4ND4A

Crystal structure of the lactate dehydrogenase from cryptosporidium parvum complexed with substrate (pyruvic acid) and cofactor (b-nicotinamide adenine dinucleotide)
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
317
structure length
317
Chain Sequence
MIERRKIAVIGSGQIGGNIAYIVGKDNLADVVLFDIAEGIPQGKALDITHSMVMFGSTSKVIGTNDYADISGSDVVIITASIPGRPKDDRSELLFGNARILDSVAEGVKKYCPNAFVICITNPLDVMVSHFQKVSGLPHNKVCGMAGVLDSSRFRTFIAQHFGVNASDVSANVIGGHGDGMVPATSSVSVGGVPLSSFIKQGLITQEQIDEIVCHTRIAWKEVADNLKTGTAYFAPAAAAVKMAEAYLKDKKAVVPCSAFCSNHYGVKGIYMGVPTIIGKNGVEDILELDLTPLEQKLLGESINEVNTISKVLDNAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural characterization of Cryptosporidium parvum Lactate dehydrogenase.
pubmed doi rcsb
molecule keywords Lactate dehydrogenase, adjacent gene encodes predicted malat
molecule tags Oxidoreductase
source organism Cryptosporidium parvum
total genus 114
structure length 317
sequence length 317
chains with identical sequence B
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2013-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4nd4A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4nd4A02
4YAIA 1AHHA 3U4CA 1YQXA 1LDNA 5G4LA 4MVJH 1RM4A 3R6DA 4R9RA 3TZ6A 1EBFA 2H1SA 4AG3A 1CDOA 4B7UA 4KWHA 2DBVO 4E5MA 4RCVA 1DAPA 1V8BA 2ILTA 5C7LO 3KSUA 1NQAO 2Z1NA 3EDMA 4GLOA 3VAZA 1I3NA 3DB2A 4IMPA 1EEHA 1IULA 3JQGA 5A06A 1PGPA 4QX6A 1UAYA 2CY0A 2GR9A 3CZRA 3T7EA 2Y66A 3A14A 4D7AA 4Z6KA 2E6UX 2P68A 1P33A 1UR5A 4LVUA 1N7GA 4EJ0A 1SEPA 1V9LA 3OFSA 4JN6B 1KC3A 2NNLD 2D3TA 4BB5A 3G17A 3JYPA 2AMFA 3I4FA 4EEZA 2VWGA 3VZPA 1E3JA 3U9LA 4GI2A 1TXGA 3KB6A 4OM8A 5G2OA 2VWPA 3FR7A 4NG5A 3Q2KA 4R16A 1KYQA 3G1TA 4PRKA 4XD2A 4X54A 2AHRA 3GEMA 2VRBA 3MOIA 4RDHA 2CF6A 3ZWAA 4AICA 3U49A 4NJMA 4CLOB 5DDIP 4A2CA 1E6WA 4TVBA 1VSVA 5IF3A 2R00C 4HUJA 3L9XA 3DL2A 3E5MA 5IXSA 4ALIA 2PV7A 1EFLA 1VKNA 1XR3A 1XYGA 2X86A 4PLGA 1M2WA 2B4RO 5CG1A 3H3JA 2BKAA 3U62A 1DIRA 3AUUA 3AU8A 1D1TA 5JPIA 3ZNNA 3TPCA 4WCFB 3S8MA 3AFNA 3OETA 5B4VA 3K31A 3PYMA 3ANLA 4U7WA 2PKRA 3V1TC 3NT2A 3E5RA 3KVOA 4B4WA 5C37A 1I3MA 3KYCB 4R9SA 1PJ2A 4FPXA 1BGVA 1GYRA 1F17A 4GH5A 3U0BA 3W8EA 1WZIA 1E7YA 1B3RA 1KEUA 5FFFA 3VVBA 3EMKA 4JJGA 3Q11A 3ZHXA 3FR8A 3MJEA 3SBOA 3PJFA 1YOVA 4EI2A 5EPOA 1U2DA 4GQAA 3WSWA 3FD8A 3GPIA 5G0SA 4E13A 2WEKA 4AJLA 3OM9A 3MJ4A 4OJNA 1KETA 4OAQA 5K6AA 4YT5A 2HSDA 1HF3A 2BFOA 1UXGA 2VTDA 1UXHA 3DAGA 4MVJI 4UVHA 1A9ZA 3NTRA 5TF4A 3RI3A 1W6UA 4ZICA 4CLRA 1LTHR 2VNAA 1VL8A 5B1YA 2W2KA 3K92A 1E6EA 5IZ4A 5T67A 4Y9DA 3H2ZA 4BNUA 3JQAB 1ADGA 4LISA 4FGWA 2I76A 2I6TA 3JQAA 4MVJE 1WMBA 4ND1A 3I23A 3PJDA 5EQFA 1LSSA 3WGIA 4RVGA 5G0WA 4R1TA 3DZFA 3WS7A 1ONPA 2DTEA 2O3TA 3RUFA 3UH1A 2AQHA 3QY9A 2JHGA 4PZDA 1R66A 3OEWA 1EQ2A 4WJZA 1F06A 5T8KC 4CMHA 4DA9A 2HMWA 5TIIA 1PL7A 3GN1A 4E30A 1H6AA 2FSVA 3WGTA 4J6FA 3VPSA 3C1AA 3DTYA 5CPBA 3GN2A 4NR0A 3H4VA 2OUIA 2P5YA 3PDUA 4ND4A 3QE3A 1EMDA 5I7EA 1SNYA 3W1VA 3WWYA 1HLPA 1NAIA 2D8AA 1PQUA 1E7WA 3IKVA 4MP6A 4WLUA 5JC1A 1WDMA 3NDIA 4BIIA 2O3SA 2C7GA 1GEEA 2R2GA 1ZMTA 4ONEA 2POQX 3E48A 1YL6A 4Y6PA 1E1MA 3BMOB 5FYDA 1NFFA 1Y8RA 1C3VA 2NVUB 3IMFA 3PXXA 3RASA 4Q39A 1SO8A 3BMOA 3MTJA 3OQ6A 1CQIA 3LK7A 4NMHA 1XA0A 5CDSA 4R54A 4PLZA 4RPKA 3KM0A 1MC4A 2EHDA 1PWXA 5FI5A 2Y1EA 3D3EA 5T5QA 1I3KA 1MXHA 3ICCA 1F14A 3BMQA 4OKNA 3MJVA 4DUPA 1HDYA 3D3WB 3FNGA 3RIHA 4AJNA 4XIYA 4W9NC 1T4DA 4ZGWA 1LC3A 3L6DA 1ZK2A 2VQ3A 2I99A 3D4PA 4CMEC 2D5CA 3KO8A 3D7LA 3T7CA 3A9WA 4CMJA 2CD9A 2Q1WA 4DMMA 4YRBA 1KVTA 3NT4A 2GN4A 2J5QA 3OH8A 1HDZA 4RQTA 4UAGA 4Q9NA 1LSOA 3ASUA 5MDHA 4GKVA 1DFIA 2VZ0A 2W2LA 2FR1A 1VRWA 1OAAA 3CXRA 4B4UA 1R6DA 4DQUA 3JD1A 2QQ5A 1PX0A 1QYCA 2DFVA 3DBHA 4BO5A 4R68A 1DAOA 4I1IA 4A03A 4YCAA 4L76A 4RJTA 3VOSA 4FOSA 3PWZA 4CM8B 3TQHA 4P4NA 4U0JA 2P91A 3E82A 2OP1A 3X2FA 2EWMA 1WXDA 2B0JA 1ZO8A 1VM6A 3DBVO 1U3VA 3PLNA 2GPTA 3DAPA 5KJ6A 2Y0EA 2OFPA 3C7CB 2DC1A 5TJHA 4RPGA 3DZGA 3WWZA 1I30A 4Z0PA 3NV9A 4RO0A 3TFOA 3JYOA 4A0SA 1BRMA 2PWZA 2CF5A 3GG9A 2WMDA 1ZW1A 2C5EA 4OL9A 1LBEA 4EITA 4NHEA 1ZK1A 3GZNA 4IS2A 4CM4A 4HV4A 2FPIA 3ONDA 4W6ZA 3QWBA 1MLDA 3DZJA 2EG9A 3GGGA 5JLAA 1WZEA 3LT4A 1X1TA 4PVCA 1EE2A 1RYDA 2X7HA 3GDGA 1FXSA 1GPJA 2IXAA 1EVIA 5A05A 3HJAA 4E12A 4R69A 3RAJA 1JWAB 3CMCO 3EY4A 3KBOA 3OIFA 1E3EA 3JD3A 1BSVA 5KJEA 4DWVA 3GLQA 1KOLA 4AJHA 1UUFA 1DDOA 1MC5A 3QSGA 4R4JA 4DVJA 2B37A 3DMTC 3O9ZA 4QSMA 5KCZA 1NHWA 1G0NA 1FMCA 3E03A 4LCJA 2ZATA 3K8ZA 1H9BA 2J3IA 2PKQO 2CFCA 4BGVA 1PJBA 2B35A 4N5NA 2Q4EA 2JAPA 3IQDB 4XYGA 5U9CA 1XHLA 1HSZA 3OSUA 3H9JA 3ITDA 4D3SA 5TSDA 2AQKA 1E3LA 1QV7A 4RLHA 1JA9A 2Y67A 3WQSB 1R15A 3K6JA 4NJOA 4GWGA 3VH2A 1DOHA 1TVEA 3RFTA 1HTBA 4CR7A 4J0FA 5KVVA 2AE1A 3KYDA 3HE3A 5ITWA 1P1KA 1GCOA 4BNNA 1XWFA 5ER9A 4EUEA 3TZCA 1TI7A 1HE3A 4CMAA 4RPJA 4M1QA 4FJ0A 1BHSA 1C1DA 2AE2A 1C1XA 1IHXA 2D5AA 3KV3O 1XQ6A 3OBBA 3W6ZA 2BFAA 1VLLA 4YT2A 5JDIC 3DMYA 5LDHA 4HNHA 4F6CA 1QG6A 4IMRA 2ZB3A 1DJQA 3FTPA 5B12A 1O89A 4RZHA 4D42A 3RBZA 1I0ZA 3FHLA 3VZSA 4CQLA 5CDYA 3QRWA 3PQEA 4D43A 5JE8A 2NTJA 3GGOA 3WB9A 2DPHA 3PYXA 4CLHA 4L4XA 1U1IA 4M87A 3F5SA 4DLAA 4B8WA 3CE6A 4RGBA 1PGNA 3ANNA 4IIVA 1VJ1A 3I52A 1LRJA 3ENNA 5F21A 1CERA 5DP1A 3ADOA 5TGDA 3WQRA 1ISGA 3HN7A 1ZKMA 4DBZA 4JROA 3SVTA 1ZJZA 2YQ4A 1PZGA 1NVMB 1LQTA 2WD7B 1H94A 3IJRA 4GSLA 4WECA 1UXJA 2VRCD 4XZ3A 3NEPX 4JGBA 4NU6A 1O6ZA 3WJ7A 2YFHA 1BDMA 1LLQA 2YHIA 5EN4A 3AU9A 3HADA 1PGQA 4NFHA 3BTSA 1P1FA 3KHUA 1QLHA 4RVFA 2C7VA 4ND5A 1U9JA 4OSPA 1GUZA 3RD5A 4LMRA 4AJPA 4IUYA 4DTIA 3CKYA 3FPCA 3K9QO 4FQ8A 4OXNA 3ZHBA 4FCCA 4MVJD 4IPTA 2HLPA 9LDTA 1V3VA 5A3JA 2VYVA 1A72A 1NASA 4HNGA 1M6HA 2DT5A 2NV6A 5T8KA 5CP8A 2UYYA 3AUSA 3RROA 1GUFA 3C3XA 2VHVA 1G6KA 3L9WA 2ZCUA 1W0CA 1H0KA 1TEHA 1KIFA 4NU5A 4IZHA 1GZ3A 1IZ0A 3BHMA 3WMWA 1P44A 3BMNA 3ZNPA 3VH3A 1LI4A 5AXBA 4IQGA 4CMIB 2G76A 2QIOA 3DBLB 3OQBA 1Q7BA 1N7HA 5DCYA 3ZWXA 3DHYA 3ZV5A 3P2OA 1K6IA 3WGOA 4KWIA 4Z0TA 3TOXA 3IKTA 3RC9A 3X2EA 4E5PA 2O48X 3K96A 4RDIA 2GDZA 1SAYA 2EKLA 4II3A 3HFGA 3ORFA 5F1PA 4BNHA 5J23A 3GMDA 2DLDA 2LDBA 3DOCA 1XGKA 1PWZA 1DRVA 2GGSA 3MEQA 4HKTA 3TNLA 3OECA 4JQCA 1ZH8A 3FF4A 4HFRA 5A1TA 2WYUA 5ILGA 3ULKA 4TRJA 4J1SA 4BNMA 3EC7A 2WE8A 3HB4X 4RLSA 1J0XO 4CM5A 3WXBA 3V8BA 2NACA 4IDGA 2I66A 5HM8A 3LT1A 2HMSA 4PG8A 2HRZA 4GLLA 5L51A 5ICMA 1JVBA 3B1KA 3EAGA 4UUMA 3WGYA 3RWBA 1CQJA 4R5MA 1ADBA 2HJRA 3OJ0A 3QWAA 3AM4A 1DRWA 1QORA 2PZJA 3O26A 4UVEA 3T4XA 3VZRA 5EINA 1A7AA 2AEMA 4W9NA 5TNXA 4EZBA 5F5NA 1DLIA 4II2A 4YJFB 4CR6A 4BGIA 3NTQA 3OA2A 3QQPA 4I8XA 5I8ZA 1LQUA 4EDFA 1ZSVA 2NUAA 4ND3A 4IQ0A 2B4QA 2ZK7A 2Z1MA 4QFDA 3WG9A 1Y8QB 4R3NA 4YAEA 5L4SA 3HFSA 3AY7A 2Q50A 4CL3A 3G49A 1O0SA 2VTEA 3AUTA 4PVDA 3TL3A 2DBZA 3GG2A 2B69A 2J8ZA 4PIVA 2G17A 1Q7GA 1RWBA 4J4TA 3WGGA 4DPLA 3ZZNA 5A3VA 1LU9A 1LRLA 3RC2A 1MFPA 1BDBA 4L9RA 1EDOA 5JYDA 5L9AA 4J3FA 4S1VA 5GY7A 4YJDA 2EJWA 2AEJA 3FN4A 3L6EA 1BMDA 9LDBA 2D1YA 1B8UA 4BNYA 2I9PA 1QXSA 4WOJA 1NQTA 2NWQA 1KS9A 3W8DA 2YDYA 4B79A 1HLDA 1L7DA 4MVJP 3L4BC 3LC2O 3DAFA 3OJFA 4NIMA 3IC5A 3BHJA 5L4LA 4FS3A 1C0IA 3H6KA 2GD1O 4CV0A 1NFRA 4HFMA 3T4EA 4RVUA 4GX5A 1SCUA 2RCYA 4NI5A 4C4OA 5G0VA 1Q0LA 1HXHA 3LT2A 3GA0A 1LSJA 1FDWA 1QYXA 3CSDA 2Q3EA 1F8FA 5TS3A 3COSA 2Z95A 1ZK4A 4DIFA 1Z73A 3QVTA 2E49A 1AHIA 4B4OA 4TVOA 1X7DA 1F8GA 3FBTA 1I2BA 4WLOA 3DMTA 1X7HA 4PLTA 1ISHA 1E7SA 4CR8A 1FF9A 2HU2A 1O94A 5GZ3A 2AG8A 4IXTA 3GAZA 1ZVMA 3OEYA 1XG5A 1WVGA 5KIAA 2D59A 4YAGA 2V6GA 1HDXA 1U7TA 3F5QA 4N7RA 3C24A 5DCUA 2NADA 4WLNA 3NKLA 4ITUA 2IZZA 3H8VA 4IDDA 3DZHA 2Q2VA 3OICA 1GPDG 3EZYA 1U5CA 2AW5A 3VKUA 2DUWA 3CMMA 1VC2A 1GU7A 2G1UA 1LRKA 3DOOA 3M2TA 3MOGA 5AXDA 3V2HA 3V5NA 3KUXA 4FD3A 3WLFA 4YJHA 3K73O 4B7CA 4XX0A 3G3EA 4RF3A 4GKBA 4Q3AA 3AFMA 3AWDA 1XU7A 1JAYA 2O50A 5IZCC 3ST7A 2WYWA 4GGPA 3LVFO 4M49A 4MPDA 4XKJA 1HWYA 2AEFA 1KEWA 3D1LA 5A03A 4IM7A 3VVCA 4DREA 1ZIDA 1KEPA 4GMGA 2Q4BA 2O7SA 2JFFA 4YT4A 1HDGO 5TC4A 3V1UA 5K0ZA 5IDQA 3DXFA 4QO7A 4BNGA 4IQ8A 1AXEA 2FR0A 2W98A 1T2DA 2ZCVA 4R3WA 4RVSA 1P74A 1E7RA 2AQIA 2O4UX 4BVAA 3PHLA 2OBNA 3CTMA 4R5HA 3QA9A 1HE5A 3BXXA 3WGZA 5ILOA 3HHPA 1QYVA 3SJUA 3DWFA 3I9MA 3WIDA 1V35A 3FNFA 3QJ5A 1OMOA 4YYZA 1EZ4A 3PRJA 2Q49A 1YQGA 5JYEA 3JQEA 3HDQA 3DZIA 3GT0A 1ARZA 1GDHA 1XU9A 2J6IA 2XPCA 3GZ4A 1B15A 1PU2A 5DN9A 1G1AA 5HWSA 3ANMA 3NTOA 4LK3A 2D4AA 4KTTE 2QRKA 3SC4A 3DBRA 4TZTA 1U8XX 3JQBC 4J7UA 2PGLA 1C0LA 4UEOA 4XRRA 1P31A 5DBFA 3JQGB 1Q7CA 1RM3A 2A9FA 3PP8A 4RF2A 3ZU5A 1J49A 1U4OA 1R0KA 4DPKA 3U3XA 3GPDG 2PGJA 1FDTA 3HZZA 4KUHA 1RPNA 4O5OA 1BXKA 4I5EA 3W4IA 4Z3KA 3SC6A 1NWCA 2QZ9A 1PTJA 2DAPA 3GRPA 1IYZA 2DM6A 5LCXA 3LU1A 5I7VA 3INRA 2QYSA 4BNWA 3H5AA 5JCXA 3DTTA 3EVNA 2PD4A 3O8QA 3GC6A 4LRSB 2WDZA 3CH6A 2B5WA 1VI2A 5KJCA 4INAA 3RVDA 3MTGA 5FF9A 3E18A 1PIWA 4CMBA 5F3RA 1GEGA 3NGLA 1XKQA 1QRRA 2EXXA 4GVLA 4DMLA 1NVGA 3BMCA 4TROA 2F1KA 3EYWA 4NJMB 4BMSA 4GL4A 2FOIA 3K5PA 1HRDA 2CVQA 4DXHA 1HKUA 4CV2A 3OQ1A 5BSFA 4ALLA 3C1OA 1LC0A 5THKA 3L6OO 4CLDA 4WNIA 4LN1A 5H83A 4BNIA 3Q2IA 3NAQA 4Q3NA 3I9LA 2E37A 3DHNA 1F0YA 2ZTMA 3ZV3A 1FJHA 3JQFC 1WMAA 4FSHA 5I7FA 2V6BA 4PLVA 1B8PA 3PZRA 1QR6A 4YQZA 1B26A 1PJQA 2EV9A 4K6CA 4MKXA 3I9OA 2UUPA 1PZFA 3IAHA 4DPMA 3JQDA 1Z45A 1PGOA 2H6EA 2XF8A 1WNTA 3GDFA 5T64A 2NU8A 4D41A 5BNTA 1E1LA 3I83A 4J1NA 1XSEA 2CDCA 1CRWG 3Q3CA 3LLVA 5IN5A 1YONA 1Q2XA 4EYEA 5U4QA 1LDMA 1YOVB 5A04A 1LDGA 1M6WA 3BAZA 4XR4A 1C14A 3H9GA 3JQ8A 5BSHA 4L73A 2JD2A 1E77A 2BHLA 1BG6A 1VKOA 1ENOA 3D4OA 3F1KA 4CV1A 4PZCA 1DBVO 3D64A 5AVOA 2ZQYA 4E21A 2C5AA 3PTZA 2UVDA 5C7OO 4BNVA 3UXYA 2EERA 4L0QA 4RORA 4WOKA 5ITVA 4PFJA 3ZNOA 4CLRB 3VPFA 1ZMOA 1LDYA 1T2CA 1Q1NA 2W2KB 5COQA 5H81A 3KLMX 3LC1O 1PZHA 6LDHA 4Z0HO 1KBZA 1U3TA 4DQXA 4K6FA 4XIJA 4NBWA 1DC6A 2J3JA 3IOYA 5HRUA 1ZSYA 3JD2A 3EK2A 2W90A 3H3FA 4FFRA 1GQ2A 4JK3A 1DB3A 4NH4A 3D4NA 3ZU4A 1XELA 4CMKA 4BKQA 2P5UA 3A06A 4MOWA 4WUVA 4XYEA 4EJMA 5JW6A 3SLGA 1N1GA 1NBOA 3RQSA 1DFHA 4AJEA 2GYYA 4PZEA 3V1YA 4H7PA 4YJGB 1EVJA 1E1KA 2UUOA 5KTKA 3DR3A 2Q2WA 1IB6A 5H82A 4MVJG 3AW9A 4YJGA 5EQDA 4IDFA 1ULUA 2FRDA 3E8XA 2J5RA 1OC4A 3HDYA 3M6IA 4ZN6A 3TRIA 5BSEA 5IDXA 1A71A 1U4SA 4UUPA 2RHRA 4WCDA 4R51A 2NSDA 3C7AA 1ZJYA 1MX3A 4CLEA 5I9LA 3KEOA 1NHGA 1GAEO 4OIMA 3PQDA 1X1EA 2GERA 3IP3A 3RUHA 3VTFA 5BR7A 3JQ6A 1Y8RB 3AOEC 4CQMD 5EERA 4FJ2A 2P9GA 4BKUA 4BO9A 4I5GA 4PLHA 2X6TA 5DOZA 4LMPA 2Y1FA 3ASVA 2YYYA 3B70A 4F3YA 3FRJA 3AI2A 4QEDA 1I2CA 5F5LA 2Q2QA 1I36A 3F3SA 4J7XA 4ZA2A 4BKPA 1U3WA 3BMQB 2PTGA 3KSDO 1KVSA 4BHTA 1J6UA 4IDCA 2Q99A 1Z6ZA 4WEOA 4WKGA 4AJOA 1U8FO 1XEAA 4OKIA 4F46A 1ENZA 2OZPA 2CMDA 3I9NA 4GBJA 4XQ9A 4MVJA 4DLBA 3OJLA 3PQFA 5DCWA 2BMAA 5F1OA 4B3JA 3H9UA 2OXIA 2GASA 2Y1GA 1NYTA 2EW8A 1IUKA 4IBOA 2ZYDA 1T4BA 5GZ6A 4J0EA 3UGKA 2GN9A 3DBHB 2O3UA 1WW8A 3VPGA 3FWNA 5B4TA 4YTEA 3E6AA 5CEEA 1R4MA 3TF5A 3VPXA 1K0UA 3L0DA 3JQ9A 4L75A 1OFGA 1UZMA 4QO8A 2A4KA 2EIHA 4H3VA 4Q3EA 1D7OA 3NT5A 1BW9A 1H2HA 2YDXA 4JJFA 1M67A 4HFNA 3ZWMA 4QT0A 3WIEA 1A27A 1KC1A 1E5LA 4TZKA 2ZB7A 4ZD6A 4BV8A 3BZUA 1ENYA 1U5AA 1ZNQO 3NJ8A 3UCEA 1LNQA 2JKVA 1MG5A 1P0CA 2PR2A 3M1LA 3ZNQA 4G5HA 3MJCA 4JBIA 3GZNB 1BVRA 3OIGA 4CM4B 1I32A 3KLPX 2GN8A 2IZ0A 1H6DA 4NBUA 3AOGA 3BHIA 4KQWA 4BMVA 3QVXA 5IN4A 3ZCXA 1P1IA 2BI8A 1UZLA 4DBVO 1F12A 2IEBA 2QX7A 1YB5A 2Z5LA 4J49A 4N5MA 4XGKA 5KJFA 4PG4A 4BO4A 4TMFA 5KWEA 4BO6A 3GHYA 3JQBA 4CJXA 3PZBA 1FK8A 3I1JA 5B4UA 1T25A 2P9CA 2XOXA 2P2SA 3AUAA 3DFUA 1PR9A 3GRKA 4HWKA 2HRBA 4JBGA 2FZEA 4WLEA 1NFQA 1SPXA 1Y5MA 4BO2A 3F46A 5L4NA 1GUYA 3RUDA 5JMWA 3JQ7B 3UKOA 1LEHA 4G2NA 3U4DA 4DGSA 4E0BA 2XAAA 4L4SA 4J4BA 1SB8A 3JQ7A 4YRDA 1Y6JA 1I5RA 5K9ZA 5LDGA 1IE3A 2Y99A 3H9EO 1EE9A 2EGHA 4L8VA 3S2EA 2FY8A 1A5ZA 4BO0A 3F4BA 3KYDB 2OHXA 1GYPA 1HEUA 3C85A 2ZTLA 1YO6A 4XJSA 5EIOA 3GAFA 1UP6A 3MWEB 3ZU3A 2C2XA 4E33A 1ADFA 3RUEA 4N5LA 4E5NA 1B7GO 4J9UE 2R00A 5BNIA 2QG4A 1BXGA 2VUTA 4OXYA 1C1DB 1C1XB 1GQYA 3D0OA 1VE9A 2GZ1A 4FC7A 4MVJF 4XB2A 2VUUA 2IDZA 1EK5A 2X0NA 3WDSA 2GZ2A 1T26A 5JAMA 4JXKA 4WEQA 1ZXLA 4O59O 4XYBA 3VHRA 3JQFA 1HDCA 5COBA 3ETEA 2BLLA 2NLOA 3QVSA 4W4TA 5I9NA 3OA0A 5JY1A 4OGWA 1XLTA 1DIHA 3P5SA 4N54A 4OOEA 1IZ9A 3FNEA 2D0IA 5DULA 3CINA 3ETGA 2NQTA 2C20A 4KP7A 4CQLB 4CM9D 4ZQGA 3ONFA 1FDVA 1BWSA 2P4QA 3JQAD 4OSOA 2PZMA 2PH5A 1NAHA 3FBGA 3E9NA 5JCJD 2X5KO 1E6UA 4B3IA 5TT1A 4L4RA 1E3IA 4NFYA 3PJGA 4YB8A 2D2IA 4IJVA 3GMSA 5L7TA 3ZWBA 2HK9A 4M86A 2EW2A 3RSHA 5ADHA 3D5QA 4J9VA 1LLUA 1RM0A 2PZLA 2PY6A 3B1JA 3P7MA 1DFGA 1LA2A 3A1NA 1JKJA 3RUAA 4BNLA 2Y05A 2YHIB 4ZQHA 3E9QA 4IZIA 4U0KA 3G1UA 3EVTA 1JU9A 1NQ5A 2JCXA 1ZBQA 5C5IA 4ZQEA 4PLFA 2JAHA 2YQ5A 4IY1A 1ZZEA 2IZ1A 3TL2A 2HK8A 3FWZA 5JY6A 4NZ9A 3FSRA 4PLPA 4RL6A 3GVHA 3UAGA 1U2GA 1E3SA 2YUTA 4XYMA 4J43A 3UF0A 1OOEA 2Q46A 2SCUA 4XDYA 2ZIZA 4XJTA 3NDJA 2O7QA 1E5QA 4JIGA 1ISFA 2PKQP 1D1SA 1ADCA 1B8VA 1KVQA 3TN7A 3ZWYA 4F6LA 5GMOA 1IOLA 1YKFA 3L07A 4FW8A 2A35A 3BMNB 3QVWA 3N74A 3R3SA 1UJMA 5BSGA 4FN4A 5A9RA 5JO0A 5CDUA 1QMGA 5JC8A 5A9SA 1ZEMA 3GGPA 4P4LA 4QECA 4ZRNA 3H65A 1ZCJA 4PCVA 3UUWA 4JLWA 4WE3A 1HE2A 4LW8A 1PGJA 5DZSA 3M2PA 2G5CA 2BI7A 1YRLA 4FFOA 3ZGYA 3L77A 4FBGA 1YGYA 2R6JA 2GN6A 1NQOA 2X5JO 3DQPA 4XA8A 5HS6A 5AQ1A 1EVYA 2TMDA 4MP3A 2NVBA 3AY3A 5KOIA 3OJEA 4GX1A 3BTUA 5CEFA 1PQWA 1UDBA 2X9GA 2AG5A 2HMTA 3ENKA 4BOYA 5B37A 3H9QA 4MVJM 3D5TA 2JFGA 3WGHA 3F6YA 4XQCA 4J1TA 2I3AA 3HNPA 4MKRA 3ZW8A 3DFZA 4WCFC 1TT5A 4CMEA 2WYVA 1YVEI 4CODB 2OP0A 3JYLA 2ET6A 1VL6A 4CM6A 1A7KA 3R0IA 1V6AA 4TWRA 4HADA 4Z3DA 5IDYA 1MGOA 3UOGA 2BFPA 3PEFA 4D44A 4K28A 2C59A 1PL6A 5A4DA 5DT9A 3EW7A 1JN0A 3PGJA 2PH3A 3QP9A 1YB1A 3BTOA 3ZH2A 4FFLA 3C8MA 5HTOA 4N18A 1YB4A 4IJWA 1TA4A 4J2HA 1EUZA 1N9GB 2DQ4A 4OOFA 4J1QA 1FDUA 3GVPA 1VSUA 4HFJA 2ZTVA 1N9GA 3RBVA 1IPFA 4ZQBA 2DFDA 3RJ9A 1X0XA 3ZHZA 3I9KA 4I5FA 3B1FA 3LDHA 1PS9A 2GNAA 3H2SA 3KSZO 4ZU3A 4IJKA 4KTVE 1R37A 5EJ2A 3RCBA 1EUCA 1NWHA 4FIZA 4XQGA 3WYCA 4YDRA 3H5RA 1WPQA 4PLCA 5GZ1A 4OYRA 4RV9A 4Y67A 5CPFA 4WLVA 3FI9A 3I3OA 4FB5A 2NU6A 1O9BA 1ZEJA 2FHSA 2VWQA 4GSKA 5BQFA 1NR7A 1DRUA 3CIFA 5ICSA 1ORRA 1EDZA 4GAEA 4GPD1 3P2YA 3UICA 1GQQA 1SOVA 1QV6A 3S2IA 4HX5A 2FPGA 5CG2A 4EUFA 3DOJA 2QRJA 2H5LA 2GO1A 4KMSA 1DLJA 2RIRA 1J4AA 3K2BA 1SB9A 5A02A 5JAQA 2VHWA 5MGBA 1TT7A 5I7SA 2X0RA 1SMKA 4DYVA 2B83A 3WSVA 3KTDA 1LSUA 4PG6A 4TRRA 2TMGA 2YHUA 2VYND 2CNBA 4HBGA 3V2UA 4J2OA 4J91A 4FR5A 2RBEA 1CWUA 1JWBB 4J90A 4R1SA 4BQPA 4E31A 4YBZA 4OQZA 2J3HA 4NBTA 3TZQA 4CLOA 3HDHA 3QWHA 1S6YA 1R0LA 3JSAA 4IIUA 1RM5A 1UP4A 3GH3A 2DBRA 4RVHA 4GWKA 2V7PA 3VH4A 4BO8A 2ZB8A 4YA6A 2X22A 1C0KA 4KZPA 2VHXA 4EEXA 1ULSA 1FDSA 2WTBA 1O95A 4HY3A 4QFCA 1T1SA 3ZWVA 2HMVA 4PGFA 4NK4A 4DIBA 3CZMA 3WTBA 4S3MA 3WNVA 5G4KB 1HT0A 3MJSA 4XQEA 4YJHB 2ZTUA 5DBGA 3Q1LA 2VWHA 2G82A 4U6SA 1DSSG 1X0VA 2V6FA 5G4KA 5TJ9A 1YWGO 1JAXA 3IDSA 3RC1A 3RU9A 5JBIA 2RH4A 3ZV6A 1HZJA 3OIDA 4RPLA 4DQVA 3HUDA 2CDAA 3NDRA 4HP8A 1GD1O 3NJ4A 3LF2A 1H2BA 1G0OA 1Q0QA 3LZ6A 2JD0A 4LSMA 4I9NA 4ZHSA 3OJOA 3PWSA 1DC3A 1A4UA 1GYQA 4FFNA 2Y0CA 4MO2A 2DUUA 2HKIA 4ALJA 4H15A 1T2FA 1GZ6A 5KKCA 4BQRA 2PD6A 2BRUA 1YL5A 2BGLA 3GEGA 3IIEA 5JDIA 3NGXA 4A5OA 1M75A 1KERA 1JTVA 3KZVA 4YVFA 3SX2A 2OOSA 2WE7A 4E2ZA 4BO7A 1PJSA 1YXMA 1Z7EA 2P9EA 4YPOA 2JCVA 3DONA 4BO1A 1K3TA 3R3JA 1WDKA 3BTVA 4G65A 3Q0EA 2HQ1A 4IDBA 3VZQA 1CYDA 3NYWA 2BGKA 1SBYA 3DHEA 2F00A 6ADHA 4NK5A 3WNQA 3PGXA 1PJCA 4P8RA 3W8FA 1T1RA 4ZJUA 3ADPA 5TX7A 4EGFA 5JFOA 3DBRB 4K26A 1AGNA 2NVWA 5ER6A 4QUKA 1GV1A 4YXFA 2FZWA 3AM5A 1DXYA 4NBVA 1S7CA 3NX4A 4A73A 3GHHA 4C7JA 4IJUA 2NM0A 3TFQA 4DLLA 2V65A 2WD8A 5ENDA 1AXGA 1P1RA 2FMUA 4W7HA 4XDZA 1P77A 4UVGA 1T2AA 2GSDA 5FI3A 4FFMA 3GNTA 7MDHA 3PVZA 1PR3A 2CVOA 3O8QB 1K89A 1QLJA 3KXDA 4D3DA 3O03A 3GF4A 4AFNA 3BYZA 3TOZA 3BA1A 4RQUA 3OMLA 4OO3A 5IG2A 1P1HA 4DIOA 3BMCB 1QYWA 4ZRMA 2AA3A 2I65A 2DTDA 3FPLA 1JDJA 1J5PA 2C82A 4XGIA 5JAIA 1PS0A 4NDNE 3JTMA 4PLWA 4CM7A 8LDHA 2YW9A 2QW8A 4Z9FA 5C7IO 2BFMA 3DDNA 2VNSA 3WBBA 2X8LA 4I5DA 5F1KA 3B6ZA 4CUKA 3GR6A 1MP0A 1NTOA 4GX2A 3LQFA 3H7AA 1MXFA 4RF4A 3GDOA 2VOEA 3AI1A 4MIYA 3AI3A 4GVXA 1JLLA 4E5KA 2JD1A 2FPPA 1DIBA 2X1HA 3ROQA 4F45A 4YWJA 3KETA 1YQDA 2P4HX 4I9UA 4E6PA 4W99A 3ZWNA 5CEJA 4JX8A 3WGQA 5TLSA 3LF1A 1EK6A 1IPEA 1K6XA 3B20A 1M76A 1OI7A 3UCFA 4BO3A 3JQ8B 3GK3A 4IDEA 2VOJA 4EBFA 1DO8A 3OF2A 4YR9A 3PHHA 4PG5A 1GFSA 4FFPA 1DHTA 1HE4A 5IDWA 2EEZA 4ID9A 1LDBA 4WCFA 3JD0A 4KDFA 5DNAA 2EGGA 3VPHA 5A5FA 4PLYA 1PQPA 4JNKA 1X13A 1E92A 3QIVA 3QVOA 3STHA 3WYEA 4RPHA 4MIOA 1GL3A 3FNHA 3KYCA 1NM5A 2ZYGA 1U28A 1W4ZA 5KJ1A 1UXIA 4NBRA 4CL8A 3IS3A 2UAGA 3WR5A 4NPCA 1ONNA 1QP8A 4Q3CA 4TRMA 4UULA 3WBFA 3ZN2A 3ROMA 3PDJA 1H6BA 2VUSA 1LLCA 5HA5A 4WK6A 2NU9A 3E1KA 4TSKA 3ZWCA 3RJ5A 1JKIA 2YV1A 3R1IA 2YV3A 4FDAA 4XRGA 4CV3A 1WDLA 2FR8A 3ZWOA 4DL9A 4BKOA 1UZNA 1CJCA 5IXYA 4CM3A 1W8DA 1Y9AA 2VN8A 4CM1A 3IUPA 1KY5A 2A92A 5L53A 4G81A 2LDXA 4TKLA 3GUCA 4JP2A 3LT0A 1AN9A 3FTNA 3PFFA 4CM9A 1Z75A 1R12A 4UVIA 2DTXA 5L45A 2X0IA 3ON5A 3Q9UA 4Q3BA 4FGSA 3L4BA 5ES3A 3RFVA 2QZZA 3VDQA 3PIIA 2RHCA 1NR1A 3SJ7A 4D3FA 5JCJA 1LDEA 1MV8A 3PIDA 4CMGA 4OMUA 4B8ZA 4XWYA 2IEDA 1B16A 1ISMA 4YT8A 3JD4A 1HZZA 5DOVA 2VCYA 2ZJ0A 4BKRA 2UDPA 4K9DA 2Q1UA 5CDTA 4FC6A 1KY4A 3AM3A 3F1LA 1Y81A 1GCUA 2GRAA 4XB1A 2GZ3A 1HYHA 3UCXA 3HB5X 4QQRA 3WJAA 3OP4A 1ML3A 1Q0HA 3PHJA 1NP3A 1B2LA 3PFWO 3EHEA 4UVDA 2VRCA 3S2GA 4NNJA 1ZSNA 2W8ZA 2OBYA 4R01A 1GADO 2GUGA 3UHAA 2BD0A 5JAZA 5TT0A 2QYTA 4XGNA 1KVUA 3HG7A 4IINA 1PJ3A 4B3HA 3PK0A 4D46A 3DEYX 2IXBA 1NPTO 3ABIA 2VZ9A 3PPIA 4LCEA 4Z9YA 4DC1A 3TZKA 1LLDA 4EW6A 3AJRA 3NUGA 2NVUA 3RBXA 3SLKA 2HAEA 4YAJA 5BNFA 4AJJA 4P38A 3PLRA 3WX0A 5L40A 1K2WA 2HMUA 1ONOA 3F9IA 1LJ8A 1HSOA 4U8GA 1R4MB 1D4FA 2IODA 5JO9A 4IGFA 3GFGA 4OH1A 5IZCA 1XIVA 3BIOA 1C0PA 5L7WA 4OHUA 1BW9B 1DJNA 1JKFA 1Z82A 1TLTA 3D3WA 8ADHA 2JHFA 3M1AA 2CVZA 5JMPA 3ETDA 3KYBA 1ISJA 2IYOA 2OMEA 2X9NA 1V3TA 2DKNA 4P4GA 5COAA 1JVSA 5KVSA 4JJIA 1GTMA 3JQCA 3IL2A 2O3JA 4M89A 4ESOA 5JS6A 1D3AA 1QSGA 3JYQA 2C0CA 3G0OA 1M66A 3LSYA 1P45A 3IUSA 3PHIA 2EP7A 4ZQFA 3RFXA 5EL0A 1UAGA 1UXKA 1WLYA 1HDRA 1DEHA 4AVYA 1N92A 3O38A 4CM8A 5AOVA 2HJSA 1OC2A 1R4NB 4IS3A 2PFGA 1L1FA 2ZJ1A 2WSBA 4BGUA 1R4NA 1MG0A 3S1LA 4YAKA 3DZBA 1VPDA 1TB4A 4Z9XA 4K1LA 4IGEA 3TDKA 3ICPA 1JW9B 4E32A 4FJ1A 1WWKA 1BXZA 2O3QA 1YL7A 4PG7A 3QW2A 4RF5A 4CPDA 4A26A 1EFKA 3QWIA 3DZKA 1CEQA 4Y8VA 3ZWWA 7ADHA 2FSSA 2X0JA 1GR0A 1EQUA 1GZ4A 2NTVA 1L7EA 3EZLA 3TJRA 3VH1A 1QYDA 3RUCA 2VT3A 1BTOA 1SC6A 5L95A 3ZW9A 1I3LA 1KEVA 2C2YA 4UUOA 4KUGA 2OO5A 5AXAA 5AXCA 1V3UA 3H5NA 3C7DB 3GFBA 2RAFA 3OHSX 5TQVA 2HUNA 4I08A 5G0UA 3ZI0A 1B3BA 3RKUA 4CLXA 2AXQA 2YY7A 3HSKA 3RC7A 1OBFO 2X58A 5CFZA 4H16A 3QLJA 1IHYA 4MIEA 4BNZA 1NVTA 3GVXA 4M55A 2ZKLA 2Y1CA 4Y6SA 4BL5A 4IDAA 1BXGB 4MP8A 2A94A 1V0JA 1CIVA 1EVZA 2Y1DA 4UUNA 2O2SA 5IFLA 3ZDFA 1XQ1A 2AQ8A 1IL0A 4MJLA 1DC5A 5AYVA 1R0SA 3PJEA 5JXWA 3HDJA 4O6VA 5CDGA 1Y5RA 3MWDB 1GV0A 4BGEA 1H9AA 3LYLA 2FP4A 2IRWA 2VYNA 2Y68A 3DC2A 4W82A 5L3ZA 2RH8A 2PZKA 4R41A 3Q9NA 3LC7O 3I9JA 1OZAA 4E2YA 5I8WA 4LVCA 2EKQA 1K5HA 4QXMA 2CUKA 3GNQA 2FN7A 1D8AA 1U7HA 1NPYA 3CPSA 3TSCA 4WPGA 3VC7A 3U5TA 5A5EA 2IYPA 2XXJA 1YH3A 1PJTA 4I9HA 3L4SO 4KDEA 1N2SA 1HYGA 4JBHA 1DC4A 1T24A 1I10A 5JDCC 2YFQA 4LRTB 3W4KA 2G0TA 3RKRA 2EKPA 1Z74A 1PJLA 3UVEA 1YBVA 4KQXA 1ZXBA 5IAAA 1E1NA 3KEQA 2WJPA 1DPGA 4AJKA 4BV9A 2BF7A 3A28A 5TRTA 3K30A 3Q6IA 2PD3A 2JL1A 4OXKA 2QHXA 5CHEA 5HS4A 2DPGA 1X15A 2YZ7A 4ND2A 1W73A 5ENVA 4D0RA 1SZJG 1HL3A 1ZK3A 4Q3DA 3AK4A 5FWNA 5C3MA 4LSWA 2W4QA 5JNLA 4URFA 1B14A 4M8SA 4O63O 1DIAA 4MINA 3IJPA 4M54A 3GUYA 4KOAA 3MCVA 3ROPA 1BVUA 1VL0A 2YJZA 4J4HA 4D79A 4DRYA 4U5QA 3WICA 1H93A 1A9YA 2C54A 4QTZA 1NX6A 4ALMA 2WD7A 1N8KA 2NQ8A 2X23A 3C1TA 2DVMA 2Q1TA 2HCTA 1ID1A 1QKIA 2O2YA 4O0LA 3RUIA 5A9SB 1EBUA 4AJ4A 4E3ZA 1K6JA 3CUKA 1N1EA 3KOUA 4E4YA 1N5DA 3V2GA 4E2WA 2XXBA 4UREA 1ZK0A 1PS8A 1PJ4A 1YBMA 2DU8A 3DO5A 1ISIA 3CEAA 2JCYA 1T2EA 3AOEA 3WFIA 3TZHA 3W4JA 2W2LD 4U6QA 1A4IA 4BNJA 1I33A 1R16A 2O23A 3P19A 3ITKA 4ROSA 3MZ0A 2E82A 1YS4A 5KNLA 4CMIA 4TQGA 3IP1A 3DBLA 5EESA 4NFSA 4W7IA 4XCVA 5KVCA 2IE0A 5DF1A 5I9MA 1TT5B 1PEDA 2QRLA 1YDWA 2J3KA 2X5OA 2OL4A 4UEJA 3WYBA 4OQYA 1GY8A 2OORA 3E9MA 5DP2A 2EF1A 3U4IA 4D0SA 5G0TA 3WFJA 4GGOA 3ZWPA 2GCGA 3UW3A 4GMFA 4BNFA 2ZYAA 3F4LA 1LX6A 4KUEA 2Y0DA 2Y93A 4L74A 4YEDA 2H63A 4BB6A 2ZQZA 1DIGA 4PN3A 1SOWA 3W6UA 3GEDA 5EMHA 2E4AA 3A4VA 4BMNA 2HK7A 4IXWA 4UEKA 2BH9A 5K6AC 5HBRA 4YACA 2WM3A 2VHYA 1I24A 1KVRA 1PZEA 2JJYA 4MDHA 2VHZA 4LGVA 4DYDA 4E2XA 4YJFA 4R1UA 1YJQA 1RKXA 3I5MA 1YE3A 3F47A 3QWFA 4WLFA 4ALNA 4D45A 5IJZA 2CDBA 2HDHA 1RYEA 4B4VA 1CETA 2Q1SA 1WAMA 3I6IA 1Y8QA 3O4RA 4AJ2A 1X7GA 3JCZA 3GVIA 1PSDA 4TKMA 1UH5A 3I6QA 1HDOA 1P9LA 1SEVA 3ZHYA 4TRNA 2UV8A 2B36A 5DBIA 1VJTA 1XDWA 1E7MA 5A9TA 1NNUA 1Y1PA 3GQVA 1JQBA 2NTNA 2O4CA 1AE1A 1IY8A 1Y9EA 1EUDA 2I5PO 1ENPA 2BGMA 3HWRA 4CMCA 3VKVA 4CUZA 3AY6A 4ILKA 1MUUA 3WQQA 4AJ1A 1XCBA 2VZ8A 4E5YA 5KVQA 4Y6RA 4R1NA 1O5IA 2H9IA 3PYLA 1I2ZA 4WNCA 3VDRA 2WWRA 3PHGA 4JCOA 3GY0A 3ZU2A 1MFZA 2CZCA 4ALKA 3INTA 3JYNA 5THQA 2PGDA 2HO5A 5BT9A 1MB4A 2J5KA 2E48A 3RU7A 2GF2A 4RZIA 4Y98A 4AJIA 1YDEA 2DBQA 5L7YA 4RVDA 5T57A 2B5VA 3WOHA 2CSUA 1E0DA 4FOOA 2I3GA 3TWOA 1P1JA 3FCOA 4A7PA 2PNFA 1H5QA 1CF2O 1I8TA 2V6MA 4EUHA 4A27A 3PI7A 4XYLA 3INGA 4NQZA 1YBAA 1ZFNA 3QHAA 4BS9A 2PLAA 1P0FA 3PWKA 3MJTA 1LXCA 1HYEA 3GOHA 2YV2A 5FEUA 1Y7TA 4YRAA 3I4CA 5JSFA 3ZV4A 4CQMB 5LC1A 5U1PA 2C29D 5KKAA 3WLEA 1UDCA 4BUCA 3K2EA 3S2FA 4YQYA 3U4HA 4BNXA 4CQMA 4DC0A 3NRCA 2Y1OA 3SEFA 1DHRA 1LUAA 2VT2A 1E3WB 1E7QA 4GX0A 4BNTA 4WGGA 3ROKA 1X14A 3HN2A 3ONEA 1O8CA 2FWMX 1E3WA 1PL8A 1P3DA 1YJ8A 1ZUD1 5CAEA 1WP4A 2PA3A 3JQ9C 4A10A 4BNKA 3EGOA 1AUPA 4HXYA 4JP3A 3G79A 3N7UA 4MKZA 3UFXA 4XR9A 1I01A 1U3UA 2ZB4A 1H6CA 3VTZA 4EJ6A 3U09A 4C7KA 2OGUA 1HETA 4J7CA 3GNSA 3WTCA 2NU7A 2O3RA 5JDCA 4P22A 1B0AA 3EUWA 1UDAA 3KRTA 4XEHA 4ZVVA 1MA0A 2EP5A 3JV7A 2JFHA 2X4GA 3QV1A 3S55A 2B4TO 4AL4A 2VYVD 1VJ0A 2EJVA 3WMXA 2X9VA 2Q45A 4B7XA 1Z7BA 3UN1A 1UP7A 3LLSA 2PK3A 4PRLA 5T6BA 2BELA 1RJWA 3HQ4O 1NXQA 2GLXA 3GVCA 3SXPA 2I67A 4O1MA 3N58A 4J16A 1NPDA 2C07A 4WASA 4CUJA
chains in the Genus database with same CATH superfamily
2I4TA 2EKBA 2I7CA 3ESAA 3U4CA 4EL5A 1JIXA 1LDNA 3L04A 1RM4A 3BFJA 3FFXA 5G4LA 5T41A 3ORRA 3QTLA 4IF6A 4PF1A 1FLVA 4BLQA 3RYHA 2WZBA 1T9BA 2ZIUB 4B7UA 2WKQA 2RSLA 4F4JA 5EPUA 3V4PB 4K9KA 1NVDA 2X2OA 1ZR2A 2YFYA 4D4KA 4IMPA 4MUNA 5LOVB 3AIMA 4LF4B 4I5IA 2Q7DA 3JQGA 2BBOA 1JL3A 1J7JA 2GEBA 3SM9A 2CY0A 4LOIA 2GR9A 3T7EA 4BKMA 16PKA 2Y66A 2CE2X 3E9DA 2YMMA 5FBLB 5CB8A 3VPBA 4MA5A 2OYSA 1B8OA 3QENA 2B7LA 5DTEA 1E98A 2A4MA 3DEJA 3ICEA 1N7GA 2FZCA 1I4EB 1SEPA 1P3Y1 5E3IA 4KFRA 1QIHA 4H3SA 1A1SA 2J9FB 2IZ5A 4Q4JA 3GFOA 5IAKA 4F4DA 2DKOA 3RRFA 3WBJA 4PGMA 3G17A 3HJCA 2ATVA 4Y6LA 2AMFA 4BN4A 4EEZA 2VPYA 2O6LA 5LIRA 2CUTA 4FHGA 1E3JA 3U9LA 2BR4A 1GNTA 4N9QA 3VU1A 2P30A 3T3DA 4H0FA 3ZEAA 3KELA 1TM2A 1L8OA 4NV3A 4LHYA 4UHCA 3QI2A 4IIDA 5C31A 2BJVA 3VNUA 4AKGA 3G1TA 3HEBA 1EXMA 4X92A 5HDQA 4B0OA 2AHRA 3GEMA 4PZPA 2JG3A 3MOIA 4KHZA 4RDHA 3ZWAA 3HJNA 4AICA 1XPUA 3OU6A 3HU2A 3KLBA 2ES4A 1W44A 4KWEA 1VSVA 2YH2A 2R00C 1IBRA 1DCKA 1SBCA 2C1XA 3IVXA 5F5XA 2P2NA 3DL2A 3T35A 3E5MA 3UGQA 3ZLUA 4ER6A 5B55A 2PV7A 3L06A 5I7RA 1EFLA 1XR3A 1XYGA 2PS9A 1QH1B 4UM9D 4D6XA 1A9QA 3EIFA 3HCWA 2GS9A 2EAUA 2V5VA 3PKJA 5ELXA 1RI1A 1IPHA 4PBRA 4FZ5A 1D1TA 4KN8A 3LV8A 3ZNNA 2HEGA 4WFQA 3UMSA 1CDDA 1KAHA 4XARA 4YQEA 3SGLA 3AFNA 3K5HA 5HJEA 3ANLA 3DNMA 1MIHA 2PKRA 3EH1A 2ATIA 4GYJA 3KVOA 5AKZA 1NONA 4RL4A 3V1TC 4DKXA 1TL7C 1I1NA 3B3GA 4C3UA 1OROA 3G9ZA 5GGXA 3F7NA 3HP7A 1V5GA 3L01A 4L15A 1YS1X 3D2LA 4Y2YA 5D00A 1HT2E 3KZXA 1WZIA 2X1VA 2A78A 1FUEA 2PKXA 2DQZA 3OJXA 3Q11A 4JJGA 3ZHXA 1ZWKA 3IURA 1GG5A 3OCYA 4FFDA 1ULHA 1U2PA 1YOVA 3PJFA 1DOZA 1VIAA 3ZPXA 4NYJQ 1U2DA 3WSWA 4EHBA 3WXMA 1S1MA 5SZJA 3G2JA 4BVEA 3LCJA 4CKEB 3V46A 1EWYA 4QGBA 4OAQA 4CTOA 4YT5A 2VPIA 2VT6A 2A5GA 3NBAA 1UJCA 1HF3A 3PSAA 4LHZA 2BTOA 4WFKA 1CCWA 1WZCA 3KEGA 3MSCA 4RMJA 4URZR 4YX9A 1DBWA 4Z4EA 1YAJA 2XLBA 5J5AA 4RIGA 3NBYC 3RI3A 4ZICA 5H02A 1QKKA 2C57A 3PEUA 4BFTA 2B34A 4WK2B 4CLRA 4L7QA 1VL8A 1KJQA 2W2KA 3CNQS 4KQKA 4AZ3B 4MVCA 1KQ3A 3CLHA 1FTNA 1OWOA 5T67A 4HNVA 2O8FA 1UWLA 1YVPA 3O0TA 5FBRB 3HYTA 1J06A 2XV1A 1KSJA 3X1ZA 1PFYA 1VYUA 3IP6A 4FGWA 1JQJC 1I6KA 1WS6A 4LISA 5KYKA 4B40A 1EJBA 5BUQA 5HJ5A 4MQLA 4PCLA 3A26A 1UC9A 1KQPA 1QFMA 3P96A 1YJCA 2ZJ7A 2MMGA 3I23A 4ND1A 3S4YA 3ZCPA 1ZD1A 4US2R 2LPMA 3PJDA 5KDLA 2QN8A 1CY1A 4BP9A 5CDHA 4UM7A 1VB5A 1G9TA 4AY2A 1AGXA 2RDMA 1ZGZA 2R1TB 1OWPA 4QBGB 2DPMA 3QMWA 4B74A 3CO0S 5T4BA 4OU5A 4PZDA 1G3QA 4WJZA 2QJRA 2ZVQX 3CX4A 2A0FA 4IDOA 1M73E 5T8KC 4DA9A 3DJFA 4FMBB 1ADJA 1PL7A 1W88B 4ME6A 1WO8A 5A5DA 1IQ0A 1GLNA 1IBSA 2ZP1A 1QGDA 3FMFA 5ALTA 4BLOA 5BMOA 4Q4LA 3TAHA 3HVRA 3GN2A 1JG1A 2BMFA 2G5GX 3IMCA 4ZVNA 1T8YA 2P5YA 4ND4A 4REQA 2PVCA 3A7DA 3I6YA 4IMJB 1RQXA 5DLDA 4MIKA 3W1VA 3WWYA 1LKZA 5EY5B 2OSBA 1DKOA 3QU5A 3QXXA 4W6QA 4NATA 5BY2A 1A9TA 5DISB 2OBFA 3R9WA 3U7GA 3AF0A 2RHMA 1KL7A 1N3IA 4MP6A 3RWOA 1SGWA 1C4XA 3OZCA 4TTQA 4F3CA 2UZIR 4YCLA 5JC1A 1SURA 5J3JA 4BIMA 1GEEA 3Q41A 3QPAA 1FU4A 2H51A 1GR1A 5CGQB 3KB1A 3CU5A 3GOQA 3OEHD 3WSTA 1UJ6A 3HJRA 1Y8RA 1N2GA 1LQ2A 2RI6A 3C3CA 4A0FA 4EP1A 1YCDA 4DDUA 3ISTA 1SO8A 3BMOA 3OQ6A 1CQIA 2GZAA 3OLCX 3NPAA 2VJQA 1OXSC 5E2BA 3KM0A 1MC4A 1NYRA 3A4LA 2VJMA 4C4YA 2BGIA 3D8UA 4FE4A 4PS0A 3D3EA 5T5QA 1PFUA 4TLCA 1J8MF 3KQVA 5KSWB 2PUCA 1QH9A 1KMNA 1ETUA 3ZD6A 5LD2B 2WSLA 1CLEA 4DCCA 2BYTA 1X1CA 2ZM5A 3GP5A 2VQ3A 1ZOOA 5K0NA 4K7JA 3T7CA 3BSYA 4JJEA 5BVGB 3FTQA 3VR6H 2CV1A 1N2ZA 1KVTA 4NBNA 1N7JA 3A6KA 2BJHA 2J5QA 4S1WA 3L5OA 5IP5A 5TGTA 5A6SA 3UGJA 1F0NA 1LSOA 1JA0A 1DFIA 4NLLA 3WC4A 2PMWB 2VZ0A 2FR1A 2W2LA 1OAAA 4Y9RA 3W5HA 2AFRA 3M34A 1I7QB 1R6DA 1MT0A 4IVQA 2XDQA 5EKUA 3SK0A 4B43A 4FMDF 1QYCA 1JYEA 4BO5A 3IIMA 2FN8A 2PT7A 4A03A 2PG3A 5SY9A 3VOSA 2C4WA 1POWA 4CM8B 2ZITA 3TQHA 2OBMA 2WFAA 1WBBA 2AUMA 4CIWA 3FPKA 1G19A 3X2FA 3W9SA 2DH6A 2ZROA 2HA5A 2XMBA 2KE5A 2FWJA 3R09A 3FYHA 4LGCA 2B0JA 4NE2A 1L5VA 1VM6A 4RDCA 5FDFA 1I7DA 1BCRB 3BDVA 3CR8A 1FBNA 1M7HA 2GKSA 3ETHA 2GPTA 5JPDA 3Q88A 5A7HA 1TNDA 1M2HA 1QGED 1NULA 3ZXXA 3EQ8A 2YOFA 5H3LA 5TJHA 2E3JA 2DC1A 4HEHA 1H42A 2P41A 4LSZA 2AC4A 4GBMA 1G291 3KOZA 1QO9A 4G41A 2PWZA 3IEPA 3GG9A 2WMDA 3SJCA 1QHXA 1ZW1A 3FSGD 4GXTA 3HKBB 4MQUA 4OL9A 2CXQA 3T1QA 2PYZA 1UBKS 4CM4A 3MTIA 4W6ZA 4ASUD 4MICA 2EG9A 3GGGA 3SZGA 3G2NA 3AMVA 3OY7A 4BBJA 1X1TA 2YRFA 4PVCA 5AI5A 4ZIRA 3AESB 5KOHB 1QU3A 3SP1A 5A05A 3WL8A 1KZ7B 5IK2A 1E32A 4R69A 4IIGA 2FEXA 1PZXA 2CNWA 1G60A 2BL4A 3JD3A 2NUPB 1ZOIA 4D6PA 3GLQA 1KOLA 4FUQA 1TA9A 2D1TA 3ADBA 1G8HA 1DDOA 4NOLA 2W37A 2XQIA 4R4JA 2GQ0A 2J9YB 1NI5A 3NATA 4KDRA 3ASZA 2XGGA 1LPSA 3BCSA 4MPTA 3I34X 4M88A 3I8SA 3NTUA 4IGAA 2N3ZA 2WM9B 4S2UA 1Y42X 2JI6A 2D7CA 2PKQO 2WWWA 1ZVQA 1DI0A 2IA5A 2P6UA 2ZOSA 2MDTA 3U61B 3C6QA 3IAFA 1G20A 1QJ4A 4IDPA 1CZHA 1ADYA 2Q4EA 1D8TA 2JAPA 3IQDB 4TYQA 4XYGA 1KE1A 1ZKDA 2CKDA 4ZYZA 2ERXA 5U9CA 1ODKA 2MSEB 3AJ9A 3ITDA 2QSUA 4YLYA 3ORQA 1U3DA 2YOGA 4X91A 1OXVA 1DXOA 1QV7A 2R8EA 4NVRA 1JA9A 3EEFA 4XPIB 3ROFA 2FP4B 1YRQA 3TK1A 4YR7A 3ER8A 1BGXT 4YUZA 4Z99A 3SF8A 3K6JA 4NJOA 5H0IA 3TW0A 3VH2A 3ZH9B 1TVEA 4X41A 4RHCA 3RFTA 5LQAA 3BBPA 1KAMA 1ZISA 1M2EA 1PQYA 2OESA 5CNIA 3AV0B 2B94A 2QE7A 5ARCA 4BWFB 4YDQA 3NTLA 4FOTA 1N5KA 3V1KA 2XVXA 4D9GA 4O3MA 1EVLA 1GCOA 4ZT6A 1E4EA 4HQLA 4ZYYA 4BNNA 3EIUA 1J2RA 1RTKA 2QRVB 3BPSA 4ECEA 2ZJ3A 4V0RA 4NXMB 4RPJA 2WTMA 3JAWB 4QUHA 1UT6A 5F7ZA 3AHEA 1C1DA 2VEOA 2H57A 3KZCA 4XGQA 3MT8A 2OYRA 3KV3O 3WZMA 4BATA 1EQAA 1C7RA 1F8UA 2QTTA 3WV5A 1YHYA 1HMYA 5JROA 2BFAA 2CLFB 2RMKA 1JFTA 2CK3A 5LQUA 5KMGA 1WL8A 3H5WA 4JWTA 4HNHA 3I01M 3O8OA 2AK2A 4JLUA 3IO3A 4FBMA 2WAMA 4JB8A 4P5PA 4ZJPA 4QFMA 4WZBE 1ULAA 2Y76A 3B89A 2PSSA 3KOOA 3S99A 4EIWA 1I5OA 2PVSA 1VKHA 3W9UA 2B8EA 1CSEE 5K0SA 1JXQA 1O89A 2GYWA 3AR9A 3FHLA 3RBZA 4DWWA 5CDYA 3DOIA 1GGKA 2XZDA 3QRWA 4WW0A 2MSLA 1OHHD 2OTCA 4FHZA 1M1NA 5DIZA 4ARUA 4C0SA 4EJSB 3WB9A 4HDNA 3NIFB 1NMEA 3PYXA 3ZHSA 4CLHA 2XWPA 1U1IA 2CLHB 1RAGA 3QKTA 4B8WA 1K5PA 3HA2A 3WA7A 1WKBA 1PGNA 3ANNA 4TMZA 3KFXA 1UFOA 2GZRA 4P2GA 4QXAA 2WU4A 1MOSA 3GW8A 2GRJA 2PT9A 3I52A 4HQRA 3W8NA 2ZRFA 1LRJA 1RC0A 3FOBA 5HP4A 5E9AA 1AT1A 1CERA 1I9GA 1RFLA 2ZRLA 3PHBE 1LVUA 3QBTA 4N8EA 2PSDA 1ISGA 3B3JA 5DV9A 3WQRA 2G0NA 3IHWA 4DBZA 1U0GA 4A1OA 2IHJA 1ZJZA 5KDOA 3SVTA 2QVBA 4WECA 1H94A 1CT9A 4NEGA 2VRCD 4XZ3A 3PC2A 4PPFA 1IOZA 2R7NA 1P5HA 5KUTA 4JYAB 1BDMA 2IY7A 5K8CA 1PTJC 2P9BA 4PTZA 1HA3A 2I6FA 2PZGA 3HADA 3EXIB 4NS1A 2IGTA 4P6VF 1PKXA 1T4CA 5FOSA 1XMQB 2C5BA 2DUMA 1DBIA 2R96A 3MRSA 4OSPA 1IUOA 1Q20A 5IT4A 1K3UB 3I6MA 3MQ2A 4KJZA 4D9CA 5EHGA 1FS6A 2VF5X 1MAUA 1M1YE 3CEHA 3ZHBA 4IPTA 1QB8A 2P9TA 1KP9A 2QRGA 3DQZA 3EJWA 1A72A 3DE4X 4K6HA 4NBSA 4X60A 5A3JA 4HNGA 1ZRSA 2QGNA 1USGA 5CP8A 5T8KA 5ABPA 4LJ5A 4GM1A 1Y0BA 5DWVA 2DGDA 4K9LA 4NMXB 3VYTB 1VLMA 4H17A 2J9ZB 1FRZA 3JALA 5FUVA 1H0KA 1PV1A 1OH6A 3HVIA 4EX7A 5B36A 1TMKA 2WYIA 4IZHA 5B57C 1OF1A 1P44A 1T9ZA 4J0KA 4GEKA 1LI4A 3ZNPA 4IQGA 4IQ4A 2OM6A 4TS1A 4UBNA 2QIOA 5D5PA 3DBLB 5LZ5A 3ZWXA 1N7HA 4CMIB 4C03A 3PNLA 1K6IA 4KWIA 4EFDA 3IKTA 2O8VA 2JNWA 4N8SA 3M3HA 3RC9A 4QTXA 1ECJA 3K96A 2JK0A 3LUJA 2PR7A 2EKLA 5A0TA 1SZPA 3HFGA 5F1PA 3EGEA 1KWKA 1JHQA 1MB2A 2LDBA 4N47A 3DOCA 1SUPA 1I3CA 1XGKA 1Y1RA 4ES6A 4M6WB 3DD1A 2YQZA 3D59A 2PUVA 1SHTX 1TCCA 5CX1A 5L3QA 1XTVA 3EC7A 3NXKA 2Z5VA 1J0XO 3I5UA 3WXBA 5HDBB 3O91A 3CG4A 5CLGA 3IODA 2I66A 4IDGA 4FQ7A 1CNEA 3LT1A 4KAXA 4LECA 4JA2A 1AD2A 4I55B 4BPBA 1W4LA 2IPOA 4UUMA 4W1RA 5ECDA 3WGYA 1U63A 1WXXA 3KJQA 5GM1A 1YIOA 1JZSA 2VP9A 3GU3A 1Z17A 2X0DA 1V25A 5HKKA 3PQ8A 4LXUA 4S35A 1ADBA 3FLEA 5A5VA 3QWAA 3O26A 4LY9A 2PZJA 4N65A 2P9FA 2A9OA 4L5BA 3A11A 5F5NA 2W2PA 3QF7A 4II2A 3IUYA 1PHRA 3U31A 3CEPB 4PPYA 3UEOA 4NDZA 3NDBB 1RI3A 3X1XA 3OA2A 3QQPA 2HHJA 5I8ZA 1LQUA 1Q2UA 1RRCA 2IXFA 1ZSVA 1NM5C 3CKLA 1P7YA 1S0UA 1N2CE 3F4KA 1D6JA 5F7XA 3W1EA 3QBJA 3WG9A 1TKAA 1S01A 2F59A 5KS2A 5DYYA 1YIDA 2D2VA 2XD4A 4TT8A 4Q01A 1TQ2A 3EIOA 2Q50A 1RRKA 2I6XA 1O0SA 2VTEA 3B9PA 4CL3A 1PUIA 3UK2A 4EABA 4F5EA 4WT7A 2DBZA 3GG2A 5FPKA 3HK2A 2B69A 4Y2JA 3M4ZA 3MHPA 3ZZNA 1QE0A 4BJ1A 1GNVA 3X1DA 1LRLA 2OD7A 2GEVA 4JASB 5JAOA 1JDUA 5J2TF 4NAVA 3WL7A 1JIVA 1TJPB 2AEJA 4XJXA 3FN4A 1EESA 1HH4A 2BKVA 4J0DA 1BMDA 2DERA 1SHKA 4G1BA 3EASA 4OXRA 1IATA 4G67A 4GYWA 1B8UA 1NMZA 4JOSA 4B9EA 3S2SA 2O1WA 1XQWA 4BNYA 1QXSA 2X8WA 2NWQA 3UAOA 1KS9A 3W8DA 2DCMA 5TQ0B 4P35A 4Z9BA 1L7DA 1I4LD 9MHTA 4YPFA 1I4DD 4PGGA 1UKYA 3B6EA 1C0IA 3OZ7A 1L7AA 3JVEA 1ACLA 4LVNA 3HXKA 4RVUA 4GM0A 1SCUA 2YY6A 4C4OA 5G0VA 2IUYA 4CCSA 1RLJA 1Q0LA 3KP1A 5DM0A 3OU2A 1TCUA 4FUTA 4ARAA 2WIGA 5JZSA 1XAGA 2AZTA 2FPKA 2C3UA 1K8YB 3LT2A 1FIUA 5AOBA 1LSJA 1QYXA 1U9YA 3LPNA 4IKEA 3ZVNA 4QXOA 2AI2A 2Q3EA 3ZBUA 5E1MA 1PR5A 2XUFA 2Z95A 2E89A 4JOQA 4GOLD 4JOBA 3U16A 2ISQA 2WJJA 2WHXA 4B4OA 1N4DA 2RH9B 2VHTA 2NT4A 1AQUA 1X7HA 2AFVA 3AUFA 3FWKA 3ZVRA 4GM4A 5D84A 1CUAA 4LKRA 2HU2A 5GZ3A 2PE5A 1C3LA 1D9XA 3THRA 2YY5A 3IUMA 3OEYA 4KJXA 1XTQA 1XG5A 3R77A 1WUHS 3A36A 5KIAA 2D59A 4YAGA 3R44A 2QL7A 4DCSA 1U7TA 1VRVA 3F5QA 2WUWE 2AXPA 1PFWA 2NADA 1L5RA 1DC8A 1R9MA 4PHCA 3DZHA 1W94A 2O06A 4KGVA 3V3TA 1U5CA 3IAM6 4MS3B 4XFKA 3NOVA 1IXSB 3CMMA 1II8A 3VNSA 3V2HA 5AXDA 1QM5A 2MTBA 4UATA 5LM3A 3T1TA 4FD3A 4ZAGA 1UPBA 3QE4A 4FZVA 1SC9A 3ABSB 4YJHA 3RLFA 3UB4A 5IH3A 4EA8A 1U0NA 2IX9A 2ZRKA 3CUYA 1WXEA 1A8HA 4HEA6 4RF3A 2ZUBA 3ZHUA 2OCBA 1XDZA 3Q8LA 3QXCA 1RXIA 5DN6D 1CS4C 5IZCC 2O2DA 2ZJ5A 3DVAA 1OXMA 5DWQA 4M49A 1D5WA 1ZBDA 2WQ7A 3NVDA 3D1LA 3ZKWB 4DREA 4EGCB 3GD5A 3CEJA 1CUZA 4GMGA 3HO6A 2O7SA 2EHJA 1T4GA 2JFFA 4YROA 4YT4A 3EFHA 1ODJA 1HDGO 2ZJ2A 5K0ZA 3OCJA 4OVKA 4U8HA 3COPA 3NC4A 3AHCA 4TT3D 5A3QA 4HLNA 1EGAA 1S89A 1N5RA 3AQIA 9ABPA 4DYHA 2FR0A 4UFNA 1T2DA 1MVNA 3VR6D 4RQBA 2ICAA 1MU0A 2DCUA 4BLTA 1KEKA 4MLPA 2AQIA 1TFRA 2O4UX 3ISVA 3WGZA 2A2ZA 3CO5A 3OX4A 3LY9A 4G01B 4P08A 4X44A 1ZD9A 2L82A 2POCA 4L0CA 2WHQA 1UK6A 3H2JA 4M8KA 4X8HA 3Q3VA 4JBNA 5D3KA 1OMOA 3OZFA 3GO4A 4PSCA 1SCNE 1NDUA 4G36A 1MD9A 2R8RA 3LDUA 3VNQA 1LS1A 4C01A 5BPFA 3BVPA 2WU8A 5JAUA 1XQYA 3HZRA 1GDHA 1XU9A 2F9FA 2A5DA 3GZ4A 4HDSA 3FCAA 3H18A 1PU2A 2AJLI 5EFZA 1TGYA 5HWSA 5ITZB 2IS6A 4NESA 2I34A 2D4AA 1IWPB 2DYKA 2H18A 2YZKA 4IDHA 3OY2A 3SC4A 3ZHTA 3N0RA 4DIEA 1Z9BA 3UTCA 3Q7SA 1L3BA 1U8XX 4ERXA 1I94B 4XRRA 3H6HA 1M54A 1OXXK 1P31A 2RGNA 5DBFA 1Z7GA 2OT3B 2QTGA 5DX0A 1RM3A 2A9FA 3GLHE 3WVNA 1XDDA 1U4OA 2WAOA 1OCEA 3OM8A 3ZHRA 5A2QA 1B73A 1MORA 1QRTA 5CNJA 2HJHA 1NQWA 2A5LA 4K9PA 1XZIA 1KK3A 3TCKA 1FDTA 1N78A 2FUKA 3DNPA 2VF7A 1O6BA 3KT6A 3QE2A 2QZ9A 4EG5A 1PTJA 4CETA 5I7VA 3D7KA 5AW5A 2QEQA 4TYWA 1M1UA 1A69A 5DHQA 5JCXA 3DTTA 3EVNA 3L0CA 3VR5D 2L42A 3C15C 1E1YA 1T1IA 3GEPA 2YICA 1DKQA 3GC6A 4YP9A 2UUAB 4MV0A 3CH6A 3MT0A 1VI2A 4KDCA 3OFKA 4INAA 2WZDA 3OURA 4C30A 2QAGC 3RVMA 4AZ0A 5DMHA 2R8ZA 4LDRA 3FZYA 3RFCA 2L2QA 1YB7A 5F3RA 3ITNA 2CWDA 1XKQA 2D74A 4B3RB 5I7WA 1NVGA 1ZZGA 4BMSA 4V2IA 2BDUA 2ZIXB 1RACA 2PBLA 4ZT2A 5HZKA 5TEVA 2GRUA 5LXTA 2G6TA 3HWSA 3G5TA 1HRDA 4P36A 3IMKA 1GILA 1X7ZB 4M1TA 3EMDA 1VCIA 3E1SA 3TTYA 4WGFA 4ALLA 5BSFA 1ODFA 1ZUNA 5CA0B 4FDVA 1YK1A 1ZUHA 3H5VA 2HZ7A 4LDPA 1LBIA 1S2NA 3PTLA 2NV0A 3Q2IA 3E2PA 3ENWA 3NAQA 4MUKA 4FLMA 2J7KA 4Q3NA 3SEQA 1OGJA 4DMFA 3DHNA 4MYUA 1S4QA 4FSHA 5KZMB 2DX7A 3CJQA 3EPHA 3EA0A 4LQCA 1U98A 1QR6A 2C5LA 1RWOA 4QATA 2JHAA 1IY9A 1GUDA 1L8LA 3IKJA 4YQZA 3ILHA 4CE6A 5HK8A 5LR6A 4CKBB 2I55A 3I73A 2O2CA 1RVDA 1PGOA 2XF8A 4GLBA 4O4IA 1E5VA 4WKCA 5AI9A 5T64A 2TMKA 1MV5A 3I83A 3G88A 3RPEA 2WNHA 4HZUA 5IN5A 2DPYA 2YNMD 1YONA 3BREA 5E6UA 3U1VA 4EYEA 2JLUA 2EBFX 1EK0A 5A04A 2ZRHA 2VI5A 3BAZA 3ESBA 3LBIA 5FJIA 5C52B 3H9GA 5DGCA 5BSHA 3D4OA 1RIFA 3F1KA 1ENOA 3CF6R 3OQOA 1SC1A 1O54A 3IJEB 4PHFA 1SXJC 4W8OA 3TLXA 3D64A 5AVOA 2JDID 2ZQYA 4CF4A 3T94A 5LSAA 3R5XA 5FP0A 4G85A 4U2FA 4Y2RA 3P9PA 2Q0HA 1RRVA 2EERA 4L0QA 3E9ZA 4B7ZA 1STOA 1YQUA 2OV8A 3OM0A 5ITVA 2ZBEA 1P4AA 3IV6A 2Z6AA 4E3ZA 2X9LA 4EEKA 2FNAA 1UC8A 4DV0B 3CLUC 4RSRA 4KYIB 4N3NA 3ZGOA 3H2BA 4DZRA 3KLMX 3ACCA 3LC1O 3RSGA 4GLJA 1OFVA 2AG0A 1EGMB 2GLTA 3BERA 1M9NA 1GXSB 1PWYE 2ZSBA 4S24A 5HCUA 5BXYA 5C1DA 2ZYVX 3KOXA 5HRUA 4HHEA 2ZR0A 4UHJA 5FV4A 2CXNA 3H3FA 2F43B 4FFRA 2ETXA 1D5CA 3PUZA 4NH4A 1DB3A 3ZU4A 1UMDB 1WPGA 2Q27A 1NU6A 3CZCA 1OPRA 1YGPA 2X4LA 2P5UA 3MMXA 2VXBA 4DIKA 1NF8A 1RYNA 2IPMA 2XMSA 1O95D 2Y0BA 1ZINA 3IX7A 3IV9A 3O90A 3QVJA 1P9RA 4FVTA 4C4PA 1NBOA 3RQSA 2GYYA 1TRHA 1HR0B 1ND6A 5IT9A 2W2TA 2PSJA 1E1KA 3M6FA 3Q4GA 5H16A 5AW8A 2QG6A 4GOMD 1SCKA 2NO6A 2Q2WA 5CFOA 1T3LA 1EGVB 4GPZA 5H82A 4AS3A 4Q9AA 4PONA 4MMYB 2HPAA 1AMUA 1ACJA 1JYSA 1VE3A 3DE7X 3E8XA 2QDKA 4PFSA 3K1YA 4KO8A 3ROGA 3T7JA 3M6IA 4B17A 1TOAA 3H11A 3TRIA 2GTIA 5BSEA 4DA4A 4OHCA 4UUPA 4O4HB 4D8WA 1TJ4A 1NKVA 4TQAA 1KMHA 3KXLA 3AZOA 1J8VA 1PEKE 4J0HA 4RFSB 4HH0A 4Y6GB 4EARA 1YFJA 1ZJYA 2PYIA 3AVQA 2ZPTX 3DE2X 1ZQ9A 4ZEOA 1MX3A 5AMXA 5JBQA 2SECE 4GOXA 1NHGA 1GZSA 2H5IA 5CCXA 1DOAA 3VTFA 3BRWD 4F60A 2Q6LA 4Y9TA 5EERA 3QVGA 5ERGB 1JFLA 1XNRB 4I5GA 3GGCA 3P5BA 4JB3A 4H7HA 4JVLA 3W2HA 3NI2A 4HDRB 2HQOA 4BVHA 5LXTF 2YS7A 1BE8A 1DJOA 1BX3A 2WFZA 4YMIA 5F5LA 2JW5A 3ZCTA 3L7NA 2PMEA 3F3SA 4Y18A 3BILA 3UKJA 2FFBA 4M36A 3DOUA 3P94A 3RYTC 4J0QA 2O2JA 1KVSA 3OCCA 4ABTA 1PDVA 1J6UA 4I4TF 4HEJA 1MABB 2DOKA 2L18A 3BGDA 1PRYA 2IP1A 3JRWA 4OKIA 1ENZA 2OZPA 2G36A 1KI4A 2CMDA 1TO1E 2BR5A 3L1KA 3IOCA 2I4IA 4J3JA 1N5OX 4J1TC 2XZOA 1SCDA 3LRTA 4GBJA 1UK9A 3C8DA 4GT1A 1WSAA 1QAOA 5C4GB 3MIZA 4NCXA 2GASA 3NS7A 2Y1GA 3DR5A 4JUCA 1G8FA 2OXCA 1Y6GA 4LQLA 4O4IF 4TLAA 4AZSA 3L7LA 4YUWA 4WNAA 3CSSA 3T61A 4Q00A 1QYRA 1NXWA 4O4JA 4J0EA 4LF7B 1UZUA 1WW8A 2FWRA 4ZQIA 1FFYA 2Q9CA 3EPLA 5B4TA 2OKCA 2WBLC 4ZZ2A 2AOVA 3WMFA 2QTHA 4KFSA 5CEEA 2NZUG 4B1FA 3VPXA 3T1NA 1PNQA 4JUAA 3EARA 2EWWA 2DLNA 4UBMA 3W2FA 1AU9A 4ZQCB 3WRVA 4M0LA 3GLFA 3BEOA 1TLLA 1J9GA 5SICE 4ZTBA 4ESEA 2HHLA 3AG5A 2YDXA 1WSDA 4HFNA 2OGSA 2D1RA 3WIEA 1A27A 3MT9A 4KXMA 3I1IA 1NKSA 1WD7A 4PSUA 4PWZA 5NULA 2ATEA 2WAXA 2ZB7A 4ZD6A 2IOFA 3K94A 3BZUA 1ENYA 1CE8B 2I2AA 3V48A 4YNBA 3IDAA 1HNNA 4WERA 5HE9A 2A9PA 2JRLA 1X7WB 2AR0A 4Q9DA 3NVAA 1G20E 4I4NA 2PR2A 1M5RA 3U7QA 3M1LA 1DIOB 2G1AA 3OIGA 1I32A 1UBSB 4RTLA 3KU1A 2FPIB 621PA 5EIBD 4H1HA 4IOJA 1XHFA 1JDSA 1G38A 4LHXA 4C7BA 4AKSA 3WYAA 4FNAA 4GRDA 3KVNA 4UMFA 3AOGA 3BHIA 1JSCA 5TS2A 5IN4A 2H2AA 3PDWA 4YCCA 3AM1A 3VVMA 2BI8A 2P1ZA 4HZGA 4MUMA 4ACBA 1TYAE 1VIMA 2IKSA 3AR4A 2IEBA 3F5FA 1E3TA 4QPJC 5CNKA 4JI4B 1U8EA 2QPLA 3ORSA 3M83A 4XGKA 4YP1A 5KJFA 2YINC 4H6VA 1NBAA 4TMFA 1A76A 2QTWB 4KQMA 3GJ4A 4MWGA 4XVRA 3RO7A 3WAGA 3S1AB 3I62A 2XW6A 3OO1A 2J0SA 2ZRDA 2ODAA 4K9NA 4OFBA 3PZBA 5E2IA 1C2TA 3SHOA 3VDXA 4JVMA 2Q5OA 4RX1A 4CFYA 3P2EA 4DLVA 2P2SA 1Y7IA 3DFUA 4UFOA 3RJMA 4UBLA 3U37A 4B09A 2D00A 3I39X 3K0AA 4KMRA 3PFKA 3PX2A 4QEKA 1KSFX 2FZEA 3PHCA 3USZA 1NFQA 1FFXB 2JLZA 2BSAA 3DE6X 1EX6A 1Q16A 3RUDA 2YV5A 1LEHA 3UJ8A 4E0BA 2NV2B 4EYOA 4O2BB 5IKEA 1FSFA 1FCJA 4L4SA 3WRWA 1YD7A 3RVSA 4MI3A 3JQ7A 4YRDA 1Y6JA 3P9QA 4EQ6A 5JHGB 1I5RA 2IHYA 5K0LA 5LDGA 5I7OA 1IE3A 1VP3A 2GSWA 2XWJI 3HS3A 2Y99A 4N49A 4QDZA 5HCNA 3T8YA 5LYJB 1JB9A 2WAAA 2H1LA 2EGHA 4MR8B 3E9YA 4L8VA 5LZ7A 4UDNA 4FT4A 1LPOA 5ALYA 4RETA 5C34B 1A5ZA 5JPCA 1G5QA 3KYDB 3SZUA 2VDWB 1SQGA 3CFYA 4LRXA 4L78A 1SKMA 1QK3A 1X42A 3WOVA 1YCGA 2C9YA 4XJSA 4DCMA 5K20A 3W2IA 1UP6A 3ZU3A 4E5NA 2C2XA 4N5LA 2DKFA 1DMSA 2J09A 4ZV7A 3LJKA 1TC2A 1M6VA 3HUFA 1PR2A 4IP0A 4JI1B 1JHZA 1VE9A 4CQNA 2BUBA 3GAAA 1R3UA 2OCLA 2VUUA 2IDZA 1EK5A 2E1PA 3PA6A 4WKBA 2CUZA 4ZYWA 4XYBA 1ZXLA 1ZRMA 1EAMA 1OA1A 2QTNA 5COBA 2XUDA 4O25A 4W4TA 1X7YA 1UFQA 1M0EA 1DIHA 4M99A 3QEMB 4D0NA 2IUEA 4HJXA 1VHLA 4O4JF 3HFRA 3KT0A 5K4HA 2JIBA 3CINA 2JGDB 3N8HA 5FJJA 2C96A 2NMVA 3GJ5A 1MQSA 5EP2A 4ZQGA 3ONFA 2GBFA 2R87A 2Y2UA 1FDVA 2QX4A 3C8HA 4EW2A 3T99A 3KE8A 3AEQB 3HGMA 1T91A 1JDBC 2VTBA 3LUGA 3LCMA 4RCYA 4HQ6A 2PZMA 4AMZA 2PH5A 1NAHA 3B7PA 4E22A 1TQHA 2NSLA 4X1YB 5TT1A 4OIFA 3LVRE 2QVZX 5JSZA 2XE8A 3B1WA 5JYBA 1E3IA 3LX4A 4FILA 4KI7A 3RFFA 4CDRA 4PC3A 5BUCA 3VR1A 5KX5A 4IJVA 3V55A 2UVPB 1CV2A 1ZCFA 2PRYA 5L7TA 3NIBA 3H7IA 3P0HA 1QG4A 1H4VB 1FUIA 2ZWVA 4B87A 4JH0A 4B75A 1QTRA 4QVGA 5BVHB 1SUCA 3EWSA 1CUCA 4LJAA 4J6EA 4Q4CA 1OFUA 2V0NA 2ZEJA 2PX5A 3PQ7A 2YHIB 1S2OA 1FFSA 4RE5A 2NXCA 5FBHA 3E35A 2R7AA 2JGMA 4RSGA 4U0KA 2VNJA 3N0WA 1MJGM 1NQ5A 5EZYB 3DDUA 5C5IA 1TYCA 4DLPA 2OKGA 4HRYA 4QBKA 3LPDA 4ZQEA 5M29A 3U60B 7GPBA 1V6SA 2IZ1A 4IOKA 4ZWNA 1V43A 3W6PA 2HK8A 3FWZA 1T13A 3FNBA 4O2AA 2ZRMA 1DUIA 3VBEA 4TUYB 4YRLA 2ZR9A 1PE0A 2YUTA 3WIUA 1N3LA 4F9EA 1EJ2A 2Q46A 1L9KA 5FR1A 3X1MA 2JF0A 2VAXA 3NDJA 3KYJB 1EUQA 4QYWA 3DEKA 2FUG6 1ISFA 2II6A 2VQ6A 3K0KA 1D1SA 2BE9A 2HQSA 3OZUA 3QI7A 4TLEA 3RNLA 5LLDA 3HBAA 4XVCA 4QZVA 5FADA 1OIWA 2A35A 3K7EA 3T4UA 4KRYA 1T5TA 5DHFA 1EP9A 3CSUA 3JPWA 3BMNB 3N74A 2AIRA 1GN9A 2TS1A 1NI3A 3NWPA 4A5SA 5CDUA 3KJEA 5JC8A 5JH7F 2C3MA 5EXSA 3T5BA 1ZEMA 4TVSA 3E2IA 1N2OA 3GFRA 2EBUA 3K5IA 3R6GA 2IY9A 4QECA 4XIIA 5D7NA 4BXOB 4RXTA 4WE3A 5KQGA 3F49S 1HE2A 2F1IA 2WZQA 2KMLA 4N9WA 3M5WA 5DZSA 1YR2A 1J00A 2BI7A 2XMRA 2GBGA 2OGTA 1HLGA 3O93A 3OFNA 4CTNA 1ZH6A 3ZGYA 1XTTA 3AP2A 5E7IA 3S70A 4JD5A 4C5AA 1SBNE 2NVBA 1ZMBA 3AY3A 3GCZA 3FOEC 4I3GA 3OJEA 4WD3A 4CKXA 4WRRA 3Q85A 5PGMA 1I4OA 2J3DA 3BTUA 4TXNA 4EX6A 1FNDA 1TM5E 4HLQB 5DI3B 3NKFA 5GV8A 5T3UA 4NMWA 1PQWA 3LOUA 4MRRA 3B5JA 5ECGC 4EPXA 1SVLA 4YAFA 1TAGA 3G8YA 2ODEA 3IBYA 5K3FB 3V4FA 1GNSA 4G8BA 2AG5A 1VZ3A 2WSIA 3BKWA 3NYRA 4OFWA 4NX2A 1NG9A 5B37A 3PGA1 3H3XA 1ZUWA 3WGHA 3RAGA 4XQCA 2IUFA 4EYSA 2GBLC 1KYTA 4J1TA 4MKRA 2VJBA 1FDIA 4CODB 1R5OA 4CMEA 2PQ6A 1T6BY 4TV8A 5CJPA 4LXQA 4R9UC 1X2EA 5AM0A 3PVCA 4D0GA 1VL6A 1G16A 2V9PA 4OK6A 2OY0A 4I6JA 3HDVA 1V6AA 4R1PA 4W1QA 3RG8A 3S68A 5C8YF 4Y0AA 5IDYA 4WMLA 3EWIA 1MGOA 1JB1A 1NG1A 2BFWA 2GB4A 4D44A 2CMGA 4EAAA 5J58A 1SQ5A 1X77A 4QUDA 1RMTA 3BTOA 3EOZA 4ZEVA 2JFQA 5JWOA 1XAHA 1NVWQ 2BGRA 1YB4A 4V3CA 3S2UA 4UM9B 4B2YA 2OV2A 2OB1A 2WU3A 2ZIEA 1OGIA 5AKIA 2DQ4A 4R0NA 4ENUA 5NLLA 1UEXC 2AOTA 1Q14A 2J4FA 3GVPA 4M21A 4OG2A 2D4HA 4ZALA 5BW5A 4X1KB 5IMSA 4FN5A 3HY4A 4ZDIA 2XCTB 3RBVA 1IPFA 2N1MA 1AMNA 4FINA 2CXOA 2DFDA 2FMFA 2QJOA 4E94A 3ZHZA 3I9KA 3NRJA 1B6SA 4M0MA 3QZUA 3B1FA 3LDHA 4O1HA 1Z22A 3KHTA 3UJDA 1QF9A 1MAWA 4Z5XA 6REQB 4ZU3A 3KQMA 4KTVE 4LFCB 1SXGA 1TYDE 4GMDA 5EJ2A 1GTG1 2WJ3A 4FIZA 3WYCA 4ZI7B 2GVZC 4RZXA 1WPQA 2ODTX 3AIOA 3C3DA 1NUPA 2DWPA 1KZ1A 2QBYB 1P7PA 4TTIA 4WLVA 1YCFA 4C88A 3O74A 3ZVLA 2IYZA 3FRIA 3OQJA 1O9BA 4GSKA 3AYZB 1FSPA 5FUXA 2AJBA 4GAEA 3O3CA 4GF5A 1GQQA 1JPUA 3GEIA 4WADA 1G42A 3SNHA 4MW7A 4O2AF 4HX5A 4INPA 3K9FC 5CG2A 2E4ZA 2WTAA 1BA3A 3CKKA 1DLJA 4CEIA 2HDNB 2N9UA 5LBTA 2H0AA 1TMGE 3HBNA 2Q6IA 3ITEA 1Z4QA 5H1YA 4F1KA 1J21A 2HPVA 3KUUA 2Z83A 1ZP6A 4YONB 5GPBA 3KT3A 4X20B 4KXNA 1LSUA 5AJUA 3Q8WA 1SPBS 2QU7A 2VYND 3RNOA 5MFPA 1GG2A 1OKKD 3FFAA 2P77A 4F1WA 4BQPA 2CEKA 1JWBB 2ANCA 4NCHA 4R1SA 1RPAA 2ZYWX 3BJIC 4OQZA 2J3HA 3I9V6 3QFSA 1YMUA 5EJMA 1R0LA 2O2IA 3P9YA 1RBYA 4L0DA 5FQOA 4NCBA 2V7PA 4BO8A 1GUBA 1DBQA 2ZB8A 1C0KA 4JUBA 4ZVUA 1RLIA 1ULSA 2WTBA 4Q6WA 3T54A 2I80A 1N1MA 4QFCA 1B0PA 4F72A 4OLBA 2GT1A 1T1SA 3ZWVA 2HMVA 3NNSA 4PGFA 3EJ6A 4IWYA 4EKNB 2O7VA 2WTNA 2Z2ZA 3WTBA 2VLIA 1T35A 1H3FA 1XZCA 2XOEA 1QC5A 1ZD2P 2H16A 5KSZA 1PV4A 4XQEA 2ALJA 2K7ZA 3HA3A 4IL5A 4XX0B 1VJGA 1AKUA 2G82A 4U6SA 5DGXA