCA 4OAQA 3RBZA 3WWYA 4CPDA 3F47A 4ND2A 3RU9A 3OETA 2Q99A 3IOYA 1A7AA 4OH1A 2Y1OA 3VTFA 3QE3A 4FR5A 2V6GA 4ZN6A 1NQTA 3IP3A 3NGXA 4HKTA 5THKA 2X0RA 3AI3A 3CZMA 3E8XA 1HL3A 3I3OA 4PRLA 4PG4A 4TMFA 3ZU2A 3HE3A 1JA9A 1PS9A 2QZZA 1KVTA 2O3QA 2POQX 1IZ9A 2HMVA 3JYLA 3W6ZA 4CM5A 1DBVO 4J0FA 1ONPA 3NDRA 1NQ5A 1YONA 3FPLA 1P1IA 1FF9A 3ANNA 4ZICA 2CD9A 5IF3A 3GMDA 3RJ9A 3BAZA 4CLRB 3UUWA 3BA1A 4WASA 4Z9YA 5AXBA 3AY7A 4D3SA 2HK9A 1ONNA 5G0SA 1Z74A 5TGDA 1M76A 1PQUA 3KZVA 1EZ4A 4URFA 3IJRA 3F9IA 4LSMA 5ICMA 1B15A 3JTMA 4TSKA 5HWSA 1I5RA 1NPTO 1E3JA 1V35A 5GZ6A 1EUZA 2BLLA 2FRDA 4A7PA 4XRGA 1JKFA 5BSFA 3E48A 2G82A 3JD4A 5AYVA 4PG8A 4RJTA 4UEOA 3QA9A 1IE3A 1QYVA 3R0IA 4JN6B 3DAGA 4ZRMA 1Y9AA 4B79A 4Z6KA 3KYCA 2CF5A 4CV3A 2NTJA 1GEGA 1U4OA 2B69A 1ZSNA 1QYCA 3LT0A 1P0FA 5B1YA 3G1TA 3L4BC 4I5GA 3GVIA 1LDEA 3AFNA 1A27A 1ORRA 3NT2A 2ZKLA 4JLWA 2GN4A 4GMGA 4K6FA 4XWYA 1PQPA 4TRNA 3FRJA 3KVOA 3M2TA 1IY8A 1M2WA 4BO4A 3RUCA 3VH1A 4ZQHA 1YL7A 4INAA 5DP1A 1YBAA 3BYZA 1UDCA 3JQGA 1W73A 2YDXA 2EHDA 3DHYA 3PIIA 4GBJA 4WLEA 1ARZA 5A3JA 1X1TA 1XDWA 3PLRA 4XYLA 3P2OA 5KJ1A 1LLCA 2JJYA 1XELA 3HNPA 2ZCVA 2VWGA 1GDHA 4E3ZA 4HNHA 3VH2A 4ONEA 2YHUA 1ZEJA 1UAGA 2FZEA 4W7IA 4WK6A 2C2YA 2BKAA 1EBUA 2HJSA 5L51A 1V6AA 2YV3A 3KYCB 3OICA 2GN9A 4KP7A 3VVCA 1E5QA 1L7DA 1LU9A 2EKQA 1WW8A 3IQDB 4FW8A 3W4JA 5TSDA 5L7TA 4EW6A 4IDFA 3LDHA 4Y9DA 1ZKMA 4M89A 4JNKA 2DTXA 2A35A 1GV0A 5T8KA 3QVOA 1R4NA 1GEEA 1U2DA 1M75A 1QRRA 1P31A 4GSLA 1TT5A 5DDIP 1E1LA 4HWKA 3E9MA 3U49A 5GY7A 3ROPA 3ZWMA 3U4CA 1ULUA 1N5DA 2X9NA 2Q50A 3IAHA 3JQGB 4OJNA 2VWPA 2GPTA 5KCZA 5H81A 2PZLA 5F3RA 4R1NA 3H9QA 4KOAA 2OO5A 3FTPA 3P5SA 1AHHA 4K6CA 3ZCXA 4L8VA 2P9CA 2QHXA 1P74A 1IPFA 4FJ1A 4E33A 3OMLA 1DIAA 1HDRA 2BELA 2D4AA 5CAEA 5IXSA 2BFPA 1XG5A 1U9JA 1ZVMA 4QO8A 4F6LA 4P8RA 2PA3A 2HRBA 5L3ZA 1Y5MA 2NVWA 3KV3O 2GZ2A 3GPIA 3B70A
chains in the Genus database with same CATH superfamily
2ZE5A 4LOIA 5FJJA 1MVOA 4J1SA 2JFOA 3C4VA 5CD1A 2IUTA 1YIOA 1XJ0A 5DBIA 3QFTA 3DBLA 4FBMA 3P97A 3N3AC 2P41A 4QYIA 1G20E 4PQGA 1XN4A 1ZM7A 2M9MA 2PEYA 3QW4B 4KE8A 2W7TA 1MTZA 3AEYA 1IIRA 5CITA 1KXJA 1YQXA 1KS2A 1R4NB 3CIFA 1JBQA 5AJUA 4EG4A 1UJBA 4GXNA 1G8PA 2W22A 3D2LA 1KI4A 3MBKA 2IIQA 3H7AA 5IP5A 1KI3A 1JEJA 5CXQA 4CF7A 1QIIA 1IDOA 3CBGA 1IMOA 1PJCA 3U13A 1CBUA 3RVLA 1QUFA 4DMMA 5JD5A 2VHTA 2XMZA 1A9TA 1YS7A 2HIGA 1G6OA 5JFTA 1RPNA 1JG1A 2QW0X 4OHZA 2GM9A 2JFUA 4AKEA 5HSGA 2A5DA 3HRHA 1C30B 1M66A 1VE1A 3KZMA 3LVBA 3O90A 4W7SA 2VK4A 3G5TA 5FQOA 5LXTF 5DGIA 4MPTA 5F12A 3QLEA 5H59A 5CAEB 3X44A 4EUHA 1MJFA 2D2EA 2NAFA 1QE5A 4FU0A 4OVKA 1WU7A 5AFSA 1X0VA 1GXSA 1UMDA 1W0KA 3II6X 3BEDA 3JWHA 3P9ZA 3NTOA 3QUCA 3G5UA 1KEKA 2VHQA 1IBRA 3R3WA 2ZEJA 1WCYA 4EKDA 2L19A 5K45A 3UK6A 3AFHA 3DJFA 4N12A 4TV8F 1FW8A 2NM0A 2ZT7A 2YOGA 3MIIA 4M8LA 1LBEA 4R3UC 5BN4B 4PZPA 2J3IA 4R9UC 3DXZA 4FX5A 5AVVA 4LZPA 3HEAA 5AW1A 1WWKA 3AIMA 3L6EA 3ROXA 2G1UA 2I76A 2YWFA 3DE3X 1OKKA 4H7DA 5JS8A 1YBVA 2F48A 4X20B 2JAQA 4O4IF 1C9JA 1OJLA 4YNBA 4DCUA 4JSTA 1A2KC 4KN8A 5EZYA 1U99A 4KLNA 4UBMA 3TMKA 3VPDA 4EO7A 4F9TA 1JFFA 1Z82A 4B4VA 2V3VA 3AB8A 4HDRB 4C30A 4DREA 5CBPB 4QXMA 2P2GA 3GELA 2CFTA 3HKBB 1DU4A 3OFVA 2W6OA 1K5HA 3VTZA 3O9VA 3KVRA 2Q5HA 3OTHA 1WVMA 2VDKB 1O5TA 4H7JA 2HXSA 1JALA 3QPCA 4UPVA 3B9QA 4QHTA 4GX5A 4R3WA 2PMCA 2XYRA 2WWGA 4JJ7A 3MWGA 4CDGA 3H2BA 4EOGA 3B36A 3M81A 2OAQ1 4WCFC 2MR6A 3VOSA 2C1XA 2J5RA 3UT0A 4F21A 2XNJA 1G17A 3RRNA 4NZ9A 1DUVG 1YQDA 2DWCA 2QNRA 4GZ5A 3KB6A 5I7EA 1MAUA 1MUUA 3QU4A 2UXDB 3NTRA 1WHTA 4S04A 3PQEA 3V3TA 1GZ6A 4MPDA 4OMCA 2CUZA 2O2HA 3KE9A 1U6IA 3U9SA 2NPIA 4I9NA 2QY6A 5K20A 5BR8B 4S05A 4G5RA 4AN0A 5A5DA 5KINB 3CKMA 4UAVA 4BMSA 4L76A 2HQ1A 3ADBA 2O2YA 3RSFA 1WDKA 5AM0A 2EXXA 1VSUA 1TLLA 1V8OA 1CUWA 3EFOB 1EWKA 2JAHA 4UJ3A 2BKLA 2RK3A 1TW2A 2HC9A 3R75A 4Z4CA 3S2ZA 2WUEA 4EUEA 4PFSA 4NYIR 2JATA 4OYHA 3AU8A 1EFHA 1GITA 1EUDA 2BYTA 1J06A 1MR3F 1WXQA 5F7OA 1Y9DA 1WEHA 3F73A 3KTFA 3ET5A 4S1NA 2DFLA 1MX3A 4GPIB 4Y2VA 1SC3A 1DRWA 2WJWA 4MS4B 5MHTA 3HXMA 4LX0A 1UODA 4WDRA 1DB3A 5IJXA 4A23A 3KZXA 1FQJA 3N8GA 2C88A 2WFLA 3OFKA 1UP4A 4MMYB 4YCAA 1AA6A 4OLAA 4Y8VA 2A0WA 3TQHA 5IVPA 4OM8A 4EF4A 3L1JA 3HJAA 4KEAA 1ECLA 5JEDA 2IV3A 4OX9B 3CUWA 1Z0SA 4S3MA 5JCOA 3IHLA 1KZGB 4QU0A 2GR9A 1P0IA 1PJ2A 1R88A 1M72A 3UV6A 4JI1B 3PQ3A 1JILA 4MRNA 3WIBA 3PHBE 2F9LA 2NQ8A 3JQ7A 5C8VA 4D56A 1PD1A 2CN1A 2RGBA 4AECA 2ZDGA 3EVFA 3PRYA 4PC7A 2R8OA 4QG3A 2R2GA 4ARSA 4C0BA 1F60A 4CIAA 2JASA 4WOKA 3OIVA 2FX3A 3R9XB 2O6LA 4Y6OA 3MT0A 5J59A 1X7ZB 5LD2B 5ALNA 2XUGA 4L8GA 4NZNA 3IUNA 3H99A 1S2GA 1SUFA 3RTCA 4JB3A 3AOGA 3EQ2A 1Z4PX 2LD4A 1SCBA 2HWWA 3N0TA 4NCIA 5CA0A 3DOEA 4Y0AA 3MTGA 3KOMA 2Y4OA 3JSXA 4JC4A 4ZVKA 4GOJA 1QBKC 1G59A 1ZK2A 3EZLA 3TZQA 2D2IA 4Y9RA 5HIJA 3DM9B 2AYZA 3LVRE 2X2EA 3EDOA 4JT4A 4PLTA 1QO0D 1RE1A 4PLHA 1Q7GA 4ARAA 4YXWD 5J2UB 3ZLUA 3GRKA 5FADA 2KQUA 5L45A 3I9LA 1U2ZA 1RYNA 1MC8A 2DBRA 5LBIA 2CV2A 1V11A 3GL9A 3VKGA 5J3JA 2X2FA 1TK2A 2Y93A 5DNWA 3THOA 2C7RA 2X9VA 2C2XA 3MGAA 3T95A 4IGKA 1XRLA 2C07A 4BKQA 4HX9A 3SM9A 4BNYA 4R1TA 4BNNA 2Y1FA 1Z6ZA 3FSJX 2GX6A 2PWAA 2Y6UA 3I6QA 4WLUA 4TV9B 5CBPA 3K9FC 3M3PA 1JAHA 2Z9CA 3IAS6 1P2DA 1NNLA 3ML1A 2CYAA 4OHBA 4LGYA 5AKIA 4BDTA 1GGVA 1DCKA 4JOQA 2C59A 1PZGA 3I1IA 1OILA 5GOZA 1LX7A 2J4CA 3A0RB 2AMYA 1MB2A 2ZR0A 3BKWA 2YCLA 3HY4A 4Y7DA 2LCIA 3WLOA 3Q1LA 1U0RA 3TLZA 4L7QA 2J5KA 2ANCA 3PDIB 3BSSA 2QE7D 5CH8A 3LC1O 2FMHA 4XUGB 3FFTA 3DP9A 4NFLA 1VPDA 3ICVA 3UWSA 3NXSA 1YR6A 3PQ4A 4MITA 4NYMQ 4RKEA 5DGDA 1VB3A 1XA0A 4JI7B 3RWBA 3R5FA 4UTRA 5CT6A 1C7QA 1TO1E 3U4HA 5FUQA 4N18A 2D6FA 3E82A 3EZXA 5LQRA 2PE5A 1XJWA 2W2KB 4QE3A 5JS1A 1H9AA 2BHSA 5KPJA 1DC4A 3G8BA 4QREA 3C5VA 4UZFA 3RFFA 4MB2A 3O3OB 3UGTA 1R9GA 2ACVA 1E1YA 2OMKA 5DT2A 4BGEA 4ZI2A 4EG5A 3JZMA 5MF6A 2A1TS 4P2BA 4B4OA 2PGDA 1JQAA 5JQGA 1HKHA 2JVJA 3NW9A 4QECA 5DM0A 1M34A 4I5FA 3A6EA 1CRLA 3KSZO 4BQEA 4OYRA 5TMBA 3DMTA 1XTQA 1TIBA 3MC1A 2JGEA 2X4LA 1AGNA 4JDUA 1LPAB 2CMGA 1UJ2A 2TRSB 3L0SA 3T9DA 3IEXA 1T9ZA 3H9JA 2EU8A 3BGSA 3OLZA 3ILSA 1PG5A 4N9WA 1C8BA 1T36B 1FVXA 1YQWA 1Z35A 3DD1A 4HGPA 2WTMA 4OREX 4EYKA 2Q0HA 4ISBA 5LKRA 3K9BA 1A8SA 2IU0A 2WICA 3EC1A 3N70A 5ESWA 4RVUA 2HA4A 4KNWA 4DNOA 2QL9A 2Z8YM 2BFOA 3DZCA 1RPJA 4G97A 4E7PA 4DUGA 2RONA 3OSUA 4R2KA 2A3NA 3K2EA 2VDRB 5AI5A 5BWCA 3S2FA 1MO5A 1JBKA 1HYQA 4MYCA 5DTEA 2ZAYA 4BNTA 4ENRA 1E2JA 5JI2E 1EUQA 4D9FA 2AF4C 4JI8B 4N1AA 1QLHA 3WLLA 5EN4A 2Y77A 4YRNA 3E7XA 1ZVQA 2QVCA 1GSHA 3H4VA 1SOVA 1DKLA 2B0JA 4XYEA 4H3VA 1C3VA 3CH7A 1TPZA 1IHXA 4PZ0A 3L9XA 4GUDA 2F1HA 1ZD8A 1F17A 3EIWA 1CJCA 4NPHA 1PK8A 4FYWA 1MKYA 3RGWS 2R25B 1Q91A 4MB0A 4RF2A 2NUTA 3N5KA 3UWOA 1B8UA 3IO5A 1Y8CA 5ALVA 3EVGA 1NJ2A 2IPLA 4W5WA 1CS0B 1DEKA 1H23A 4CT5A 1QHNA 2CLCX 1YASA 1W5BA 2MYNA 1ZHHA 1QP0A 1IN7A 1QE0A 3ROEA 4LHVA 4ZYZA 3ID6C 1DQYA 4MS1B 4TS3A 5SYAA 4G1BA 3R7AA 1ZR2A 2P3LA 3STUA 4BWGA 2VZ9A 1GLVA 4IG9A 1T8PA 2KBEA 3A28A 4FHDA 3IAFA 5DHTA 3EDRA 3MUNA 4WUTA 5AW9A 3HI4A 2G7MC 1J8MF 3ZWNA 2PMKA 5DW3A 2O5VA 1TJ3A 4AROA 2VHJA 5BVHB 5AHWA 1A7JA 3R8XA 3OQBA 2R8XA 3N2EA 2Q3BA 5KTMA 3ESZA 3HBFA 1II9A 1UJMA 2FJPA 3ONVA 1F2DA 2IS6A 3M6FA 4FC7A 4YV1A 5IVDA 5LBUA 2C5LA 1RIIA 1Q5PA 2GVNA 2OHHA 4M87A 4WZAA 3O2QB 5F2OA 5IAEA 4A2QA 5BQ5A 4YUXA 4LGVA 3AESA 4FYHA 2J30A 4TTVA 4CUJA 1E9VA 3CX3A 3O94A 1W52X 3DE5X 1YB5A 2R0QC 3DAHA 2FRXA 2HU5A 2MDTA 2AUNA 2JIRA 2ZRKA 5BSMA 2WE7A 4ZVNA 5A4JA 4K1XA 4BLRA 2ATXA 3KTOA 1U9ZA 2P9EA 4L8LA 4N3CA 5HILA 3A8TA 2BR5A 2JDID 3WNQA 4UBKA 5JYEA 1EGMB 2JBAB 1OWNA 1JMKC 2PKXA 2OCKA 3PKZA 1C3OB 3RREA 5K8IA 3SHTA 1NWHA 3BORA 1CB7A 4RBNA 3DMNA 2CK3A 3VUFA 1A95A 2KBFA 3NVAA 4C43A 1KZ6A 1PSDA 2HU7A 3S7ZA 4C4PA 3DLAA 3NWEA 3CW2A 1CP2A 1L8OA 3NC4A 1QIHA 4H7EA 2CNDA 5F98A 3GC6A 1N2CE 4PPYA 3D8SA 3PJRA 4LXGA 5FB3A 2DKNA 1O0BA 5JSZB 2E2WA 5DWVA 2O8NA 4TT8A 2PY6A 3PJDA 3ZLJA 3A27A 1RYEA 1KI7A 1RWBA 3L6OO 1EFPB 3F3YA 3W7AA 4X1OA 1KPIA 3WK4A 1VPTA 3BJMA 4DMGA 2QDXA 1U0SY 1GZ7A 4LYEA 5ITZB 5HM8A 3EPKA 3UEOA 2WWIA 4DNXA 4EY4A 3PUWA 4DBVO 5KU7A 3IPXA 4R1UA 2P2SA 2AJDA 4FGLA 2R6CA 2N9UA 5E6RB 3ASYA 5FQNA 2QT9A 5CTJA 1UPXA 4U2CA 1F0KA 1PFGA 1B8PA 2FP4B 1OXVA 2Y0EA 3AB7A 3SBDA 2GPNA 2P2LA 3E53A 4XGQA 4B2LA 5KNCA 4AUNA 2RHHA 1F8FA 4ZDKA 2ZE7A 5C8ZA 3GU3A 5IJ0B 3ORQA 5JHGB 3H2JA 2EW1A 3PFFA 3SEZA 1HDZA 5F64A 1AQLA 3E7WA 1KH3A 1N7JA 3OF2A 1ZRHA 1JWBB 4HXGA 4LYFA 4L2IA 3HN6A 3UHPA 4YT5A 3O84A 4L22A 2WTUA 1QV9A 2G76A 2QAGA 2QRVA 3P0FA 4FZVA 4M7RA 3NBXX 4N7BA 2EZ8A 2IEAA 1FMJA 1L5NA 3OPXA 2QAIA 1FFWA 3QA3E 2GYUA 3D8BA 3HXKA 4HGRA 1R37A 1YDHA 2I3ZA 3QU9A 4IW3B 2DTDA 3ZJYA 4DQVA 4K9SA 5K0CA 1ESZA 2WA2A 1SMKA 2QU7A 2QUZA 1R3DA 3M4JA 3OPMA 1C4XA 2Q7DA 1K5PA 3IJPA 3SFZA 4KPUA 4B6EA 3GNQA 5C9ZA 3WDLA 3ZU4A 1RYYA 3E0XA 2H4XA 2FFQA 3G17A 1UOEA 2VPTA 4IH9A 4UVIA 3RFCA 3JZFA 3KKQA 4AF7A 1SXJA 1UUFA 3IQZA 1DJNA 1SOUA 3RTEA 3DMYA 4UREA 2CW5A 4J43A 4M9SA 4M0FA 1A98A 2KLHA 4NCNA 1UH5A 3TGLA 1HTWA 1QKIA 5LLTA 2HDWA 2E0IA 4XOUA 3OZWA 1UPAA 2PL1A 3WLSA 3QU2A 3USES 3UH1A 4AB1A 5LQAA 2GK3A 4EGFA 1H2BA 2OHXA 2ZSKA 4DYHA 3D7KA 3NKVA 4LWQA 1ZUHA 3L8GA 5J5VA 4BLSA 2R11A 1NXQA 3ZW7A 2H52A 1JYFA 4N82A 3SJ7A 4AX4A 4KFRA 3SZRA 4WD3A 4C76A 1HDCA 2BZGA 2PNJA 3BIWA 5AXDA 4P7BA 3ZW9A 1F8GA 3N53A 3ZZ0A 2FSUA 2NTVA 4LE0A 3HJFA 1JTFA 1Z3IX 3AEZA 3SKVA 1OB5A 2XOEA 1W85A 2FFRA 3CCCA 2P69A 3SF8A 2VKQA 2QR2A 1UPTA 1YO6A 2PRSA 2R5NA 3NUQA 1JLSA 3PITA 1M5TA 1Z16A 1UL1X 5EHZA 1Z8FA 2NT3A 1YZQA 1ZRMA 4TMYA 1ZMBA 3GFFA 4CGYA 8LDHA 1T2CA 3D7MA 3JR3A 1HFKA 4KQHA 3DHNA 1UFRA 1VBKA 4FLMA 3C48A 3HXPA 1GA4A 1CS4C 3KB2A 3UCFA 3WRYA 4CGZA 4V3CA 1LD3A 3ZYCA 4EB6A 2W6PA 2WHPA 5G4KA 1VHDA 1G4AE 3UWPA 3ZWVA 3ZWAA 2OCDA 5KNDA 2IA5A 3UB3A 1JRLA 2H63A 4LCEA 4MCHA 4MV8A 3RYFB 1V6SA 3RS4A 1K8ZB 3EZGA 2PBLA 5LKAA 4IIYA 3B51X 1BFDA 4DRZA 4ZAZA 3AY0A 1H6BA 2C1EA 4OMUA 1CUYA 4C2UA 1VJGA 4N54A 3AERA 4LZWA 3VNSA 2YL2A 3W8NA 1OWPA 1L7QA 1SXGA 3AF0A 4MRSA 3P9XA 4NU0A 4ACAA 2Q5QA 2XUDA 1ZWKA 2XMPA 2GLUA 3IMEA 1GNPA 1UXGA 2XVZA 3DBHA 3N7UA 3HJCA 1Q21A 3V4FA 4RTLA 3CZ4A 3KK0A 4MLDA 4A9AA 2QQGA 3LL7A 5DHPA 5L7WA 2LZ0A 2HN9A 2Q1SA 2AC2A 1M3SA 3LRTA 2ZIWB 4POOA 3ZV6A 3KQUA 3U4DA 5LIRA 1IBKB 3H0CA 5B1DA 4JI5B 3IV6A 3LYHA 4YRLA 2LBPA 4L9SA 3ZU3A 4BFZA 1WABA 5BOSA 1M8GA 5KYNA 2D1RA 4WJZA 1YZNA 1M2OA 3K16A 3GOHA 3WVNA 4FDMA 1E2GA 1M6NA 3WISA 5IJ9A 5AW6A 1UQRA 2VHYA 4JWTA 1NX9A 1USVA 3FSEA 2IL1A 1E2KA 5LZ5A 5B12A 3GH3A 4B7UA 4OI0A 1YE3A 1QYXA 4IMJB 4ZAWA 5CVCA 3C3AA 5KVAA 3FSGD 4JH0A 2O7NA 1H8HA 5CR9A 5KKNB 3T9CA 2CEKA 3B3FA 2B8TA 3GDWA 3GFSA 1KO7A 1V1MA 3BGDA 1EK6A 3I6YA 3FKQA 3IBFA 4IOMA 4UNIA 2ZCUA 4ZO4A 4QEKA 3VR2D 4CKWA 2VUIB 1TO2E 2VXYA 1I7DA 1AKEA 1SK9A 1U80A 2YBDA 3TOZA 2Q5LA 1CDZA 5KB3A 3U56A 4A73A 3UB4A 4O02B 4AWBA 2IHZA 4YACA 221PA 1N1GA 2IY9A 4K40A 4BFVA 1PFVA 1U94A 3K1JA 1Y8ZA 3PEYA 3Q41A 4FSDA 5EE0A 5IXJA 4UOZA 2B6NA 1KHHA 5IDXA 3ZWXA 3KAPA 1UF9A 3HA3A 4IWXA 3N2LA 2BDTA 1VL1A 1W9MA 1NYLA 2B99A 1KE2A 1RD4A 3LOUA 3FNHA 2QD1A 3FYSA 2ZS8A 2WUFA 4X7MA 3VU8A 1JB1A 3ZH2A 2AQKA 5ELLA 2MU1A 4W6ZA 1SUIA 2YQ5A 3RHSA 4DY4A 1IOVA 3UMYA 3HFSA 4RXUA 2C9MA 3EMVA 3AM5A 1L4LA 2R3SA 2Y92A 2RH9B 3KQWA 1IBLB 1AGXA 2XB4A 3FPJA 4UM5A 4BB9A 1YZHA 4AUEA 5FWXB 2V8OA 3HFRA 4QWWA 2P2DA 4IXTA 3WX0A 2X5JO 1K92A 3K1YA 2HUNA 2HJWA 4QOJA 4HNRA 2FG6C 3RS3A 1ZD2P 5CM8B 2ZPAA 3M3HA 1LB1B 1XKQA 4OSOA 5FWYB 2AK3A 2WWHA 2Z2KA 3FNGA 3QVJA 1NVTA 1EUYA 1ADBA 4O2BA 1WPRA 2OXFA 4NI5A 2RGAA 4RO0A 4ZCSA 5A4IS 3T5PA 1II8A 3BWCA 1KA9H 8GPBA 2JLSA 3A9VA 3I61A 4MULA 5BYAA 2IEZA 2I29A 2J9FB 2PYDA 3WE7A 5CDTA 1MO3A 2V9PA 1HO3A 3UAGA 2D62A 2QLJA 4QYMA 1NN3A 3ZZTA 2Z9DA 1HNZB 4NAHA 5FKJA 1BDIA 5F2KA 1GZ3A 1PT9A 2XQGA 4Y2UA 2OCIA 6AT1A 3AIIA 3K05A 3QE0A 3STVA 3IE1A 1UAAA 1FLDA 1V4VA 2QRHA 4AJKA 3KQOA 4GOXA 4LJ6A 4NBTA 4B9AA 3FCEA 1VG8A 3IEVA 2WMYA 1JIUA 3A3OA 2XCTB 5FUBA 1X1QA 3N6RA 5M34A 3RI3A 1RI3A 4S35A 2YNMA 1Y37A 4NAUA 3NATA 1M2KA 4MA4A 3IB3A 4CMCA 2OYCA 2D4HA 2FYTA 4KGXA 1RI1A 4B09A 4DLZA 3TSWA 1MW9X 3A4MA 3DVAB 2P6OA 2Q6KA 3I9V1 2WVAA 3IDQA 1A9RA 4OXYA 3QV2A 4UDNA 3ZV3A 2I8CA 4TMZA 1IK4A 4EHDA 3QKRA 1A1VA 1MIOA 1EIWA 1ECBA 2XKJE 3IESA 3HU5A 3KZNA 3N9IA 4WNIA 3DW3X 2GOYA 2IEIA 4JYZA 4ALLA 2LW7A 1X87A 1YE8A 5D5HA 3SQNA 1V48A 1UOQA 1N3BA 1O4VA 4MP6A 1EVQA 2ST1A 5E9AA 4IOJA 5EPEA 5IDYA 3LS2A 2C5BA 3RSGA 1A9XA 3OOJA 3V1NA 1SXIA 1ZY2A 2NU7A 3TMYA 4P3OA 3U40A 3J7AC 2VWQA 2I6SA 3E3AA 4UBNA 4IGEA 5FTWA 4JXJA 3FBWA 4WLVA 3T3PB 4F04A 4WXHA 3PFHA 5LA6B 5K8TA 3FPCA 3BQMB 4FMCB 4GKVA 1P0QA 2JFYA 3DL2A 3RAPR 1K06A 3I9KA 4NAVA 1H9BA 1JHXA 3Q6IA 3TPFA 5LQDA 5JDIC 1R6DA 3VU0A 1OCEA 3AB3A 3P0RA 4AMUA 4G5SA 3A1UA 3U3OA 5GOTA 4ZI7A 2PGJA 1OI3A 5MFZA 4MI3A 1B41A 3DTVB 2F43A 1E4OA 1UKEA 1TA0A 3KJIA 4KUGA 1Z45A 4KYTA 5D5QA 1Q74A 2OCAA 2OZPA 2H4JA 2J67A 2PX0A 3JQBA 4ZDWA 2JAXA 1CTQA 3THXB 4IIJA 2D7CA 2EW2A 2PXCA 2BGRA 2X3YA 2XVYA 3WGNA 1E64A 3HYRA 2C92A 3FNFA 5EJ6A 1RMQA 2N1MA 2NZXA 4EMUA 5FHRA 1DADA 1Z29A 3MT7A 3W34A 4IKEA 2O3JA 2ZP1A 5BSGA 3ZWQA 2ORWA 2COUA 3T1QA 1AXRA 4TSRA 3WWCA 1VKJA 5TDHA 2ADOA 3RTBA 5JZBA 3BILA 1A7KA 2VSQA 4QOEA 2EGUA 4OYYA 3UATA 4B5KA 2XTZA 3RG8A 3CPEA 3JYOA 4FFBA 2YZGA 4HRVA 2ZIAA 1EBFA 1Q1BA 1U7ZA 2NU6B 1TIPA 1UQTA 1Y9EA 3CKKA 5EIAA 1Y9JA 3UOGA 1TYEB 5DBHX 3RUFA 3OMXA 4BRSA 1PD0A 2WUWE 2F6RA 2ADFA 3OBIA 1Z73A 2OQRA 1N1DA 3FMIA 3IOCA 5HGXA 2B5OA 4Q3BA 4TTAA 3Q5EA 4XX0B 1ORIA 3IT0A 3F78A 5TT0A 1OPRA 4QRHA 1U0JA 2EV9A 3OIGA 1GZVA 2AOTA 3D4IA 3INYA 4B83A 3GG9A 2CFOA 3ZUGA 4H15A 4JHXA 2JFGA 2CUTA 3E5MA 1EG2A 3OG9A 4BX2A 4V1CA 2NT4A 3SG0A 2FPPA 1T6ZA 3G3EA 3PXCX 3R3SA 2ISSD 2OZLA 4L9RA 5BOVA 3WMXA 3GEEA 3RFXA 3PRJA 1Y1PA 1TEXA 3FXAA 2IPOA 3ZK8A 3TZ6A 3NOXA 4M0KA 1GGMA 1O03A 3A31A 1E2QA 1D4ZA 1GUFA 4PR0A 5KZMB 2ALJA 4JLVA 3PRHA 5AJHA 3C6KA 2BEKA 3CPHA 3GVPA 2FEKA 3GLHE 3W78A 4CIBA 4Q1DA 3IBYA 2EQBA 1CUAA 1GGNA 2X5OA 4XM0A 1JSLA 3TUIC 5H3CA 1DFGA 4TYQA 1J5EB 1QWSA 3ZDDA 1SD1A 3AUXA 4MVJG 2OHGA 4HQKA 4CL8A 3TLGA 4PZ9A 1NP7A 1N3IA 2VZ0A 4GL2A 2C5HA 3I73A 3COPA 2V4UA 4MVJH 1WM1A 1XBTA 3VPHA 4MQ5A 4DKXA 1HT1E 2WSLA 1DCTA 3INRA 1Z38A 4XLTA 5EQFA 4BMOB 1G5PA 1GRCA 1SHTX 2ZTVA 2G25A 1S2NA 3EUEA 3Q15C 4N3BA 4ZODA 5IN5A 4DVGA 4GMXA 4MROA 3F3KA 3QPAA 4KACA 5DF1A 5CK4A 3EXG2 2NWQA 3T9AA 1ZW6A 1UBTS 1PK7A 3F9CA 3V6LA 1P45A 2YN4A 3GROA 3KQSA 5LMNB 1WV0A 4Q66C 3PE4A 5LQKA 2BMWA 1SHLA 1C8LA 4HLNA 2CEAA 3SSAA 5F3WB 2YWJA 1OIVA 4PICA 5C4IA 4YRCA 2ECOA 4EX7A 4ZHQF 3KWMA 3TQIA 3FOFC 3HC7A 3A26A 3EBPA 5JVDA 4UW9A 1IY1A 1G41A 1RFGE 3AILA 4CV2A 1G5TA 1Q0QA 4RZSA 3RABA 2BFCB 4JVOA 2C9OA 1HQCA 5J4LA 3LLSA 4RK6A 4UMVA 1Z5WA 1ZJJA 2G4VA 4ADSG 4DLVA 2C3YA 2BFMA 2YVLA 3HCRA 4N0MA 2H54A 3PKJA 3W2IA 2H31A 1PGQA 1XMXA 4S1OA 2IYTA 5I7HA 2GJAA 1T8WA 2GK6A 2EJBA 2Q1WA 4FB5A 4TWIA 1T5HX 3FLEA 4WGFA 2NU9A 1BGXT 3WP1B 2GHTA 2ZJOA 1WUKS 4I9UA 2OXEA 1O9BA 2NTYC 3RWOA 3SHWA 4EPYA 3K70C 2O19A 2FN9A 2WDZA 3ER8A 4I08A 4HQRA 3UW1A 1UWVA 3V1MA 4B3HA 1XYVA 1LDNA 3DONA 3T3GA 4TRMA 4RC9A 1XROA 4YT4A 1SVMA 4IJVA 1E0AA 1P9LA 3H04A 1WMEA 4RD1A 1NBMD 4OXXA 4FMCF 3EUWA 1FYFA 4TXNA 1PWXA 1Z0IA 4N9QA 1QH9A 3VU9A 3VYUB 2FSVC 2IHUA 1W5AA 4LVCA 3SC2B 4B4WA 2HUPA 4FHEA 3T7RA 1SRQA 1TYDE 3RUIA 3S29A 3ZX5A 1ZCZA 5G2OA 4B6OA 4C0JA 1KAMA 1COWD 2HNBA 3HA7A 3LKDA 1V16B 4CKBB 2A14A 4YASA 4D3YA 1Q44A 2EYUA 2CV0A 3ZGLA 3QWAA 1ZD4A 3AP1A 4KB5A 1SVUA 1T4CA 2YOHA 4RY9A 2GAOA 1ULZA 1XZQA 3JPYA 3OZDA 3DQQA 4AY5A 5A5VA 1JU9A 1KDOA 1R6BX 1S2MA 2PTHA 3VKVA 1O95C 1VIDA 4HEA1 3RYTC 4DTIA 3ZQJA 5EE1A 1KJ8A 3C15C 5BQPA 4MR9A 2QRUA 5AQ1A 1GPMA 4J0EA 1UBEA 3MOIA 3AQIA 5HKKA 1KY4A 3ZZNA 4ZV4A 3JRXA 1VHLA 5LB2A 1UT8A 4BKRA 1KZ4A 1UANA 2E3JA 2HBYA 2OOSA 4DM3A 3VNVA 5FD8A 1XZGA 4H3HB 4OFZA 4UQLA 2NYVA 3AC0A 3T3MB 4BEVA 3ZCRA 1ZPDA 3K0CC 3HWX1 3ZGXA 4JI6B 4PYNA 1AGRA 4ZVUA 4QM7A 1TXGA 1QNFA 1U02A 2E85A 2CWDA 2LV8A 3C1OA 3T9BA 2VYNA 3TNYA 2ZB8A 2PYIA 4WEQA 1CYEA 3OJOA 1FFHA 4IO1A 4CIWA 1WE2A 1T0JB 2QLFA 4G56A 5EZ6B 2DTEA 4JR2A 1PJ3A 5F33A 2OXIA 2P7IA 5E3JA 3OZRA 3ET4A 4DV0B 1N2GA 1PWZA 1T4GA 4AAYA 3KQTA 4RNDB 5JQWA 1VL8A 2FW0A 5KQLA 4LZNA 4E70A 2GNOA 4EEZA 1NU8A 2OGSA 3G9TA 1F8YA 1AVTA 2Z8ZA 5IT4A 4EHLA 4WXEA 1RYHA 2X4DA 1RAEA 2YN2A 3LECA 4QXRA 4ZI3A 1JE0A 1WXEA 2BH9A 4KQFA 3KEQA 4TTSA 1R16A 3L8HA 4YCDA 1KE1A 2BGWA 3UFXA 5TC4A 2VK1A 4QPPA 2IH5A 4BBJA 3GUZA 4Y1RA 5LYJB 4DBLE 3WBFA 3Q3HA 4ZJZA 1RC8A 1W29A 1BDBA 1N2JA 1GARA 2R8BA 3ORFA 3QYJA 4Z4GA 2EAUA 2PUVA 4BXOA 3DYBA 4F1WA 4YJFB 2AR9A 2CSUA 1QTIA 4YN3A 2IS1A 4Q9DA 4HDSB 3V4OA 3OECA 4GKAA 3FDJA 3WGVA 5LP6F 1T8YA 2NTEA 4KDFA 1Y3CE 3IAAA 2JJ8A 2I1VB 2IHKA 2JJMA 2G5TA 4D3FA 3NP9A 5DIZA 1XEWY 2C82A 5E1OA 3GJ6A 3I92A 2OCXA 1DIBA 1YZLA 2J0UA 3DH0A 2AEFA 2X19A 4J91A 1FB5A 1LZLA 1XZPA 1BXKA 3D3JA 4WNCA 4BFWA 2VIIA 3CLTD 1EEHA 3OCXA 1T24A 2AK2A 3O0DA 3MF4A 4FFDA 4RZIA 4X8LA 1U98A 4QJ3A 1OHHD 3EW9A 2IY7A 1H4TA 3RKUA 4Z2AA 3C4JA 1UJCA 4CTOA 2HM7A 1T25A 2JRLA 4ZANA 3CF0A 1NXSA 4OQYA 4JVSB 5AIBA 1RXVA 3H5VA 3S1SA 2C8VA 2Q0SA 1V5WA 1YRAA 3HYCA 5ED0A 3WGOA 2IYYA 4GP6A 4LIPD 4KXFB 5E6UA 5TPWA 3R5XA 3ZXIA 2ZUFA 1IZ0A 1RAHA 4CN9A 3LX8A 1X14A 2DCUA 2NGRA 1PVOA 3PNPA 3DE0X 1Z7BA 3SVZA 1Y82A 1Q95A 3AONB 3I05A 1XP5A 5IMSA 4Q9JA 1I2AA 5T4FA 1E9CA 1M10A 2H92A 2CMKA 4XPIB 4YMSA 5BRNA 4B34A 2W6CX 1E5DA 4FFVA 1F8XA 4MWZA 5BNWA 2UZ1A 1ABBA 4KR2A 4K9NA 2C4KA 2H0QA 4GLBA 4FSHA 5B1EA 4NEHB 4D9EA 4YAIA 2WOJA 1RABA 1VGRA 2XRFA 2MSWA 1PKXA 2BGLA 3AEXA 3ITNA 4BNKA 1BS1A 4OQFA 5CBKA 4OGFA 1EMDA 2IYOA 2NU8A 1S89A 2PFKA 5KYGA 3AM3A 3TDNA 1Z9BA 2J0SA 2ZYIA 2F8LA 1GLGA 4DA6A 1SEPA 3IT1A 4QTUB 4N76A 4EX6A 1AV6A 1D8TA 4M3NA 4MRVA 1UT6A 1NDQA 3FA2A 4L5AA 3L4EA 1KRHA 4QUIA 5ALQA 2QP9X 3K9NA 3CNLA 3I5UA 4XCQA 3KKNA 1JLHA 2ERYA 1EVLA 1CRWG 3GHHA 1KYWA 4BQSA 3CJQA 1YFJA 1YF3A 1N2HA 4EDFA 3KYDA 2IYWA 1AKTA 1NQAO 1OD6A 2A8YA 2C61A 2NSHA 2O4UX 2P7HA 3HCPA 2R1VA 1M8PA 3JQ9A 1RKBA 1LPOA 3JQFC 3H5TA 4LI0A 1E77A 5E9QA 4D5GA 1E3TA 1G63A 4CCWA 3KLOA 5KX5B 1MAWA 1SC4A 2E4YA 2PSJA 3O8DA 4IILA 1H1DA 4IVNA 4A0FA 2OUIA 3BGVA 1Y3BE 3PB3A 3UMFA 2F9FA 3DV0B 3RSQA 1G55A 3IJEB 1U3FA 3BM5A 3A25A 4WE3A 5F76A 1LLUA 2PAFA 3H9UA 4MVJD 2DWQA 4HLUA 3W79A 2R8YA 1W49A 4S2UA 2UYCA 1ZJ6A 4RK1A 1N9KA 4HFNA 3O4RA 1W1IA 1X9HA 2GNAA 1PNOA 2QN1A 3EG5A 4LKOA 4YRFA 4DLNA 1RKUA 3ELBA 5BNZA 2PNFA 3KSRA 3W5UA 1JG2A 4FW9A 2RKOA 3R74A 3WFIA 2H7YA 2QVXX 1YZYA 3IH5A 1CQJA 2B8NA 4CM9D 4B75A 2X1LA 3GJSA 2TMYA 1F20A 2D59A 4MPJA 3LHKA 1T9GS 4RZQA 4DR1B 2V65A 3ILXA 1XGKA 3B6MA 3OE1A 1K6EA 1RBMA 1RAIA 2HHLA 4MICA 2HWYA 1RM3A 3PNBA 1F12A 1H22A 1GGHA 1Y5RA 5E6SA 3GIWA 3N07A 2R85A 4RPHA 1ZRNA 3GN2A 4QYTA 3HUTA 4L4XA 3KR2A 4TVSA 4WBNF 1ID8A 5DCWA 2CZGA 3V7WA 1J9ZA 2V03A 1UINA 4N6NA 5JFOA 2PG3A 1ZK3A 3NVKI 1R8YA 3OJCA 4C78A 1Q50A 2CLLB 2V6JA 1ECJA 1HDGO 5K3EA 1MX9A 3E6AA 3ORRA 2I3DA 3RRJA 5CT8A 1JMVA 2NV2B 2PH7A 2K7ZA 2QRKA 4N8SA 3ZY3A 1DG9A 2LP4Y 1IXYA 1DX4A 2C5SA 3F71A 3CH4B 1F38A 4PLGA 2PHZA 2G8NA 5BQ3A 3GEGA 4LNUB 5IX8A 4XW2A 5AM2A 2QXYA 2Z2YA 3VJLA 3WP0A 1QQTA 3UW3A 3RODA 3ZBPA 1EYZA 3HVHA 3IEUA 2FPRA 4NCKA 1UFVA 2DH5A 2OBNA 2ZQZA 4FZ3A 1WPQA 5ALDA 3O31A 2QZJA 4K6MA 3TSAA 4XVCA 3G8DA 1JDNA 2A1IA 2PZJA 4KUEA 1TAUA 2G5GX 2FTKE 3C87A 2D1SA 4XFKA 4P0QB 4AI6A 3W1EA 3HB4X 2J3EA 4RSGA 2CCGA 3BHIA 3BFXA 1PEDA 3CNOA 3KWJA 2VJLA 2AG6A 3BH6A 1KYIA 4S1VA 5AKZA 3AEUA 3LT1A 3ZNQA 1GADO 1PGNA 2GO7A 4HQLA 3MS4A 3UN1A 5I9NA 4DQLA 2D7JA 3DEAA 1S3SA 2IGTA 2VJAA 1XZNA 3HWRA 4G4GA 1GR0A 1YZTA 5K01A 3RTAA 2XZOA 4LWPA 3L8MA 4M37A 3Q0IA 2VBIA 5CEJA 2A57A 4LW8A 2XADA 1EB9A 1RXIA 2RDMA 3RYHA 5H82A 1FTYA 2AMLA 2VPPA 4L1KA 3CVWA 2A78A 3CZ5A 3V9PA 1PS0A 5PNTA 2P8SA 4QDKA 1N0WA 4BLVA 3KAJA 3HYNA 4R1OA 5CH3A 1TD1A 2WAYA 5EEGA 4UVHA 4EWLA 9GPBA 1X1SA 4DG9A 2NYRA 1E1DA 3EG9A 1JEOA 4YK7A 2ZVPX 4NZZA 3B1KA 1XTIA 4NDZA 1F3LA 1BS2A 2WM8A 3L8FA 5JSQA 4G0YA 4XD7D 4NCAA 3AF4A 4Z0HO 4DABA 3HR8A 3QFHA 3DF7A 3PLNA 3HYLA 1Z5ZA 5EWMB 5LZ2A 2GUWA 3WYGA 1IJEA 1BMQA 1Z6AA 2I4RA 3JQ8B 4HK4A 1QDEA 1QOQB 1NZFA 3WAKA 1M1XB 3UNXA 5L7YA 1P4RA 4XVRA 1YU9A 1ZOLA 2P9BA 1EFUA 3QZUA 1NM5C 4NU6A 2Q4RA 4Q9HA 1PR1A 3MINA 1B23P 1NBEA 4CL2A 2XNSA 2R7KA 3R0XA 4XE5A 1JFVA 4HDMB 4MGHA 3BZUA 1VE7A 4L85A 3C24A 5HEKA 2IZ1A 5DHUA 1SHUX 5IPFA 3U5TA 4TXMA 5D5PA 3KJEA 5LMUB 2JJ1A 2O0LA 1EJBA 3R9IA 1JQKA 1Z36A 2YV4A 4I6EA 4BLQA 2CB9A 4ZTZB 4UTVA 2BFFA 3WIVA 5J4KA 4A0QA 3D8RA 3Q8XB 4AURA 1GU1A 1QTRA 5EQJB 2HNAA 5G40A 2XMDA 5JRDS 3I0ZA 4RDXA 3OEHA 1DV2A 5JCPA 2AJCA 2E49A 1QGZA 2V0CA 4A91A 2PGXA 5JJLA 1CJTC 1E7SA 1ENOA 1ENZA 1JLKA 1RTTA 2R47A 4RDCA 3S8MA 1R0CA 2C3OA 3KT8A 1NVAA 1Q3TA 4PZUA 1NMZA 3CVXA 1C7EA 2OBMA 3VU3A 1NUQA 4F1KA 2JEZA 4IWYA 4BCDA 4FBLA 3OEEA 4QGGA 4DJJA 3B7WA 3QVKA 1H6AA 1PZMA 5JAUA 3P9SA 3PVCA 4D8XA 2A1UB 1ILWA 2ETVA 5KX5F 1CIPA 1QKKA 4DXAA 5KTKA 2ZUEA 3QV1A 3NWJA 4GWGA 4CR8A 4J7XA 1R3UA 1TA9A 3DZDA 1WXGA 4HAWA 3A2LA 3SWWA 2JEOA 4TVBA 3FB4A 1W5FA 2IOQA 1YULA 4U7TB 2ZTUA 4R98A 4ICIA 3ZIAD 1GHTA 2YCBA 2GVZC 1P5HA 3PUXA 4JSYA 4QQNA 4URZR 1OLOA 3EC7A 1USKA 3Q8WA 4HNAB 1E79D 4R2WA 1ICEA 4MXDA 3TX2A 3VMMA 1IPHA 2AMVA 4UZEA 2VJOA 3NNDA 1KSHA 5F4BA 4KQ2A 2H4ZA 2P90A 1NBME 1YR2A 4YLEA 4YMLA 5CXUA 1LS1A 1XCMA 2J9GA 1J21A 1GNLA 1Z5PA 3MJVA 4KMMA 4BWVA 3CT6A 4BAGA 1OBOA 4I9HA 1E3LA 1G9SA 2G7ZA 3TR6A 1JYSA 1Z6GA 3IMGA 4K0RA 4ZVSA 3ZWBA 3AR6A 4PYQA 4G0QA 4GU5A