4ND5A

Crystal structure of the lactate dehydrogenase from cryptosporidium parvum
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
314
structure length
302
Chain Sequence
MIERRKIAVIGSGQIGGNIAYIVGKDNLADVVLFDIAEGIPQGKALDITHSMVMFGSTSKVIGTNDYADISGSDVVIITALLFGNARILDSVAEGVKKYCPNAFVICITNPLDVMVSHFQKVSGLPHNKVCGMAGVLDSSRFRTFIAQHFGVNASDVSANVIGGHGDGMVPATSSVSVGGVPLSSFIKQGLITQEQIDEIVCHTRIAWKEVADNLKTGTAYFAPAAAAVKMAEAYLKDKKAVVPCSAFCSNHYGVKGIYMGVPTIIGKNGVEDILELDLTPLEQKLLGESINEVNTISKVLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural characterization of Cryptosporidium parvum Lactate dehydrogenase.
pubmed doi rcsb
molecule keywords Lactate dehydrogenase, adjacent gene encodes predicted malat
molecule tags Oxidoreductase
source organism Cryptosporidium parvum
total genus 105
structure length 302
sequence length 314
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2013-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4nd5A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4nd5A02
1LDYA 1PWZA 2NQ8A 4LSMA 2AHRA 3DR3A 4UVHA 5C3MA 1YXMA 4PLYA 3IIEA 4XIYA 1YOVB 3ZU2A 5IAAA 3T4XA 4I5EA 4UUMA 1ZKMA 1LLDA 4EW6A 3CIFA 4N5MA 1M6WA 1T1RA 2JCXA 4P4LA 3WIDA 1LLUA 1X0XA 2I5PO 3K92A 3KOUA 4CL3A 3ZWBA 4UEOA 4GGOA 3TFOA 1X7DA 2X9VA 1WW8A 2GRAA 3BXXA 3H5AA 2FRDA 4Z0TA 4LVCA 4YT8A 5BR7A 2J5RA 2VWPA 2IZ0A 5A9TA 1YB1A 4PZEA 1E1KA 2C7VA 1CIVA 1ENZA 2EJVA 3S2EA 3EVNA 2AEFA 2NTJA 3N7UA 4BV9A 1NX6A 3ZV6A 3KSZO 4TRRA 4JBIA 4YJFB 3RBVA 2OBYA 4FPXA 3RIHA 4XRRA 4CMGA 1A4UA 4YJGB 3QVOA 3IS3A 3UAGA 5A06A 2Q1TA 2Y99A 5DCYA 4DPLA 4EGFA 2BHLA 5EERA 3JYQA 4YJFA 4AJ2A 1X1TA 4QX6A 4PG4A 4BKQA 1PGPA 4FD3A 5I9LA 2YQ4A 1U2GA 4E2XA 3NKLA 5JNLA 2QRKA 3QVTA 1DEHA 2VWQA 3P19A 2P9EA 4RVGA 1U8FO 3G49A 3JQ9A 3K5PA 4CM6A 4FSHA 1B0AA 3DMYA 1PZEA 1WNTA 3SBOA 2CD9A 3I9NA 1ZO8A 3KEQA 2GSDA 5G0WA 2GUGA 4LRSB 5T67A 3UGKA 2EEZA 5C5IA 4E21A 4NBWA 2D4AA 5ILGA 5EMHA 1ZK1A 2X23A 3E5MA 1ZBQA 3GT0A 1MX3A 3F9IA 3WGTA 4ZICA 4ND5A 4AJHA 4WJZA 4CMEC 1IB6A 3RASA 3SC6A 4GWGA 1V0JA 1QSGA 4XGKA 5EPOA 4TSKA 5JMPA 2PKQP 4ZQFA 3ULKA 5LC1A 4B7UA 3UW3A 1R37A 1EBFA 4RPGA 4RQUA 4UUOA 1Z7BA 3L6OO 3FBGA 2ZYGA 2P4QA 3BYZA 4CMIB 1QV6A 3GVIA 2ZQYA 2O48X 2ZCVA 4IIUA 3WYCA 1NBOA 4J6FA 4BNXA 1W73A 2A35A 2NNLD 4MDHA 4DRYA 4OXKA 3DB2A 3ZWCA 3FCOA 1FDWA 4CPDA 3RROA 3RUEA 5EL0A 2QZZA 3UFXA 5K9ZA 1VKNA 4Z9YA 4A73A 4MIOA 4IXTA 4BNMA 4I5GA 4BS9A 5IDYA 2E49A 3ST7A 2Q46A 3HDHA 5IJZA 1GUZA 1E3SA 2O50A 4MVJA 4NJOA 3UCFA 4PVCA 2ZTVA 3WLEA 3VZRA 2VT2A 3HADA 2P91A 2DAPA 3AJRA 1VRWA 4NDNE 3QWIA 1E7SA 3PFWO 1C0IA 3WGHA 3W8DA 1YDEA 2X8LA 1O0SA 3KB6A 3OJEA 4GSLA 4D7AA 2X5KO 3TJRA 4PZCA 3KHUA 5K0ZA 3JYOA 3CH6A 4RORA 1B15A 2Q2VA 1D1SA 3TOZA 2PTGA 1ARZA 3GGGA 3AI2A 1P0CA 3I9OA 1DJQA 1JKFA 4XDZA 4B3JA 1HDXA 2PD6A 3OSUA 4CJXA 1F14A 5A9RA 3EZYA 3JQFA 4GI2A 3L6EA 1OAAA 1F12A 1M66A 2AE1A 1Y8RB 3MJSA 4W4TA 3U9LA 4R41A 4PFJA 3ZV3A 1SPXA 2EP5A 3DAFA 1J4AA 1DAOA 3LT1A 4YAEA 4CMEA 3PRJA 1BGVA 3FTPA 4YR9A 3IKVA 3AM3A 1CQJA 1BXZA 1XQ6A 4NR0A 2GDZA 1Y8RA 5CG1A 4EITA 5KKCA 1HRDA 4IS3A 2HSDA 2YHIA 2HMUA 3SVTA 1EQUA 3GMDA 3E9MA 3C7AA 5CEEA 3F4LA 1HDYA 1ENPA 1V6AA 3UN1A 3L4BC 4BO3A 1DIRA 2ZATA 4BO5A 5I8ZA 3IUPA 4IDGA 5AXBA 2NU6A 2UVDA 5CAEA 2I3GA 3ETGA 3IAHA 4KQWA 3UOGA 5HRUA 5DDIP 4CMJA 4TKLA 3DZGA 2ZTLA 3DWFA 1FMCA 1IPEA 1GL3A 1H6CA 4F6LA 5CDGA 1ADFA 1K5HA 4BNTA 2ZJ0A 1B8PA 1PGQA 2C20A 3QJ5A 1CETA 1SC6A 4PCVA 3NTRA 1NHGA 1ISHA 1HLPA 3EUWA 4E13A 3JYPA 3M1AA 2CZCA 4GX5A 4FJ2A 4ZVVA 3RJ5A 4II3A 3ZNNA 1JVSA 1XWFA 1ZK4A 3BTOA 3LF2A 5F5LA 4CUKA 3IKTA 3I23A 1NVGA 4RF3A 1B26A 3LF1A 3PWSA 3MTGA 8LDHA 3QA9A 4YJDA 1YL6A 3LC7O 3PEFA 4CM9D 2CMDA 2V6MA 1HDGO 1I0ZA 4R69A 2FSVA 1V35A 3HDJA 5L3ZA 2V65A 1HYHA 3BMOA 2YDYA 1XEAA 1YS4A 4OXNA 3RUFA 3QIVA 2DU8A 4PG7A 4BKPA 4QFCA 4DL9A 3DBRB 1HE3A 3LSYA 2VYNA 2HMTA 1PWXA 4I1IA 5FEUA 4GQAA 3I1JA 3HN7A 2FMUA 4X54A 3I52A 3E6AA 5HA5A 5HTOA 1EEHA 2O7SA 1JDJA 3O26A 2C29D 2C54A 5H83A 3H2ZA 3FNEA 5EINA 2ZKLA 3WWYA 2B4QA 4W6ZA 3T4EA 5J23A 1LQTA 3TF5A 4CMHA 2EKPA 3D3EA 1Y5MA 1BW9B 3L4BA 3OECA 5A02A 3CZRA 2GF2A 1FDUA 1N9GB 2HRBA 4LK3A 5MGBA 1LXCA 1Z75A 4I9UA 4BNUA 5CEFA 1LDEA 3JQAB 1LDMA 1SB9A 1ZZEA 1EK5A 5A3VA 2ILTA 1BW9A 3IP3A 3S1LA 4Q3CA 1F8FA 4WLVA 4CM3A 4TWRA 2JFGA 1D4FA 4DYVA 1N9GA 2XOXA 3HFGA 4Y67A 2QZ9A 4DA9A 1DXYA 2JD1A 2VCYA 2AG8A 4TQGA 3KXDA 1I32A 1FJHA 1YBMA 4OIMA 3MJ4A 1GQYA 5GZ3A 5JCXA 2P9CA 4GL4A 4I5FA 1WDMA 2ET6A 2ZQZA 3BTUA 4IXWA 1T2EA 1QYDA 4URFA 1YJ8A 1FXSA 4EJ6A 3RKRA 4FFLA 4YAJA 3PK0A 2RBEA 1MV8A 4HUJA 3KZVA 3PJFA 3ETEA 2X5JO 5AXDA 1PU2A 3O9ZA 5LCXA 4JLWA 4A0SA 3K9QO 4J4HA 1B16A 1R4NB 4OQYA 3CE6A 2O3JA 1ONPA 1NQ5A 2PZLA 1FDVA 4RCVA 2HQ1A 1Z7EA 1M2WA 1NXQA 5JS6A 1WXDA 3AM5A 3RD5A 4QO7A 2B0JA 3JD0A 3L0DA 4HWKA 4ALLA 3KSUA 1MA0A 1U3UA 4N5NA 3K31A 3NUGA 2OHXA 1I5RA 2PGJA 3B1KA 1PS9A 5JAQA 3BMNA 2V6FA 1ZJZA 5L4LA 3GPIA 1YQDA 4DGSA 1UP7A 3WQSB 3WICA 1PR9A 4NQZA 4WLUA 3RSHA 4A27A 4BHTA 3ON5A 5TX7A 1OC2A 4RVHA 3ENNA 1M6HA 2VRCD 5TJHA 3TL3A 2O2YA 4OSOA 1DFHA 5BSFA 1KVSA 2YYYA 3COSA 3GVCA 3BMCB 3DZBA 4MVJM 3F1KA 2B5VA 2VNAA 3K96A 1ZVMA 2YJZA 3GG2A 1YL5A 4AJLA 3RUAA 4NU5A 3LLVA 4EUFA 1R16A 4GLOA 3QWAA 2HK9A 4GVXA 4R51A 3D1LA 2OL4A 4Z9FA 4PLTA 2C5EA 1DC3A 1C1DB 1ZNQO 3V5NA 2AEJA 4OQZA 4Z0HO 2B37A 3O03A 2BI7A 1CDOA 3D4PA 5CHEA 4K26A 1ZW1A 1J5PA 1PQUA 1ZJYA 1PS8A 4E2YA 3BZUA 4R4JA 1AXEA 4N5LA 4ND4A 3EHEA 1W4ZA 2V6GA 4Y6SA 3PVZA 1XKQA 1XSEA 3W6ZA 1K3TA 1PX0A 4D0SA 1JVBA 2A92A 2NU7A 3DEYX 3NTQA 4S3MA 1WDLA 1Q0HA 5B4UA 1QG6A 1OZAA 2FOIA 5AYVA 4YXFA 1OOEA 3GRKA 4IMRA 3ZDFA 1NQAO 4FBGA 3FPLA 4Q9NA 1PJ3A 4YTEA 3ONDA 4GKBA 4AJEA 2JD0A 2B5WA 1WWKA 1R66A 5F1KA 3ZWWA 3MTJA 4TROA 4CV2A 4IQ0A 4FJ1A 2OOSA 5G0VA 4D44A 4WLEA 1HE4A 3FWNA 2HO5A 3ZHBA 1U7TA 4YT2A 4XWYA 4GAEA 3JQ8A 2QQ5A 2NSDA 5A9SB 3GEGA 3UCXA 2HMVA 4E5KA 4GX1A 1RPNA 3KYDA 1VL8A 4IY1A 1EBUA 2C5AA 3E5RA 2D8AA 1GR0A 1V8BA 3WFIA 5JY6A 1H6AA 4A5OA 4DLAA 3OA2A 1UZNA 2B69A 1ISJA 2Q50A 1HWYA 1I8TA 2BGMA 4IGEA 3HHPA 1GDHA 3R6DA 3WGYA 1QV7A 1E3IA 4LMRA 1VM6A 1RM0A 1YL7A 3H7AA 3NV9A 3GY0A 4FJ0A 2X0RA 4W82A 3H6KA 3WDSA 5L40A 4J9VA 4YWJA 1AN9A 1NVMB 4CV3A 3BMQB 2WE7A 3JD4A 3DOCA 3GDOA 4DUPA 1JN0A 2DT5A 5U4QA 1T2FA 3ZWVA 1LLCA 3RUDA 4BNYA 2GZ2A 5FF9A 2EP7A 1P9LA 3GVPA 1PR3A 4S1VA 3L9XA 2O3SA 4YA6A 4CLDA 2DBRA 3EW7A 2XPCA 2BFAA 4BMNA 4EI2A 5TF4A 1DLIA 3K73O 2Y1DA 1R15A 4U0JA 1E3WA 4CMCA 1W8DA 4E5NA 4GMFA 4PLPA 3GOHA 1LDGA 4INAA 1XA0A 3PZBA 3WQQA 5JBIA 5DOVA 1LRJA 2DBQA 4U0KA 5ITWA 4BNLA 3PYXA 4Y6RA 4MIEA 3VZQA 4R1NA 5L7TA 2Q1SA 4UREA 5KIAA 1BSVA 3VAZA 4AL4A 3NDJA 2H9IA 1QXSA 4XKJA 3V1UA 2Q1WA 1I01A 5I9MA 3PQEA 5JO0A 3FSRA 1NFFA 3RKUA 5A5EA 1Y9AA 3JQCA 2AXQA 4MP8A 3AY3A 4FB5A 2JD2A 3OF2A 4KZPA 4J1NA 1E0DA 1PJ2A 1LJ8A 3L07A 1A9ZA 3VPFA 3G1TA 1Q1NA 2DC1A 1SNYA 1HSZA 4RGBA 1MFZA 4HXYA 1RKXA 4DBZA 2X5OA 1ZSYA 4EUHA 5JC8A 2O23A 1PGJA 4ITUA 3LC2O 1S6YA 2HUNA 1KVTA 3ZNOA 3IDSA 4GLLA 4QEDA 4XQGA 1EE9A 1P0FA 4IDBA 1XQ1A 4P4GA 4K6CA 1LU9A 4R5MA 4E5YA 4TKMA 1MG0A 2EW8A 4OOFA 2RHRA 5JAIA 1ZSNA 4O6VA 5G4LA 2CDAA 3OIDA 3NRCA 3BTSA 2J8ZA 4DMLA 4XYGA 1UDAA 3F6YA 2CVZA 3KVOA 4GPD1 2VOEA 4WNIA 2FWMX 2EJWA 4KDFA 3WFJA 3M1LA 5B1YA 3PWKA 1I33A 2Q1UA 3HG7A 3OICA 4G81A 2NUAA 3WXBA 1DC4A 2IYPA 1Q0LA 4HX5A 4ALKA 3GDGA 3RJ9A 3PLNA 4NG5A 1ZXLA 3K2EA 5ER6A 1PQWA 4JIGA 2FN7A 5MDHA 4RZHA 1X15A 3AUTA 1QLJA 3I9KA 3A1NA 2AE2A 3P2OA 3Q6IA 2NVBA 4DIFA 2Y0CA 4LGVA 5BSGA 4WK6A 3VC7A 4LISA 1T2DA 2ZB4A 4KDEA 2EKQA 4RVUA 1ZEJA 2TMDA 5IDQA 2EWMA 3DBHA 3WGZA 3W4IA 4E30A 3CMCO 4R54A 4H16A 1NPDA 1YB4A 3W4KA 1SZJG 4UEKA 1W0CA 1FDTA 2AEMA 4BMVA 1DLJA 3UCEA 4HP8A 3FHLA 4CLRB 1XHLA 1GEEA 1SAYA 2WTBA 3RC1A 5DBIA 5TIIA 1D1TA 2VTDA 1Z73A 3X2FA 1TLTA 1U9JA 1T1SA 3AU8A 3Q2KA 1CYDA 1Q0QA 4P38A 4CLRA 3R3JA 1IOLA 1TI7A 4FDAA 2O2SA 2GYYA 4HADA 2HJSA 4B7CA 3OEYA 1HSOA 2YY7A 3VPHA 3DO5A 1L7DA 1U3TA 2X58A 4WLFA 1P1HA 1TVEA 1VL0A 4IIVA 3B6ZA 4J1QA 3EVTA 4ND2A 4IDFA 4BNWA 1T25A 1ZK2A 2UYYA 1K0UA 1WVGA 4RL6A 5JXWA 1UH5A 2HMWA 3VH1A 1YQXA 4ALNA 2ZYDA 2JAHA 3ZV5A 1PQPA 1MG5A 2D5AA 4UVEA 1N5DA 2YV2A 2W98A 4ZRNA 4YRDA 1Y9EA 3RBXA 3DZFA 3G1UA 3WSVA 1O6ZA 1OBFO 3A9WA 2PZMA 2DFVA 1QP8A 3G17A 2VRCA 3GN2A 2NWQA 3WGIA 1ID1A 1GU7A 2PWZA 1UP6A 3ADOA 3OQ1A 3GA0A 3ABIA 4D79A 1EE2A 4ALJA 4YAKA 2G82A 3D3WA 3R1IA 3TNLA 4Z6KA 4YT5A 2WMDA 4I5DA 5DNAA 5GY7A 3RC9A 1U3VA 4IJUA 3TZCA 4F3YA 4Q3AA 5TT1A 4RPKA 4GGPA 3LT4A 4NH4A 3RCBA 1CRWG 1VJ0A 1HDRA 5TNXA 4RDIA 3AUSA 4OSPA 2RIRA 3NYWA 4B3IA 4D42A 2O4CA 5F21A 3ETDA 3PXXA 4FCCA 1Y81A 4RVSA 1TA4A 2W2LD 3NGXA 3M6IA 1ML3A 5I7EA 4R1UA 3D4NA 5KJCA 1MXHA 3JQDA 1ZMTA 5L4NA 1QYXA 1KETA 2P5UA 4YAGA 3C3XA 1TXGA 2PGLA 2OP0A 5G0SA 4NK4A 4EUEA 3GMSA 1PIWA 4OGWA 3TZQA 2VZ9A 1T2AA 1JKIA 2W2KB 4UVGA 3WSWA 1GFSA 2NLOA 3Q1LA 1ZSVA 4MVJF 1X14A 5DULA 2FPGA 4B4VA 3D64A 5G0UA 1YBAA 4N7RA 1UXJA 3VH3A 3GEMA 5T6BA 1T24A 2IXAA 1NP3A 2W2KA 3SC4A 2VWGA 1HYEA 1KC1A 2WYVA 3DBVO 4QECA 1PJCA 1X7GA 3CZMA 1J6UA 2B83A 3N74A 3NJ8A 1PJ4A 1LRLA 4YDRA 1EVYA 2P2SA 3JTMA 3PJDA 1YBVA 1U2DA 4O0LA 5T57A 3L77A 4BOYA 3G3EA 2JHGA 3EAGA 3S55A 3AOGA 4FC7A 4D3SA 3D5QA 1GPJA 5KNLA 2GPTA 4WLOA 3OBBA 4J90A 4L9RA 2JAPA 2VNSA 2NADA 3R0IA 2VZ0A 3PHGA 4H3VA 2VHZA 4MVJH 4E31A 4Y8VA 4B3HA 2ZCUA 5ES3A 1I24A 1LNQA 1DHTA 3Q11A 4BNKA 3ITKA 2EERA 3RVDA 4KMSA 2FR0A 1FK8A 2CVQA 4EJMA 3I9LA 3W4JA 3C7CB 4FIZA 1JU9A 4MVJG 4BNZA 4KUEA 4II2A 1CJCA 1NQOA 2YHIB 3GZNB 3IJRA 3P2YA 4MOWA 2J3KA 3CUKA 5BNFA 1TT5B 1OMOA 1ADGA 3U09A 3S8MA 3KYCA 3P7MA 4DREA 4CM7A 1YE3A 2QX7A 3TOXA 1C0KA 2A4KA 4BV8A 4GSKA 5KJ1A 5DP1A 3GZNA 1CF2O 4FS3A 4KWIA 4ZQEA 2OP1A 4MJLA 2IDZA 3DAGA 1TT5A 2EGHA 3D4OA 1FDSA 4MP3A 3AK4A 1B8UA 3VHRA 3WR5A 3UUWA 2HLPA 1MLDA 5C7IO 3ZI0A 3DTTA 4RJTA 3B1FA 4KP7A 3QRWA 1AE1A 3SX2A 3PIDA 3A4VA 3VTZA 1OFGA 5B4VA 4K28A 2UDPA 3HN2A 1HZZA 4XX0A 2PD3A 2RH4A 1JAYA 3HNPA 3ANLA 4R9SA 1VKOA 1KBZA 2VUTA 4NPCA 2NTVA 3ZWMA 3VDRA 2AMFA 3OJLA 4BUCA 4D41A 1P1JA 4ZA2A 1GZ6A 1A7KA 3PFFA 4ONEA 4PG8A 2LDBA 1R4MA 2PH5A 2YW9A 3GVXA 5F3RA 1SBYA 3RI3A 1BG6A 3L6DA 3IMFA 3BMOB 3DC2A 1UXKA 4OHUA 1D8AA 1UAGA 3AM4A 3ZWXA 4BQRA 2PY6A 4GMGA 2Y93A 3H9JA 1XYGA 3HQ4O 4W9NC 3DZIA 4W7IA 3KBOA 1K2WA 1BVRA 2GD1O 1EFKA 1Z82A 2VT3A 1O9BA 2Y0EA 3NX4A 3QLJA 2O3TA 4BO2A 4ZQGA 4AJ4A 3LT2A 2EGGA 4JNKA 4OKNA 4F46A 1KVUA 3TL2A 3VDQA 1GPDG 4G65A 1SEPA 2DLDA 5JMWA 2Z1MA 2GASA 4ZN6A 5JPIA 5CDSA 2Q2WA 3TFQA 3GAZA 4E6PA 1DJNA 4WASA 2AQKA 3EK2A 3HUDA 4FOSA 5EJ2A 2Y1CA 3E03A 1E7RA 4EYEA 3INRA 4CUJA 5C37A 1YO6A 3ICPA 1DRUA 2GERA 3GNTA 5BT9A 2X1HA 1PZFA 3F5SA 2XAAA 4XYLA 2FPIA 4XGIA 1K6IA 4CLEA 1HETA 3B70A 4M89A 4EZBA 4YB8A 4AJPA 3JQ7A 4XZ3A 3OQ6A 3WGOA 3TZKA 3V2HA 4TMFA 2G0TA 2QIOA 1KEPA 5JW6A 1I10A 2PR2A 1B8VA 4GH5A 1LSUA 3K2BA 2SCUA 3KEOA 3OP4A 4PVDA 3ZWAA 1P1FA 4DIOA 2VQ3A 2VHYA 4MP6A 1P33A 2G76A 2C07A 2HMSA 3N58A 4ZQBA 5DBGA 5AXAA 3E9NA 4HFRA 2DTDA 3H5NA 5A03A 4HFMA 2VUUA 4J3FA 4L4SA 4YCAA 3OETA 2RAFA 5THKA 1E5LA 1VC2A 1ISFA 3BA1A 2OMEA 1WPQA 4DC0A 3WB9A 4MVJP 4WECA 1Q7CA 1HDCA 5FI3A 4EBFA 2YV1A 3O38A 4FFPA 4CR6A 5F1OA 5DF1A 3ZNPA 1PZGA 2Q49A 4DPKA 4W9NA 5JFOA 2Q3EA 4L73A 1G0OA 4NBRA 3WLFA 3DBLA 1UXGA 3H3JA 3JCZA 3QSGA 4IBOA 4ZD6A 2ZYAA 5G4KA 2DTXA 4FOOA 4EEZA 1E77A 4QFDA 3H4VA 5JCJD 2GCGA 3AY7A 4AJJA 1H94A 3PJEA 4LN1A 1A4IA 3JD3A 4PG6A 1Y8QA 3IC5A 3BMNB 3RUHA 2YFHA 4OL9A 1ZH8A 2I67A 3WX0A 5JY1A 4E33A 1EK6A 4IMPA 2BMAA 1T26A 1P3DA 2FP4A 2PZJA 4YPOA 3VKVA 3WS7A 4IDDA 4PRKA 5CEJA 1G0NA 5LDGA 2NU9A 4NBVA 4YRAA 4C7KA 1E1LA 3CEAA 2XXJA 2BRUA 4FFRA 2FZWA 2ZB8A 3MEQA 4J1TA 4DIBA 1OC4A 3U5TA 1ZIDA 1KC3A 3K6JA 4PLWA 2POQX 3I9JA 3M2TA 3KM0A 5ER9A 3SJUA 2IZZA 3FNFA 3WWZA 1U4OA 3JD1A 1C3VA 1ZXBA 1YH3A 2WD8A 1GUYA 3VKUA 2DFDA 4AJOA 3DOOA 3OQBA 3Q2IA 4D3DA 1DIBA 4PLGA 4RDHA 1NR1A 5TJ9A 3DFZA 3PHJA 3X2EA 1HZJA 4IZIA 1P31A 5HS6A 2ZJ1A 1GZ4A 1BXKA 3A28A 1E3EA 3EMKA 3HZZA 1O5IA 4Q3BA 1X7HA 4PRLA 4RF2A 4FR5A 4CM8A 5HM8A 5I7FA 1E92A 2BGLA 5ICMA 2W2LA 3OHSX 4Y6PA 4OAQA 3STHA 1RM3A 3AUAA 4JP2A 4BO9A 1DB3A 1XIVA 2RH8A 2A9FA 2DBVO 4ILKA 2VN8A 3GN1A 1N2SA 1O89A 1PJLA 1UZMA 2D5CA 3DHEA 3GEDA 4G5HA 1ZK0A 3QVXA 1YVEI 4R9RA 5EN4A 5GZ6A 4DXHA 5A5FA 2EKLA 2W4QA 1MC4A 2WD7B 3S2IA 2R6JA 1I36A 1KVRA 4UAGA 1YRLA 2F00A 4H15A 1GYRA 3L9WA 2PH3A 1PGNA 2FY8A 4CMAA 2PGDA 4BNJA 1DSSG 1H9BA 4R3WA 4BQPA 2WYUA 1C0LA 1U5CA 2I65A 3VTFA 2WD7A 5DBFA 4C4OA 2E48A 4RV9A 1XCBA 2B4TO 4CV1A 4BGUA 3MJTA 3ZHZA 4HNHA 3NT5A 1NFRA 3QW2A 5I9NA 3B20A 3JYNA 5DCWA 3JQ8B 3Q9NA 4RVDA 1QLHA 3C1OA 3F46A 2OBNA 2X22A 1BTOA 3KYDB 4IDEA 1EVIA 3UXYA 2J6IA 4N18A 1WMAA 2Z1NA 2C2XA 4U7WA 2VYVD 1XELA 2VUSA 1PJSA 2VHWA 3IOYA 4MKRA 5KCZA 4J7XA 4D45A 4EEXA 1LTHR 2E4AA 3CPSA 3B1JA 1LUAA 5KVCA 2PFGA 4PLCA 2D1YA 1IL0A 4L76A 3TRIA 3GFBA 3HB5X 4IM7A 3W6UA 4L0QA 4YBZA 5IG2A 3ASUA 3GK3A 2JCYA 3KRTA 5T5QA 3UF0A 1AHHA 1DDOA 4NIMA 2Q99A 1IUKA 2X9GA 3DDNA 3DTYA 1GUFA 4NMHA 2P4HX 3DZHA 2FHSA 4YJHA 4XQCA 1Y1PA 4BGVA 2HRZA 1DOHA 4TZTA 1YB5A 4R68A 3PWZA 3ZW8A 3MWEB 4IPTA 1CEQA 1E3WB 3GVHA 4XEHA 3IQDB 1GCUA 3DZKA 3U62A 4CM1A 1NFQA 1E1MA 3NT2A 4TRNA 4B79A 1NASA 2VHVA 2I6TA 4CM5A 4FFOA 3ROQA 1DC6A 1MXFA 4JGBA 1GV1A 1NR7A 2FPPA 4OOEA 3F47A 4Q39A 3QHAA 3C1TA 1U1IA 5CP8A 1WAMA 4EJ0A 3TN7A 3VVCA 4PIVA 5GMOA 4AJNA 4WOJA 1KVQA 1XG5A 4JQCA 4EDFA 1EUZA 1JQBA 2DUWA 4QQRA 3VZSA 2ZIZA 2GR9A 3GGPA 1M76A 3FI9A 4E2ZA 5U9CA 2YQ5A 3OMLA 5ADHA 3HE3A 1RYEA 4GWKA 4J0FA 4WCFC 5COBA 1JW9B 1ISGA 4DBVO 1PJBA 4RO0A 3Q3CA 4XA8A 4UEJA 3TSCA 3H3FA 3PDUA 4FGWA 2WWRA 3JQBC 4BMSA 4PN3A 1D3AA 4E3ZA 3NTOA 9LDBA 2GN9A 1P77A 1H2HA 1KY5A 1PSDA 1UJMA 2B36A 1CWUA 4JCOA 2NQTA 1EDZA 4XR4A 4NHEA 2CDCA 2OXIA 1ZCJA 1ULSA 3ZWYA 2JHFA 4DLLA 1GD1O 1PL7A 3EZLA 4QXMA 1JAXA 2EW2A 1SOWA 2YUTA 3INTA 4LCEA 4WKGA 3W8FA 1EDOA 1C1XB 1P1RA 3JQGA 3OJFA 1Z6ZA 1MGOA 2NTNA 2QRLA 3HSKA 4OJNA 2H6EA 3ZV4A 1WP4A 3PHHA 3OJOA 3KO8A 1QKIA 5JDCC 4CM9A 1KERA 4BVAA 4L8VA 2FZEA 4OKIA 3C24A 1VJ1A 1LDBA 4IDAA 5G0TA 2GGSA 1C1XA 4E0BA 5BNIA 2HAEA 4XB2A 4I9NA 3VH4A 2WJPA 4NBUA 3RAJA 1NNUA 4GX0A 1AHIA 1LDNA 4MKZA 1YWGO 5TQVA 3FNGA 4P4NA 3ZNQA 4J49A 2X86A 4OMUA 1N1EA 1WZEA 4DTIA 4YRBA 4OYRA 2NV6A 4A10A 1C14A 1IE3A 1SCUA 3ROMA 1I30A 5COAA 2Y05A 3OFSA 4RVFA 3V1YA 4BB5A 5LDHA 4B8ZA 3HDYA 3G79A 1P44A 2P68A 1NWCA 2YFQA 4L4RA 2ZB3A 3H9QA 4CL8A 1GYPA 5IDWA 2CNBA 5KVVA 1I3KA 5ICSA 1LRKA 1M67A 3KETA 4CODB 4KOAA 1GEGA 2F1KA 3ZH2A 3I5MA 4M1QA 1DFIA 1UDCA 1V3VA 3PGJA 1KYQA 4A03A 2VHXA 3GZ4A 4IS2A 1D7OA 1N1GA 4WLNA 5KJ6A 2D3TA 4UVIA 1ENYA 3DBHB 5L7YA 4TZKA 1BXGA 4ALMA 2EV9A 5A04A 1ZFNA 2RCYA 4KQXA 5JO9A 1SO8A 2ZB7A 3PDJA 4M55A 2GN4A 2PV7A 1MC5A 5IZ4A 1SOVA 4I8XA 4WEOA 3WGGA 5KOIA 2ZK7A 1IHXA 1LC0A 3EY4A 1Q7BA 4NJMA 3ICCA 4BNGA 4DVJA 5TGDA 4YAIA 1WMBA 3C85A 3PQDA 3FR8A 1RM4A 2AA3A 5TC4A 3QQPA 4Y9DA 1WDKA 2JCVA 3RWBA 5CDTA 3ONFA 2O3QA 3OA0A 1A72A 4ZGWA 3PLRA 1GV0A 5JDCA 4F6CA 1U5AA 3F5QA 1EMDA 3SEFA 2I99A 3DONA 2D0IA 5BQFA 1HLDA 4J0EA 5JCJA 4Z3KA 1PEDA 3V8BA 4M87A 2B35A 4LW8A 1NPYA 4RPHA 4HKTA 1H6BA 2Q2QA 4B4UA 3ZWPA 3JQAD 3LDHA 1V3TA 1NAIA 1LSSA 3IJPA 4YEDA 2IODA 3GAFA 3C7DB 3KUXA 5AQ1A 3NJ4A 1HF3A 1I3NA 2PA3A 4ROSA 5IZCC 2C2YA 4ZQHA 4P22A 3GNSA 1O95A 3EGOA 2HJRA 3BHJA 3D3WB 1XGKA 2CUKA 2D2IA 4UUNA 1PJTA 4WNCA 1YOVA 2IEDA 2DTEA 1B3RA 4E32A 4XCVA 3TZ6A 3PZRA 3LVFO 3TDKA 4UULA 1R12A 1GQQA 4MVJI 5JC1A 2CY0A 4XIJA 1W6UA 1ISMA 1EVJA 4HBGA 3DL2A 1MFPA 4PGFA 3ZW9A 2PD4A 3QVSA 3H9EO 2HDHA 5A05A 5JYDA 1DIAA 2HKIA 2E82A 1PL8A 1IULA 2O3UA 3LT0A 2J5QA 3U4CA 3V1TC 1A5ZA 1LI4A 2NVWA 2QYSA 3S2GA 1UR5A 2GN6A 4YJGA 3FTNA 3KTDA 3A14A 2FSSA 1LX6A 2ZTUA 1XR3A 1GAEO 1R0KA 3JD2A 5K6AC 5KJEA 1VJTA 1EUDA 4B7XA 4GVLA 1DAPA 4FC6A 4MIYA 4J7UA 3BTVA 1I2CA 5B4TA 1GQ2A 2O4UX 3E48A 3A06A 2DUUA 3BIOA 2XF8A 3ZU4A 4AICA 4R16A 2J5KA 5KVSA 1NVTA 3JSAA 1H6DA 5I7SA 4ALIA 1F06A 3LQFA 4NFYA 3WJAA 1Y5RA 4DC1A 1A27A 2RHCA 3W1VA 4WEQA 3WOHA 5I8WA 2Y1OA 5IXSA 2X7HA 3JQFC 1NHWA 4NBTA 4OO3A 4AJKA 1QMGA 4CMKA 3AOEC 3ONEA 1C0PA 4WE3A 1UP4A 5IZCA 2LDXA 1DRVA 4M54A 1HYGA 4BNVA 4D3FA 2WSBA 2HK8A 3AI3A 3GUCA 5C7LO 3SLGA 3P5SA 1UXIA 5F5NA 4MKXA 2QHXA 1AUPA 1E3JA 1O8CA 3U49A 4CR8A 5CDYA 4OH1A 2VYVA 2EIHA 5L45A 3NEPX 2GNAA 2IYOA 3UHAA 4BKOA 3ADPA 3LU1A 1LQUA 3E8XA 3GRPA 3MJVA 3LC1O 4CLHA 4D0RA 4ESOA 2Y66A 3I4CA 4QSMA 2DBZA 5H81A 5HWSA 2I66A 1RM5A 1KS9A 1X13A 2GZ1A 3HFSA 3U4IA 4NK5A 3AI1A 2DQ4A 3GR6A 1JWBB 3MJCA 4TVBA 4U8GA 4WPGA 4CMIA 4FN4A 8ADHA 3U3XA 4J91A 5A3JA 4RZIA 1GTMA 4HNGA 3VZPA 5IF3A 4KUGA 4R01A 1EVZA 5CPFA 4BO7A 3NAQA 1A7AA 2VOJA 3RUIA 2WM3A 3ZHXA 3VOSA 2PKQO 1YDWA 2P9GA 3GUYA 4J7CA 3E9QA 5BSHA 1UAYA 5EQDA 3KYCB 2CDBA 1E5QA 2BKAA 2G5CA 4BO4A 3FN4A 5K6AA 2IEBA 4M49A 1H93A 4LCJA 4CM4B 3SLKA 2YHUA 3HWRA 3ANMA 4J43A 4BNNA 4K1LA 4A26A 4ZRMA 4R5HA 3PHLA 1KEVA 3KSDO 3VVBA 3LK7A 2UAGA 3DAPA 5DZSA 3OIFA 1E7WA 2I9PA 1DO8A 1P1KA 4CM4A 2X4GA 5DP2A 5B12A 1WZIA 2YZ7A 1M75A 4QO8A 3CMMA 1R0SA 3D7LA 1GY8A 3WYBA 1X1EA 3HB4X 2NVUB 1NQTA 1P45A 1YKFA 3TQHA 3AOEA 2CSUA 4K6FA 2Z5LA 4G2NA 4MO2A 1HXHA 2J3JA 1EQ2A 4IINA 5COQA 4XJSA 1DIHA 4IJKA 1YGYA 2EHDA 5JDIC 3BHMA 1Z74A 3F1LA 4B4WA 4PLVA 1LC3A 2NVUA 4UUPA 3I3OA 9LDTA 3RFVA 1R4MB 1MP0A 2AQ8A 3EDMA 2I3AA 1R6DA 2PLAA 2CVOA 4RPLA 4JBHA 3W8EA 1I2ZA 2V7PA 1GZ3A 1QYWA 3AWDA 1QR6A 2AQIA 4IJWA 4XQ9A 1U7HA 1A9YA 3GLQA 1SMKA 4TVOA 2Y1GA 3IUSA 4MINA 2VRBA 5IN5A 5KWEA 1BDMA 4NFHA 1V3UA 1V9LA 4XQEA 1EFLA 3ZU5A 3JYLA 4WUVA 3KLMX 1UUFA 1YQGA 4O5OA 1T4DA 4P8RA 5H82A 4DQVA 1HL3A 1ADBA 3U4HA 3HJAA 3H2SA 4A2CA 1LSJA 3NT4A 5JLAA 2Y1FA 4NU6A 2UV8A 1EUCA 1U28A 2O3RA 4J1SA 2OZPA 5EQFA 5AXCA 1HE2A 5JYEA 1XU7A 3WGQA 4XR9A 3EYWA 5ILOA 1P74A 2BF7A 1VE9A 4E2WA 1KIFA 1A71A 1ENOA 2DPHA 3PHIA 2X0NA 1NAHA 3H9UA 6LDHA 4DYDA 1F17A 3GF4A 2PZKA 5L53A 4RLHA 2UUOA 4AFNA 3QVWA 3GH3A 1GADO 3JQ7B 1E6EA 4GX2A 5A1TA 3WNVA 3MOGA 3WMWA 1N92A 3MOIA 4FGSA 1IYZA 1ULUA 3PIIA 1TB4A 4W99A 4JN6B 3CTMA 4O1MA 1DIGA 3ZHYA 4LMPA 1JTVA 2BFPA 4BO8A 1I3MA 1RYDA 3C8MA 5DCUA 3AFMA 5JDIA 4DMMA 2E37A 5DT9A 3QWBA 4C7JA 3H5RA 3E1KA 1UZLA 1FF9A 1NTOA 3OJ0A 1H5QA 1TT7A 1E1NA 3DBRA 1KY4A 1NYTA 4PG5A 2IZ1A 4JJFA 3PGXA 4JK3A 3VPXA 3GHHA 4PZDA 3WMXA 1BHSA 3R3SA 2HU2A 1JWAB 3QY9A 2WYWA 3INGA 4FFMA 3D0OA 3LYLA 2H1SA 2C0CA 5L4SA 5FWNA 3OEWA 4CQMD 3DBLB 1CERA 1GYQA 4D43A 4I08A 3I6QA 5G4KB 1JKJA 4NNJA 1LEHA 4E5MA 1BDBA 3K30A 2NACA 3RFTA 1U8XX 4HFNA 1DPGA 7ADHA 1DRWA 1K6JA 1Y8QB 5EIOA 1MUUA 3CXRA 2NU8A 5F1PA 5ENDA 3WTCA 4BO0A 2JJYA 4BKRA 2GZ3A 3O8QB 1ZK3A 1H0KA 1VL6A 2WDZA 3SJ7A 4RQTA 2R2GA 3JQAA 3RFXA 2A94A 4GBJA 5FFFA 3IL2A 3OIGA 2OUIA 2H63A 3KV3O 1JA9A 5JE8A 3O8QA 5AOVA 3WQRA 1I3LA 1BWSA 4R3NA 5KVQA 4ND1A 3V2UA 5ITVA 1PGOA 2CFCA 1ONOA 1ONNA 2J3IA 1SEVA 2JFHA 5JAMA 3UKOA 1DC5A 3ROPA 5IFLA 1PJQA 4IGFA 4DQUA 3AU9A 4YQZA 1QRRA 3O4RA 3NDRA 4M86A 1HDZA 1O94A 2QG4A 4M8SA 1WLYA 3WNQA 4NI5A 2JKVA 3WBFA 3QE3A 1R4NA 2YDXA 2Q4BA 2G1UA 1YJQA 3K8ZA 4HY3A 3VH2A 4CM8B 3AUUA 4JBGA 2BLLA 2R00C 1RJWA 5L95A 1LLQA 5CFZA 1PS0A 4R1SA 4DWVA 4QUKA 3UICA 1KEWA 4JJGA 3LLSA 1JLLA 4BKUA 4NZ9A 4BL5A 3RC2A 4RF5A 7MDHA 5KKAA 4Q3NA 3BAZA 2AW5A 3KLPX 5L7WA 3PJGA 1U4SA 3IP1A 5T8KC 4YYZA 1VPDA 4BO6A 3QWFA 3FNHA 1DHRA 5CDUA 2D59A 4IQGA 1U3WA 2OORA 2PNFA 2EXXA 4W7HA 2JFFA 2P5YA 2YV3A 3MJEA 4JX8A 1IZ9A 2I76A 4ZJUA 3CINA 3FR7A 1CQIA 3GG9A 1XDWA 2BH9A 4XYMA 3DOJA 3RC7A 5AVOA 3MWDB 1YONA 1ZUD1 1R0LA 2XXBA 4BGEA 1HE5A 1BMDA 5I7VA 2HK7A 1PTJA 2BFMA 3BMCA 3F3SA 4XD2A 4Z3DA 3T7EA 4J9UE 5DN9A 1UXHA 4PLZA 1Q2XA 1HKUA 3MCVA 1B7GO 5TLSA 3DHYA 4WOKA 5KTKA 4AVYA 3PP8A 4ID9A 3ZGYA 5TRTA 3WBBA 3GPDG 2VWHA 4RF4A 3U0BA 4E12A 4GKVA 1E6UA 1C1DA 1F8GA 4IZHA 1IPFA 3S2FA 2PKRA 2BELA 1HTBA 3TPCA 1E7QA 3ZWNA 2X6TA 1BVUA 1B2LA 2C82A 2AQHA 2BFOA 4R1TA 4CLXA 5GZ1A 1IY8A 3QP9A 3GC6A 5TSDA 5FI5A 4JP3A 3I9MA 4FW8A 4YJHB 2R00A 3PTZA 2FR8A 2Y0DA 1Q7GA 1ZMOA 5KJFA 3CSDA 2ZTMA 1X0VA 1T4BA 5ENVA 2DKNA 1SB8A 4D46A 4Q3EA 4JROA 2IE0A 3DZJA 1VSVA 3H9GA 1E7YA 2TMGA 3DMTC 4CQLB 4A7PA 1I2BA 2CF6A 4YVFA 1PZHA 4MPDA 1HT0A 3ROKA 2IRWA 3DHNA 3RU9A 4E4YA 1K89A 1LA2A 5T8KA 5C7OO 4BIIA 2B4RO 4F45A 2JL1A 2W8ZA 5BNTA 4MVJD 1BRMA 3L4SO 3BHIA 5BSEA 2EG9A 4LVUA 3E18A 1ADCA 4CQLA 4XJTA 1E6WA 5A9SA 2BI8A 3F4BA 1J0XO 1LSOA 3UVEA 4KTTE 1VI2A 3Q0EA 1H2BA 1QORA 2BD0A 1E7MA 1HEUA 3FWZA 2WEKA 1N8KA 3RQSA 2AG5A 4JXKA 4HFJA 4Z0PA 4XYBA 4CLOB 2E6UX 3OH8A 4DQXA 1T2CA 2GO1A 2Q4EA 4OXYA 3ZWOA 1VSUA 4YT4A 3QWHA 4CUZA 3BMQA 2FR1A 4RPJA 4AJIA 2VTEA 1NM5A 1G1AA 4CLOA 1ISIA 3OM9A 2C59A 4AJ1A 3ANNA 3ITDA 4Q3DA 3JQGB 4FQ8A 2X9NA 1QYCA 1OI7A 2HCTA 1UDBA 3DQPA 3TZHA 1IZ0A 4UVDA 3NDIA 1J49A 3PYMA 1IHYA 3EC7A 6ADHA 1E3LA 4ZHSA 4IUYA 1EZ4A 4QTZA 4BGIA 5IN4A 3GQVA 4KUHA 3SXPA 5IXYA 2WE8A 4J4TA 3FBTA 4IQ8A 4J4BA 3WIEA 3AFNA 3DMTA 2V6BA 1H9AA 3I6IA 1G6KA 1L7EA 3DFUA 1ZEMA 4QT0A 4U6QA 5EESA 3TWOA 3WYEA 4RLSA 1B3BA 1Y7TA 3M2PA 2OO5A 5HS4A 4XB1A 5HBRA 2DM6A 4NFSA 3VPSA 2Q45A 3JQEA 3FRJA 3T7CA 1VLLA 3E82A 4TRJA 4LSWA 1DFGA 3JV7A 1KEUA 1ORRA 3QV1A 3UH1A 4KWHA 4L74A 4CMBA 1N7HA 5B37A 4XGNA 4K9DA 3PYLA 1K6XA 4H7PA 3ENKA 4BNIA 2BGKA 4MVJE 3ORFA 2Z95A 4XYEA 1KOLA 4BNFA 2CF5A 3Q9UA 4LRTB 4JJIA 2IXBA 4O63O 2X0JA 4TRMA 1GCOA 4CV0A 4WCFB 2W90A 4Y98A 5CG2A 1RWBA 1L1FA 3RBZA 3FF4A 1QYVA 1BXGB 3FD8A 3H8VA 3ZCXA 3KYBA 1B14A 1XU9A 2QRJA 2QYTA 3ASVA 1DBVO 3GDFA 4IDCA 5TT0A 1NPTO 3G0OA 3GFGA 4OM8A 4WCFA 1AGNA 3V2GA 5JSFA 4BO1A 4KTVE 1MB4A 2J3HA 4PLHA 4NJMB 4U5QA 3GNQA 5IDXA 3RUCA 4BNHA 4YACA 4E5PA 4O59O 2EF1A 5A4DA 5T64A 2O7QA 1Z45A 3JQBA 4U6SA 2VYND 3ZZNA 4CQMB 3H65A 3CKYA 2PK3A 2DPGA 3WJ7A 3D5TA 5JAZA 3PPIA 3HDQA 4DPMA 2NM0A 5G2OA 4PLFA 3JQ6A 3VPGA 4J2OA 4CR7A 2G17A 1Y6JA 3AY6A 5DOZA 3ZU3A 4AG3A 4CQMA 4HV4A 4N54A 2OFPA 3FPCA 3GGOA 5TS3A 1XLTA 3U4DA 3LZ6A 4IJVA 2GLXA 2X0IA 5THQA 3I4FA 4I9HA 4J16A 1PL6A 2VZ8A 1AXGA 5L9AA 1N7GA 2OGUA 1LBEA 4ND3A 4BB6A 2C7GA 1TEHA 3AW9A 2GN8A 4WGGA 4YQYA 3WG9A 4Z9XA 3I83A 4J2HA 4DLBA 3JQ9C 3WTBA 4XRGA 2UUPA 3RU7A 1HDOA 4ZU3A 3GHYA 4L4XA 5L51A 1F0YA 1S7CA 2Y67A 3PI7A 4B8WA 2Y1EA 1NWHA 2QW8A 4WCDA 5U1PA 1P1IA 4B4OA 2H5LA 2Y68A 4FFNA 2DVMA 3DXFA 4L75A 5CPBA 3ZN2A 3PQFA 3MZ0A 3C1AA 3NGLA 4XDYA 5FYDA
chains in the Genus database with same CATH superfamily
1PWZA 3RC8A 4LSMA 1LW7A 2XLBA 3DR3A 2AF4C 1CUAA 5EE1A 3U7JA 4QPZA 1VYTA 3ZU2A 3T4XA 2R8ZA 4ZOCA 1L7XA 1LLDA 1UIMA 1ZKMA 2EKZA 1M6WA 3G2PA 4FYXA 4M9QA 4N5MA 4EW6A 1LLUA 2ATXA 2Y6VA 3KOUA 4YXWD 1H9CA 2LBPA 1NMYA 1II8B 1SIWA 3MMPA 5BVGA 4LK2A 4E08A 1CR6A 5AI6A 4MVXA 2OM6A 4C05A 6ABPA 3LQ4A 4HGRA 4QDKA 3VTKA 4LVCA 3PC3A 3PE6A 3HL4A 1OB2A 2IZ0A 2CMFA 4PZEA 3EIOA 3B2NA 3NMUF 1ENZA 2K2QB 3EVNA 3ZJVA 3N7UA 2NTJA 3IKMB 1KRHA 4QNMA 1XC7A 4YJFB 2WLSA 3D0QA 2XI4A 3IO3A 5CH3A 3THWB 1GDTA 4H31A 3ZCSA 4V0NA 4JC5A 3QVOA 2WKPA 3OQJA 2P78A 5DGXA 3RYCA 4ZHQB 1BD3A 1CUGA 1J5XA 1BXRB 1CUDA 2FNAA 2Q1TA 3NW9A 3OTIA 1FSFA 2C99A 2Y99A 4HNUA 3BS4A 1ST2A 2FQ1A 1NV9A 1ILWA 3C3PA 4MARA 5AJHA 4RTMA 2GJAA 4POOA 2X0EA 2WU1A 5C1DA 1OWLA 1J90A 2YJ6A 3CA8A 4JJ4A 2HF7A 2IHTA 1QVZA 3B6IA 5JYBA 3MT0A 2YQ4A 4AUMA 1QFXA 1QKKA 4RSMA 2YL2A 4J3JA 1KK2A 3QKUA 2PRIA 4RACA 4DV1B 1ZGZA 4JSTA 2ZE7A 4CM6A 1B0AA 3DMYA 4KE6A 5HIKA 4I14A 3FLBA 4YCSA 3ZLUA 4QDXA 5KTSA 1QS0A 3R5SA 2BM1A 3I9NA 3MCWA 2JGLA 2MTBA 5T67A 421PA 2J4DA 3K6KA 4IGIA 1F20A 1KKMA 4CGZA 4C07A 2EBWA 4K0KB 5IC4A 2VQ6A 1C80A 1LJUA 1FMTA 1E2IA 2XUOA 1DQPA 4GQIA 3AF0A 1SXJC 3AR6A 3CCBA 2QN3A 3ILXA 4PFQA 4PONA 1ZBQA 4TWIA 3RTGA 4UUAA 1ZMBA 3RFCA 2OHFA 2PMDA 3QH4A 1CJKC 3WGTA 3RVKA 4WY2A 4O4HA 1JDBB 4XOIA 3F96A 3KJIA 3N5KA 5GM1A 3SC6A 3UMSA 4CTJA 2J0QA 3V4OA 1ZUNA 1K8XB 1QZ3A 2O57A 4BE4A 1RJ9A 1RXYA 3QQ5A 3CURA 4TSKA 4C89A 1UQTA 3KTOA 4DKXA 5A1JA 3HV0A 5LC1A 4B7UA 1L4NA 1E62A 1JG6A 3DA8A 5IHXA 3EVFA 3UHOA 1G5IA 4TTTS 5E0KB 4EM6A 3G6WA 4Q82A 2Z2KA 5F35A 4A8HA 1QV6A 2ZRPA 3GVIA 1XTSA 3EIHA 3PQ4A 5SZIA 2Y9MB 3KVNA 4KN8A 4LHSA 2XUJA 2FUEA 3E7DA 4LY0A 4UXJA 5CTAA 1UPXA 3TDMA 4J6FA 3CUWA 2UUBB 1W73A 2BUBA 3L02A 2A35A 4UM7A 4DRYA 3NBFA 2R8OA 3P96A 5ADUS 5DO9A 2Q6IA 4V0QA 2GK6A 3FCOA 5C31A 4EKGA 4XCXA 5FWXB 4BFLA 5C7YA 5TMEA 3RROA 5EL0A 2PMWB 2P0AA 2QZZA 5LUAA 2VO1A 5K9ZA 1VKNA 3NM6B 4KXWA 5JSHA 1GFWA 4I5GA 5K8VA 1XXHA 4ENQA 4L7VA 2WINI 2IU4A 1MAUA 3IEPA 5U4XA 3ST7A 3HDHA 5DV9A 1XAJA 1QVRA 2Y77A 3R5XA 3TKYA 3AYZB 1NF8A 5FLKA 2COUA 4YLEA 2REXB 1VYHA 1EVQA 4QJ3A 2O7RA 3N76A 3WLEA 1HG0A 2P91A 1G3QA 2QVGA 1A5AB 2JI6A 5FTJA 2HF2A 4TS9A 5EHIA 1CRQA 3WGHA 1UCFA 1TQHA 1YDEA 3DDHA 1O0SA 1HQYE 3KB6A 1H1TA 2R8EA 1OYWA 4IP0A 4JYMA 4B0PA 2GFHA 3Q7QA 3IEXA 2GX6A 1VJ5A 4FGZA 1TQDA 1D1SA 4IAOA 1R50A 4QRHA 4FT4A 4JI2B 2PTGA 3O7WA 3GGGA 3I9OA 3KD2A 4XDZA 1S01A 3WI7A 1JV2B 5HTKA 3QVVA 3SX0A 1NKVA 3JQFA 1U7PA 3MCZA 3MJSA 3MOSA 2DOKA 4R41A 3IBYA 1I4EB 4PFJA 5HIMA 3VU9B 1ADJA 3ZV3A 4CIXA 3W5CA 1DAOA 4CMEA 1GAXA 2OK8A 4NZNA 3PKZA 3UXEA 1KSJA 3PRJA 2CXQA 2YMQA 3ZHQA 3ZDQA 3G7NA 1V7QA 5ESDA 4CN8A 1XRNA 4EARA 1WSDA 5BMOA 1JQEA 2RK3A 4ZEMA 1SG9A 1NUAA 2XMSA 4NR0A 1Y8RA 1Y3DE 4Q4AB 3VVLA 1XZHA 4AZ0A 3E5NA 2IA5A 4NS4A 4AZSA 2PVPA 4RKQA 3SDZA 4EITA 1DE0A 2HSDA 2GQ0A 2YTZA 3NVAA 4ZVQA 5JAUA 1URPA 4FVTA 5IVDA 2R1ZA 1EQUA 2CYBA 4X8HA 4ZOLB 4DIKA 4TT3D 1U63A 3C7AA 3BCHA 4S1OA 1LW6E 1XMSA 3F4LA 2OR3A 4KQJA 4DLPA 4BC1A 2PKCA 3LUHA 4PCLA 2VF2A 4EHJA 5C2JB 1NI4A 3OZIA 2C7QA 5EAIA 4YMTA 1E9RA 2AVDA 3EXHB 1PBNA 3ET4A 1IXSB 1JDVA 2VC2B 3WYDA 5CAEA 2I3GA 3ETGA 2R7LA 3OM8A 2QRVB 3VOTA 1CUXA 4BDTA 4BE7B 4EATA 3L01A 2R25B 4MV4A 3L4KA 1V4NA 1GUBA 4KITB 3PFKA 4KGZA 2FETA 4INZA 1SVKA 1FMCA 1GL3A 4G86A 2DERA 2DF8A 1K5HA 3P27A 3VAYA 1H2EA 1B8PA 1PGQA 1JA1A 1QE0A 2A8YA 2F3SA 2JLSA 4IFTA 5LP1A 3PEYA 1CETA 2HJGA 3ZDBA 2J07A 2YHBA 1WUKS 4P4TA 3T95A 1DNPA 2ZRFA 4U2DA 2CZCA 3T0IA 2IF2A 2AOTA 3EGVA 4ZVVA 3WYGA 3M6UA 4M1WA 1JVSA 1RPTA 3CBQA 5CU7A 3ZNNA 1XWFA 4EA8A 4PAGA 5JROA 3ORRA 3GCGA 3UK7A 1U2QA 1WCV1 5EP3A 2QNRA 3VZDA 5ALRA 2JLUA 3PJEA 3TVDA 1L5GB 5F9HA 4DLVA 3PWSA 4TTVA 3NBKA 3LC7O 3PEFA 4CM9D 2CMDA 1J23A 3L0OA 2ZBPA 1I0ZA 3MTIA 1N9KA 1C2TA 1AVTA 2JLVA 2EFHB 1XTZA 1GTG1 1NT4A 1SPBS 3UMRA 2Q3MA 3HDJA 3NO4A 1BH6A 3BMOA 3IIMA 4G24A 3GBSA 3L06A 5ALEA 2YNMA 4OXNA 4MYDA 3RUFA 2FEPA 5KOHB 3QK7A 3P2MA 4KX5A 3OJXA 4YECA 3SC2B 5LP6B 4BAZA 4QFCA 2BTOA 4DL9A 1AGPA 4P5EA 5MGNA 2P77A 5IM4A 1FW6A 1HE3A 1LFDB 3A37A 2A0KA 4I1IA 1PWXA 3CO0S 1FLVA 4HLDA 1PNVA 1V71A 3HN7A 4L16A 5CVVA 1JMYA 2O7SA 1QANA 3SICE 1BMQA 4XIJA 4MJ7A 1Z6GA 3GD7A 2C54A 1I4WA 1UK6A 4M8IA 1H5NA 3HKDB 4RD2A 5EINA 3TKLA 3WWYA 3FRHA 4F4FA 4JD5A 3WRVA 4HWTA 1G8GA 3JTEA 4W6ZA 4WI1A 3JY6A 2YJNA 1Y5MA 1BW9B 3OECA 4AK9A 1JHYA 3D4IA 4OLHA 2LXNA 3CZRA 3P5BA 3G13A 3NDPA 4DYHA 4KI7A 4CKBB 2HRBA 4IMJB 1NX9A 4AB1A 1PJAA 1XQ9A 1AZTA 2F8MA 4LK3A 1FFXB 1RYHA 1LXCA 1Z75A 4RHCA 3ANSA 4EKDA 2C77A 1Y7IA 1D8TA 4JHLA 3ZBTA 1LDEA 2YWDA 5CEFA 5KWSA 4W5HA 3IP3A 3ZEIA 1DX6A 3O9MA 3NHYA 1DC8A 2A9JA 4JB8A 5EXXA 3MW8A 5AJUA 2JFGA 3OTQA 3WA6A 2XOXA 4MDYA 3GV0A 1OX6A 1E2DA 4B76A 2DJIA 3ASZA 1DXYA 4DA9A 2PUBA 2CXOA 1LTQA 1V2HE 4KE9A 4CCWA 4UAVA 1MDBA 4IYJA 3ACCA 1TU0A 3TTTA 2AFHB 3TZLA 4ER5A 4P5DA 4JSRA 4EB0A 5BSMA 5JCXA 4I5FA 5JUWA 1WDMA 2PTHA 1T5OA 1HBJA 3BTUA 1UT8A 3HKEA 5CFQA 1T2EA 1QYDA 2B6HA 4HUTA 3K3PA 1YJ8A 1FXSA 3C3MA 2C1ZA 4EJ6A 3HJFA 2VAPA 4JNCA 5EMKA 5BUSA 2IU6A 2WJYA 4LOJA 4NYMR 1P2GA 2IYZA 3LTEA 4A8JC 4Q7QA 1MV8A 4HUJA 3G8DA 2HSJA 4L5AA 4TX1A 1UEJA 1QRTA 1W9MA 2X5JO 2I4OA 1PU2A 3O9ZA 3I5UA 1KNXA 1B16A 1ZBDA 1MMFB 3EEYA 1NOKA 1ZC4A 3CE6A 2V1XA 3FDIA 1KDTA 1Z68A 2VHCA 3N86A 1BZYA 4KXMA 2BFFB 3B1WA 4EB8A 1FDOA 4MWOA 2IUTA 4XCQA 2HA0A 1WB4A 4TLDA 1JFLA 1FDVA 4U3JB 5KYUB 4LWPA 2C92A 4IDNA 1WXDA 2Y8EA 2ZXFA 1RZVA 4IO0A 4ZEOA 3RD5A 2YZ2A 3Q3GE 1G18A 4ML3A 2B0JA 3MAGA 4QO7A 4RWEA 1GFZA 3HXKA 4FXOA 1QQ7A 3HU3A 4LXXA 4RCZA 3R24A 5FCDA 2PGJA 2YW2A 1GG2A 3BMNA 3DE6X 5B58C 2V6FA 5FOVA 3TLEA 3BE5A 3C6ZA 1UP7A 4WBNF 2QSUA 3NM5A 3WQSB 1E0KA 4OMDA 3RTBA 2ZDGA 3THWA 2H4FA 3RSHA 3JATA 3GDWA 4UCXA 2BGNA 3MTBA 2G5TA 2HA4A 5H5JA 1UKYA 3H87A 1FRZA 3A6EA 3UMVA 1O1YA 2AKEA 2HWUA 3ENNA 1FLDA 2VRCD 4TYQA 2BJHA 5FL7A 3GJ8A 3D8TA 2PAAA 2V55B 2GPBA 3BD7A 1QNLA 2LVBA 4NLLA 5I7WA 3ILHA 5IT0A 3LYHA 1YDGA 2A0YA 3COSA 1YIDA 3GVCA 1Y37A 3DZBA 4MVJM 5DTMA 4G5QA 5BV2P 4ITVA 2B5VA 4IIHA 2VNAA 3K96A 2OCDA 2FWRA 1ZVMA 2YJZA 3GG2A 4JDPA 2HF8A 4KIFA 4WNAA 3B9BA 4AJLA 4BJ5A 3VUFA 5K0FA 3U3RA 4GLOA 4PU0A 5J2UB 3OZVA 3IYLW 3TLYA 2DY0A 5FT9A 1EDEA 5GIOE 4RIIA 1M2OA 3O4GA 5C34B 4UBNA 2IZ6A 3O21A 4PNHA 1Z56C 2AOXA 4R51A 3D1LA 3LDAA 3ZTWA 2JJ2A 4TQUS 2C5EA 4WN3A 1DC3A 3UJ3X 4WXRA 2E7ZA 1JJBA 5LOVB 1M0TA 1GQSA 4B85A 1NNEA 4R31A 4D3XA 4OHBA 8OHMA 4MRMA 1JQDA 2G9QA 4TYWA 4K26A 2GOYA 1PQUA 2I4LA 5SYAA 2ZR7A 2VH2A 2NSYA 5BR8B 1OVGA 3PKIA 1XZBA 1AXEA 4N5LA 2QAIA 3EHEA 4YRKA 1THMA 1X42A 3UMGA 2OV3A 2V6GA 4QODA 3PVZA 1KDOA 1QH8A 1W44A 2W43A 5K45A 1Z25A 3O6VA 4HSEA 2IYSA 4NCIA 3DEYX 4R1PA 4WERA 2H1IA 4WXPA 4CNBA 4ZJYA 1RWMA 2HJHA 7GPBA 1WDLA 5B6PA 4OJQA 2DPLA 1QG6A 2W0MA 4ZTUB 4Z2AA 5AYVA 3ZX4A 1OOEA 1ZN7A 1UBFA 3GRKA 4ITRC 4IMRA 3SPXA 4ARIA 3FOWA 3KBBA 5EHNA 4Q9NA 4CIVA 4N5HX 3ONDA 1W5AA 2B1QA 4GKBA 4OHXA 4ZCQA 4DIUA 4AJEA 5D5QA 1R66A 3TLJA 1SQ0A 3BERA 1KFJB 3MTJA 3PA6A 4TROA 4FJ1A 5G0VA 4JEIA 4CV2A 4D44A 4AMGA 5BURA 3KU4A 1QB8A 3OLYA 3UMMA 2I9KA 5EXSA 2OZKA 3BFXA 3OOSA 5HGXA 1GGFA 3A25A 3TE7A 5BOSB 3FWNA 2BGRA 2HO5A 3LCVB 1GXSB 4C4TA 1PAUA 4GBED 3Q3VA 3OZDA 3E84A 3DV0A 4KPYA 3AVPA 1MJNA 4A4DA 5AKHA 3STWA 3DMHA 1FBTA 1KJJA 2IY8A 4I2VA 4E5KA 3T5BA 3K0EA 1RPNA 3DM9B 4GX1A 1ETUA 4KQKA 4IY1A 4ABTA 5ETJA 4R40A 4FFVA 4MUBA 3TTUA 2D8AA 2RKBA 4YDQA 2W0SA 3SIWA 2UXCB 1XZGA 1UBNA 2FH5B 2VF4X 3A3YA 2PHZA 2ZTHA 3FETA 3AEKA 2RGAA 2FLWA 5A4IS 3OTWA 3HCOA 4IGEA 1WXQA 1JEJA 1GIAA 3HHPA 3KUDA 4RMIA 4ZOQI 3R6DA 4BNDA 3DMFA 5LA6A 1E3IA 1C8VB 2DSNA 3P0IA 3IT2A 1SKUA 4P9NA 1RM0A 3NV9A 5ALDA 4YX9A 1R0CA 5EJAA 4HAVA 3BAFA 4W82A 1E8DA 4I50B 1QC5A 1N2BA 2JGDA 4PCAA 4ZU6X 3WDSA 1I94B 3PHCA 3EGIA 2ECFA 1ZDMA 3BMQB 3TQOA 4FNGA 3CNLA 5U4QA 1LLCA 5AW5A 3S68A 4KYVA 3VNRA 3WWPA 4UE6A 1QGYA 3CCCA 1MAWA 1YI0A 2KYRA 1ODLA 2ZBQA 2X4LA 2I6FA 4NYIR 3DULA 1GKUB 2I6UA 3UJAA 2O8FB 5I5GA 3UQYS 3I6MA 3R7FA 2DBRA 3EW7A 3ZOKA 4LY3A 3WHIA 4CFYA 3U3KA 2BHRA 2A4MA 2C3MA 3IODA 1KYVA 3NJRA 1F1BA 1MQSA 5JJ5A 1OQAA 1RLOA 1YR6A 2POCA 3EFOA 2ZE5A 1FNDA 1Z6TA 3GLRA 5ESXA 5C8YF 1MCZA 4WGFA 3W5IA 1JHQA 4IRXA 1LDGA 4ZI3A 1XA0A 3PZBA 3IQZA 2OV1A 4NBNA 3GAAA 5DIZA 1UT5A 4ZAZA 3EVCA 4TMZA 1KDPA 4IKPA 3DWEX 4Q4CA 4MB2A 4HH3C 5EJ7A 5ITWA 2Y9PB 2PCLA 3NXSA 4R1NA 5FI1B 3O8RA 2Q1SA 1G4AE 1NNSA 3A4NA 3W06A 4L8WB 3J80A 1TL7C 5EZ5A 2MMCA 3BGSA 1HO3A 1QXSA 2FPWA 4LJSA 3V1UA 3WL6A 4BCDA 1P0QA 4HVLA 4KQFA 3PQEA 4JLDA 1U3FA 1YKGA 2B7LA 3FSRA 5IEJA 3NM4A 2X3YA 1Y9AA 1V5IA 1RRCA 2Y2UA 2C3PA 3UWSA 5JS1A 4OQMA 1BS2A 1M8KA 3MERA 4QTTB 4AQYB 3AY3A 3H1BA 4MW5A 2JD2A 3H83A 4GOOD 3AJ9A 2Q5IA 4KZPA 4J1NA 2LPMA 4PSAA 5KQSA 4Q16A 1RCUA 3ANXA 3KJGA 4R8RA 2HO4A 1IBRA 3G1TA 1CS4C 1W5TA 2FGKA 1SNYA 2P2CA 5HK9A 5LXTA 3ECAA 3OESA 1RI3A 4EEKA 4F4CA 1U9ZA 4F4DA 4CF4A 4JT2A 1KYIA 1IQPA 1P0PA 4KACA 5F33A 2BKXA 4A91A 1IRXA 4ZREA 2WUFA 5LVAA 2HUNA 3D0KA 1KO8A 1DS6A 1KVTA 5E6SB 2EZ8A 3FSGD 3GEIA 4F84A 5AVQA 4R7TA 3C5WP 2QENA 3EQ7A 3LNTA 4Q4DA 4GLLA 1NBEA 3TXYA 3I42A 1I1OA 1RMTA 3MGKA 2IS4A 1RVV1 3KE9A 2HOQA 4YIKA 1F4LA 4D8XA 1VHDA 4P4GA 4JEUA 4K6CA 5F4ZA 1Q1QA 2NZXA 3QLVA 1MG0A 2NT4A 2RHRA 2FJPA 5DGHA 4M9RA 4RTLA 5JAIA 5G4LA 3ZJUA 4FU0A 1Q0UA 3UT5A 4AWBA 2JVJA 3L7MA 1EESA 3CNBA 2AZMA 3D81A 3BTSA 3NRCA 1E66A 1E1RA 1NLUA 4LOAA 1XDDA 1TPZA 2NUAB 1WTAA 3UEOA 3R9XA 1LH0A 3ETCA 2P62A 3CB2A 1NQXA 1NY6A 2OXRA 4MUIA 5DGIA 5KTRA 1SC4A 2GKGA 2XZTA 4WJKB 3WRXA 3ZE6A 2Q7XA 3MPUA 4F3KA 3M1LA 2OCYC 5B1YA 4NCAA 1I33A 1XZEA 3LE8A 1XVUA 3H1TA 4NARA 4UE3S 3OICA 3O0DA 4M8LA 5JSZA 1VE6A 1DC4A 1DRJA 2XCTB 3ZOZA 1Q0LA 1BFKA 1C9JA 3THOA 1TM3E 3ZHCA 3BJRA 4ALKA 1KYZA 1PG5A 3A6JA 3QHPA 1SWWA 4PZUA 1AS2A 1Z0UA 1ABBA 3CVOA 1N8SA 2PL5A 3LM8A 3AVYA 4NCNA 3AUTA 3TSOA 2JZOA 5C32A 5EWLA 1R18A 3I9KA 4QKQA 3LQ2A 2IH2A 3Q41A 3OPMA 1O0BA 2G9UA 1ZKDA 2P1DA 4L4ZA 1CUWA 4AS2A 3IUMA 4OU5A 3AV3A 5LN1A 3MINA 1UDRA 1T2DA 4P3KA 3PXDA 4G1MB 4KDEA 3CIOA 4ER7A 2W2MA 1KFEB 2OQIA 3WYFA 2ZUVA 1M1NB 1RTTA 1WBJB 2C58A 2EWMA 1CLEA 2HEIA 3DBHA 2PMEA 1Z88A 3RIMA 3QPCA 3W4IA 4B32A 3PA8A 3VYWA 1IWPB 4E88A 4H16A 1DKOA 3UJ9A 1CUZA 3WC4A 2Y92A 5TMPA 1SZJG 2R6ZA 2WHYA 4FOTA 4NCHA 1GNRA 4UEKA 1G9XA 4X5OA 1C2YA 5F64A 3HR4A 4CLRB 3I64A 4CFZA 3OUZA 1MX9A 4L6IA 2WUDA 3PDWA 3BH0A 5TXGA 5IAOA 4X1OA 2WTBA 3WZMA 1P6XA 3V42A 1D1TA 2VTDA 4BASA 2YRXA 1Z73A 1IBLB 1T4CB 1BD4A 3QFCA 3UWMA 1YTUA 5FPYA 3V7NA 2BM0A 3K9WA 3WL7A 4WKNA 3S29A 2QPAA 3D6JA 3R3JA 1Z29A 3B60A 4V1CI 5LD2B 2W2PA 4HADA 3HRKA 1AM4D 1G64A 1SKBA 4YRZA 4B7CA 3HI4A 3A6PC 3KXLA 1DX4A 1G5FA 3E7XA 3PRYA 3OX1A 4GD3Q 3DO5A 4LZOA 1G16A 4R6WA 5J2TF 4OF4A 4WLFA 4BNFA 5FWAA 1TVEA 2XIQA 1HNZB 4MO9A 4E14A 4L2IA 2BFWA 4RGQA 1XQVA 1R8SA 5FUYA 4DDUA 1SD5A 4JH0A 1CNEA 2YJ4A 5AO9A 2HMWA 1EXNA 3T5TA 5HIJA 4YR7A 1U0BB 1YQXA 4PXAA 4DJ5X 3HZRA 3ROEA 1SZPA 2JI4A 1N6PA 5IYZA 5BYJA 1Q15A 2J7PA 4HB4A 1PQPA 2C5BA 1VCNA 2GXUA 3HCRA 4KVZA 4R3UC 1E3TA 2VKTA 3TMKA 4UVEA 2PMBA 3VKFA 3ZXYA 3SK0A 4ZRNA 1DI0A 1XI2A 1QQBA 3W2EA 3ZBPA 5JZBA 3B51X 3VR1A 5C18A 5JXHA 1OBFO 4P3XA 4XTCS 3U4QA 2CHVA 4QU0A 3EIUA 1KIMA 2PZMA 1QP8A 1K5PA 1XALA 2PO7A 1H65A 2AZ4A 4HN2A 5KMGA 4NATA 2HLDA 4O5AA 2VJNA 2WVGA 3ADOA 3CRMA 4AD8A 5FHQA 3ABIA 5K8UA 1VKZA 2RHGB 5B3AA 4Z1OA 1KS2A 3BT7A 2PH7A 4I5DA 3FUWA 1HM5A 3IEKA 4TMVA 2QD4A 1N2CB 2ZRNA 5DNAA 3A9RA 4Q3AA 3MSCA 3MMSA 1F8YA 1WPXA 2ORYA 1JLHA 2HQRA 4GGPA 4NH4A 4JMLA 1VBFA 4IGAA 3DOUA 1VJ0A 4OQXA 4WW0A 4OGKA 1G4HA 3TGPA 5E3HA 3AUSA 3L7KA 1N3LA 2HBQA 4OSPA 4AYXA 2EWWA 5JOQA 1J0BA 5CX1B 2VJMA 4IIYA 3G8BA 3ETDA 2VH1A 1NW4A 3PC8A 1QO0D 1U0RA 3H5OA 2W6QA 1YUBA 2IGBA 3L41A 1KIAA 1K88A 3D4NA 3W5BA 1MXHA 3JQDA 3KR2A 4HDMB 1W0JA 5DYWA 1OVMA 2WJHA 4YAGA 1TXGA 5EXTA 1KZHA 2PGLA 1BMFD 3TNYA 1ZNXA 2D00A 2CBZA 1AQNA 4EUEA 3S44A 2V7QA 2GKSA 2X2OA 3K32A 3LVRE 3GU3A 1C9EA 4L9AA 3BQNB 4LPSA 3VR6D 2XZLA 1JKIA 2J7KA 4W6QA 4RZUA 4TLBA 4XUCA 4M37A 4M0MA 1P2VA 1JHOA 1X14A 5ED4A 16PKA 2EAUA 2IYTA 3W0LB 1DWQA 4P34A 2G06A 1RU3A 4FI3F 4Y2HA 5J4KA 4ZDKA 3PICA 2ZG6A 4DCCA 3PNYA 2XTNA 1M8PA 3M4NA 2ZZKA 1E9AA 1IG0A 2VWGA 1V39A 1HYEA 3KDSE 4M2LA 2O8DA 3COPA 4FUQA 1TU4A 3DNMA 3IAM6 3D3KA 1XAHA 4K6OA 3TM4A 3CZMA 3BDVA 1J6UA 1BKYA 3N74A 1DTWB 3NGMA 5KKNB 5KX5A 3V8NA 2UZIR 3H1EA 1LRLA 2NGRA 2VPPA 3HFRA 2OUKA 2P2SA 2B8NA 3W6PA 2IYYA 3JTMA 1YBVA 4O0LA 4X7RA 2E2WA 4I1YA 1JBQA 2ODQA 3EAGA 3KSRA 1I2MA 5KNLA 3LS2A 4P53A 2GPTA 3DCJA 4J90A 4NEGA 4XI9A 1S8AA 3H9BA 2VNSA 2NADA 2ZJ8A 3BC1A 3R0IA 4H3VA 4LWQA 1P6QA 4PINA 3TXAA 3WLKX 4A6EA 2ZUTA 3U48A 2EGUA 2RHOA 4Y8VA 3WK5A 5FV4A 2NTYC 2GA8A 4GZ6A 2F8LA 5JAPA 1KOFA 1JH8A 4QUDA 1CE8A 5CM2Z 4D56A 4ZCTA 4ENUA 5HVNA 1T5LA 5G53C 1ODCA 3BREA 4FXPA 1V16B 2ZRCA 1X1DA 5SYNA 5AUPB 3KQYA 1G8AA 4KYUA 2EERA 1ZD4A 2VBCA 5DHPA 1N8TA 1D2NA 3JVUA 4AUEA 2OZVA 4U2FA 3SFTA 5KYGA 2RGEA 3AILA 3W4JA 1TTHA 4NP6A 4HGYA 4OHMA 3IUJA 5JNSA 1OWOA 2ZT7A 3EDYA 1OFIA 2FMKA 2ZIVB 4H3KB 1PE0A 3RRXA 4CKYA 4KNVA 3UWKA 3BULA 3UHFA 4C0LA 4TM8A 1CJCA 3OX4A 3QU5A 5FBHA 2A59A 6AT1A 2WT9A 2G1AA 1QUFA 2FCRA 2VT7A 4AW9A 3V34A 1EUYA 1TT5B 2QVZX 4M38A 1AD2A 1GRRA 2GJ4A 3U09A 1YE3A 1N75A 3HI6A 3CZ5A 3NHZA 4MS1B 2XCSB 3H4IA 4UAUA 2IP2A 4TXJA 1UBGA 4OK6A 5FTLA 4HH0A 5I8PA 1FZQA 1E60A 3GZNA 4KWIA 3IAXA 4EFNA 1I7DA 1OROA 1Y9ZA 3ZUPA 4KXFB 1EIZA 4YALA 4DG5A 2EGHA 5TVKA 3GT7A 1B8UA 1XE3A 2VEOA 2NUTA 3WR5A 4BBZA 1VPEA 4M0EA 3R0VA 2HA3A 3H6HA 3UC5A 4TMWA 3PR3A 5JYCA 2Z4RA 3FDFA 3ZI0A 3L7YA 5HDQA 2RARA 2IUUA 1M2HA 2OXTA 1ZJWA 5CK5A 1AE1A 3PIDA 2BR5A 4MV6A 4DCSA 3N2KA 4PN7A 1KFCB 2CJFA 3VTZA 1FJXA 5FUVA 3BRQA 2QT0A 2UDPA 2XGMA 1Q20A 2MINB 1Z4NA 1I2AA 3A3PA 4IG9A 1CSEE 4HXEB 1W76A 2QRZA 3P9ZA 3KKNA 1KMHA 1LFAA 2RH4A 3O8BA 4Y2VA 3HNPA 3IR7A 4UNRA 2OVFA 3DXYA 1DKUA 2GB4A 1K9VF 3SN6A 5GJVC 4CEIB 3B48A 3EGXB 3GQBA 2AMFA 4YN3A 4NKRA 1P7YA 2WP0A 3HJGA 3ZZTA 3CTPA 4D41A 3W2GA 5KHLB 4ZA2A 3RS2A 4ONEA 4Y2RA 1EZ1A 1R4MA 3GEBA 4FHCA 3J81A 5F3RA 1TMGE 5IM4F 4CCYB 4RTRA 2FQQA 4KR9A 2A0UA 2CDNA 3CH5A 3IMFA 2Z6UA 3MQFA 1T5BA 1UXKA 2C4UA 4WX2B 4R0VA 3RTAA 5HHTA 3DR5A 2R1VA 2PY6A 4MQ6A 4BQRA 3ABQB 2W6IA 2IP1A 2QVYX 2QLBA 3ABRB 3DMGA 4P86A 4W9NC 5JH7A 3F6RA 4TPKA 1AKVA 3ADBA 3K9GA 4AKHA 3O3MB 4Q3LA 1G5TA 1EFKA 4ZVMA 1AY0A 4JVMA 5AM4A 1J1IA 3TBFA 1RXIA 1BRTA 2VT3A 3OZRA 3W1EA 2Y0EA 3MGAA 4XWKA 2O3TA 2GXAA 2PCJA 3LT2A 4JNKA 4H0NA 4F46A 4AP5A 3VDQA 4G65A 4ILEA 5JMWA 3LL4A 4I4LA 2GASA 4FMBB 1B0ZA 2ZE8A 4HAIA 5CDSA 2SNIE 3ZI7A 1CIJA 1SHUX 2ODTX 4RETA 4DLUA 4WASA 2AQKA 1EAYA 3T06B 4G4JA 4XVCA 3K8QA 1E7RA 2IX9A 4K05A 4XIGS 1S4MA 1CTQA 3JPYA 4PC7A 5B1HA 1DRUA 3ZIUA 5HMLA 2GERA 1TCAA 2G8LA 1DCKA 3B78A 1AO3A 4JL5A 4GOMD 1T9GR 1YK1A 2KQUA 2WWIA 2XDAA 1U1CA 3V7YA 2YCBA 2I2AA 2QM8A 4J1TC 4AN4A 4BV2A 6REQB 3U7QB 5DX8A 3EBPA 2X7XA 5CK4A 5HF6A 3WGOA 1S3IA 5JALA 1O94C 1T3LA 3TZKA 4F9EA 5BMVA 5MN6A 1OZHA 4ZZ2A 1CZUA 2F67A 2QIOA 2GM9A 2VJCA 3LT5A 4BVGA 2Z3WA 1CY1A 2D0PB 3DLBA 3PUKA 3PQ2A 4XFJA 1I10A 2PR2A 5TF0A 4I4CA 1OA0A 1IMJA 5AVXA 3VR5A 4DM7A 3OZGA 1CY2A 3T41A 1ZXXA 4RHTA 2P27A 1SVLA 3PDIA 4WFKA 3VXKA 3VNUA 1RZUA 2IDMA 2VHYA 2XNSA 2G76A 2C07A 3D7SA 1SU4A 3EC2A 4HFRA 2DTDA 2IUFA 1XZAA 4KPFC 1FUYB 4HFMA 5KNBA 4UPVA 1QGAA 2VHEA 1E5LA 1VC2A 4JBXA 3BA1A 4AMYA 2AYXA 4BRZA 2G88A 3N9IA 3OZEA 4MVJP 4QPDA 3BJIC 4H60A 4U7FA 1BCSA 5JIBA 3JWJA 1YIAA 3CSSA 3T7AA 1VGVA 3GLFA 3SY8A 2IQ5A 2IF0A 2PKYX 3HB9A 1LBSA 1R3DA 2FXVA 4RYLA 4FEAA 1RZRA 1KEZA 2BEWA 2QTHA 4N12A 1V5GA 4L73A 4W5TA 4NXMB 4L72A 4MRRA 5BSUA 1UXGA 3JCZA 3LQRA 4IBOA 1IOZA 4ARCA 5GVRA 4HGOA 5G4KA 3X1ZA 2DTXA 4QFDA 1X1QA 1F4VA 4OATA 2GCGA 4Y0VA 3OAAA 5JCJD 1H94A 3ONWA 4D26A 2HT6A 3ISTA 3QUBA 3RRBA 3WGMA 4X3PA 1RCTE 3L8YA 4KLNA 5ECGC 3RUHA 4C4YA 4Z1MD 2R66A 4OL9A 3DOEA 4IR7A 4OB6A 3RR2A 4OXRA 1QP0A 1FX0A 3FPKA 1E4EB 1WE2A 4HX9A 4Y18A 2ECKA 3PNVA 1KJ9A 3EYAA 5GV8A 2X19A 1T26A 4YPOA 3E9DA 2PZJA 1Q17A 3NIDB 1J8QA 1P60A 2PUJA 2QMEA 4IDDA 4PRKA 4W1PA 5LDGA 2NU9A 2WTUA 4PQFA 2ONYA 3SYTA 2QQEA 2XXJA 4HDNA 4L07A 3D8HA 1A5TA 2FZWA 4LYHA 3ICVA 4ZGBA 2ZB8A 3MEQA 4KBGA 1GITA 4LQ4A 4OCZA 4QDZA 4V0LA 1OC4A 1ZIDA 4HF7A 2QPTA 4DEXA 1O9HA 1KC3A 2K7FA 1FSZA 2RG7A 4Z8XA 2HF9A 3WMEA 1N6LA 4NPAA 4TV8F 3LZDA 5BVHA 1Z4MA 4XSVA 4H59A 1P9NA 1PFGA 3CVWA 3L05A 4MLPA 4C78A 4JT4A 2R65A 1GUYA 3B7WA 4PGHA 2C57A 2DUNA 4WFQA 2VQSA 1DIBA 5JVDA 4OTZA 4PLGA 4CTMA 3CJRA 4AS1A 3I9V1 2XTJA 5BWMA 1F51E 2FQYA 3PHJA 1OPXA 2PZBA 3X2EA 3L4EA 1HZJA 1G2QA 1IOVA 1WXXA 2CMGA 1U2PA 1P31A 2I3DA 3F5DA 4IZIA 4OK5A 5HS6A 1UOEA 2H4ZA 5JC8A 2EATA 1SZDA 2HD4A 3A28A 3FCAA 1O5IA 3EGEA 4COKA 1OYYA 1WCWA 4EYGA 2H7YA 1VMIA 4OP1A 2XMRA 5TVGA 2JIMA 3O2NA 4IUCS 1K8RA 3VPAA 1CLUA 2I6XA 2JCBA 2W2LA 2PT6A 4Y6PA 3STHA 4B81A 4ZCIA 4BO9A 3PBKA 5LYJB 3R4CA 4RE6A 4WK2B 1U02A 1YRAA 2G6TA 1F9AA 3AEUB 3BRCA 5KAPA 3T3EA 4XD7D 5K8CA 2VN8A 4FZRA 4HHEA 1UMBA 1FFHA 2WB2A 2CVFA 2R86A 4QPCA 4MGKR 3TIVA 2YWCA 1MNAA 4DJAA 2R6JA 1W96A 2CCGA 2Q5HA 2ZUUA 3LLUA 3N3AC 2B0CA 4EFMA 3WGVA 1MVOA 2O5EA 2ID4A 5T3YA 4U2KA 1X1SA 1Z4KA 3L9WA 2PH3A 3IT3A 3MTAA 4WA8A 2KI5A 4MI1A 4L8YA 5IDVA 5SZHB 3CZCA 5DI3B 1A96A 2XBLA 4B71A 3KQMA 4BNJA 1DSSG 3DP7A 4O0MA 3SZOA 3GZJA 1MRNA 4R3WA 4BQPA 2IU3A 1U5CA 4XWAA 3VTFA 3GPLA 2BLNA 2ZR8A 3EXEB 5LJIA 4P0TA 1PD1A 3N75A 2Q6KA 2ZFUA 3P0FA 3BRWD 3NPMA 4QEKA 4DLRA 3MJTA 1G8SA 5B1IA 3E8SA 5I9NA 4HXGA 5AK6A 2PJRA 4KN5A 4X20B 3VNBA 4GP6A 4H77A 4RVDA 1NVVQ 1R9JA 1YE8A 3F46A 2VP2A 2A9KA 2OBNA 5DPMA 2H2AA 2CYCA 1JFFB 1BTOA 4M7RA 3EJ6A 5CVCA 4IDEA 2XWQA 5LA6F 2NQ2C 3EWIA 4PCUA 1FRNA 2AYZA 3DEAA 3QBTA 3T52A 2Q3JA 3PT5A 1MJHA 3WZLA 5KBYA 2H2GA 4AUNA 1N2JA 3Q12A 2Z1NA 3G0DA 3RNLA 5ES4B 1OLXB 4Y9SA 3KTAB 1ZZGA 2IXGA 3O31A 5EJMA 4TN1A 3ACBA 2L82A 2ZKIA 2XTZA 2Z0MA 4XJXA 8AT1A 3A1SA 4BLOA 4R8SA 1P4AA 4LXTA 1CEXA 3I72A 4PBRA 1EFPA 4GEKA 4E94A 1LX7A 2M32A 2DQZA 2ONKA 3TRIA 4IM7A 4B2YA 2WJJA 2V6IA 4YBZA 4RS4A 3EEFA 3KRTA 5ALYA 4F2PA 2X9GA 2YIDA 3LA8A 3DKVA 1MOQA 1M2VB 1GUFA 3MELA 3CX3A 1XTIA 5IFKA 1G4UR 2GH1A 4JBNA 4XQCA 4BGVA 4ZT2A 1RZ3A 3JYHA 5LQJA 4TZTA 5HUHA 1KJ8A 3O5AA 2P9HA 3R5HA 3M34A 4Q1DA 3R76A 1QDEA 3LPAA 4O25A 2VJDA 4BX0A 4LF8B 1CEQA 1E3WB 2PZ8A 4OB7A 4WKPA 2XYPA 2FCAA 3G0HA 3Q5DA 2G72A 4G25A 4XEHA 4EABA 3DZKA 4Q4HB 3U62A 5DM60 1E1MA 2L19A 2QF7A 1FYFA 1QIFA 4NONA 2I6TA 4FFOA 4IFBA 5FQNA 1SN7A 1MXFA 1WUIS 2WPDD 3D2LA 3MWEA 2YX1A 4JVLA 3BA6A 4NAHA 4YK7A 4DT1A 2H2IA 3EWNA 1U1IA 3OHPA 2XNDA 1WAMA 5HR5A 3B2QA 3EQ8A 3ZYCA 2KMLA 1BKDR 2MYPA 4TSFA 1C4OA 1QFJA 1QMPA 1V48A 4WOJA 1GN8A 4EVSA 3ZGXA 2NUBA 5F9FA 4JA0A 2X0KA 2ZIZA 2GR9A 3GGPA 2QMZA 3FI9A 3HDTA 3ICOA 1KSHA 2G9ZA 3UT6A 4CN9A 1JEYB 3I2JA 1MC1A 3LPMA 4J0FA 3G5MA 3RS3A 1PEKE 4U02A 1BE6A 3FRIA 3QJYA 2ZTSA 4DW8A 3PFIA 1YK0A 2QWXA 4QNNA 4XA8A 2JHCA 3HY6A 1TAQA 3KKKA 4UEJA 4YLYA 2BFCB 2F4VB 4KXUA 3ZR4B 3T1HB 4NCKA 3DAOA 4OHFA 4QEZA 3FOZA 3CKLA 4EECA 2D5BA 1NKSA 2FW7A 1ETHA 3VSAA 2VPYA 3DE2X 2NQTA 4FMCF 4EUNA 1I4TD 2QTRA 3HWX1 1X39A 2L17A 3FDZB 2CHUA 1ZCJA 3VU1A 3VC1A 5IU6A 5K0JA 2A9OA 3H2YA 2DHDA 2JHFA 3HDVA 3IFSA 3ZWYA 4DLLA 4EI8A 5IJ0B 1YFLA 3MWYW 3W6OA 4QXMA 2YUTA 3WIUA 3SVZA 3W8FA 1XLTC 2YWRA 2XLCA 4G9EA 3VYUB 3WGKA 5IUKC 4G5XA 4OJNA 5FX2A 1V8PA 1YZQA 4F4HA 4TYYA 1X2EA 5HK8A 3PHHA 1SUSA 2R7MA 1R88A 1O6FA 1XZCA 3KO8A 5JDCC 3UXMA 3EEOA 5DSXA 1FCJA 4B47A 3MLAA 3DVAA 4IDAA 4O4IA 5G0TA 4H1WA 2WFLA 1M6VA 2P30A 2CE2X 4XB2A 3VH4A 5A5DA 4NBUA 2FHPA 5E9JA 1KXZA 2FUG1 2RKOA 3OQOA 1AHIA 2YZMA 1V45