4QO7A

Lactate dehydrogenase a in complex with substituted 3-hydroxy-2-mercaptocyclohex-2-enone compound 7
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
331
structure length
331
Chain Sequence
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of substituted 3-hydroxy-2-mercaptocyclohex-2-enones as potent inhibitors of human lactate dehydrogenase.
pubmed doi rcsb
molecule keywords L-lactate dehydrogenase A chain
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Homo sapiens
total genus 114
structure length 331
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4qo7A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4qo7A02
1J6UA 2I6TA 5TJ9A 1R0LA 3JD4A 3OICA 1HLDA 2X0IA 1EDZA 2P91A 2FR1A 4WE3A 3RJ5A 1H6BA 2BLLA 4LVCA 1PGPA 4DIFA 1DJQA 2HMUA 1T4DA 4NFSA 3TF5A 4YAKA 1V6AA 3ROKA 1BVUA 2DM6A 4LK3A 4O59O 3JYNA 4QO8A 1PGNA 3OJLA 2VYND 5KWEA 4MDHA 3OH8A 1XCBA 3P2YA 3G79A 5TS3A 3DZHA 1FF9A 4UVHA 3ETDA 1DRWA 3GVIA 4EYEA 4NBUA 3ADPA 4FFPA 1L7EA 3I4CA 3PGXA 4WOKA 5BSEA 5KCZA 1PGQA 3VKVA 4CR7A 2QHXA 1MLDA 1IZ9A 3QRWA 2ZTVA 4L76A 4RDIA 4DQVA 2IODA 5JMPA 1T2FA 3E03A 3GH3A 3VZRA 4CM9D 4YAIA 3NTQA 5TC4A 3ZHZA 4JJFA 2VHWA 4XQGA 3ASVA 4G65A 2Y0CA 4E5PA 4ILKA 3MZ0A 1YB5A 3CH6A 3L6OO 3FNHA 4RLSA 5G4LA 5ICMA 4S1VA 4IJWA 3H9QA 5L45A 3K92A 4QXMA 3BTVA 3AK4A 2FR8A 4ZQGA 4I08A 3KYBA 1UDCA 4Z3DA 4J7CA 4OXNA 5H82A 4WLFA 3JQ6A 3ZWVA 2WD7A 1ZJZA 4CM3A 1UH5A 4BO5A 1KY4A 2O3RA 4BV9A 4GKVA 3I9OA 4DXHA 3M1AA 4RPLA 1RM5A 4PRLA 1DHTA 2IZZA 4XGIA 3UCFA 4NR0A 1O95A 4NBWA 4GKBA 5G0SA 3DBRA 1EFKA 3NX4A 1F8FA 4FJ1A 5G0WA 5THKA 4QX6A 2QZ9A 4JX8A 2EP7A 5AOVA 2FR0A 2YQ5A 4CLRB 5CPBA 3OMLA 4RORA 3DZIA 4PVDA 3H3FA 1JVBA 3X2EA 4B7UA 1GUZA 2J3JA 5HBRA 2HK8A 1SC6A 2PKRA 1NAHA 3NT5A 1PJSA 4EI2A 4AJNA 4W82A 3VDRA 3KLMX 2AE1A 4YACA 1X7HA 4NU6A 3ZWPA 2GO1A 2Y93A 3H6KA 5L3ZA 4R1NA 1GADO 2WE7A 4HFJA 3S2EA 2GPTA 1K3TA 1ZK3A 3DOOA 3MOGA 1JAXA 3M1LA 1DEHA 4I5FA 3HJAA 2OHXA 4PLCA 2VYVA 4YAGA 3B1JA 4J0FA 1C1XA 4NBTA 5TSDA 3D5TA 2B35A 5MGBA 1N9GB 3C1OA 3OJOA 3GPIA 3AUSA 4B4VA 2YYYA 4IMPA 4FC7A 4JJIA 1KY5A 4E5NA 5L51A 4FW8A 3W1VA 4LRTB 4MJLA 5H83A 4YT8A 3ZV6A 2PFGA 3FN4A 4WEOA 2F00A 3AM3A 1IYZA 3JD1A 4DPLA 2C07A 4J4HA 1B16A 4N54A 1M67A 1MXHA 4EW6A 1I2CA 3GEDA 4YA6A 4M54A 4QTZA 2B5VA 3O38A 4RF4A 5ILOA 3CEAA 2O7SA 2YV2A 4II3A 5C37A 3F5QA 1YB4A 2IYOA 3ZZNA 3FBTA 2HAEA 1Y1PA 1P77A 3N7UA 1DPGA 4PCVA 5DCUA 2Q2WA 2YHUA 1ML3A 3PLRA 4AJ1A 4II2A 2UAGA 3A1NA 1PQPA 2P5YA 1ZMOA 3RAJA 3JQ8B 4B4OA 1NTOA 3LQFA 5T5QA 3UW3A 9LDTA 1Q7CA 1DHRA 4XYEA 2FZEA 4MVJH 4WPGA 2FSSA 3I6QA 3GMDA 2D1YA 2X5JO 1HKUA 4XDYA 3DBLA 4UUPA 1E3LA 1BXKA 3C7AA 3E6AA 1RM3A 1V9LA 1P45A 5A4DA 1OZAA 2Q3EA 3VPFA 4WCDA 1QMGA 3I5MA 1LC0A 4BO8A 2O4CA 3AU8A 3RWBA 4R3WA 2WD8A 2NVWA 5C5IA 5JXWA 3WLFA 1QKIA 1XWFA 4FOSA 5HTOA 2QYTA 3PJFA 2EV9A 4YJFB 4AL4A 1X13A 5TT1A 1E3WB 2HJSA 4YT5A 3DFZA 2I3AA 2C20A 3K96A 4BHTA 1ZUD1 1Q0LA 5IN5A 3LU1A 1P1HA 2FWMX 3SXPA 1WP4A 3L9XA 3KYCB 1UZLA 2I5PO 4HFRA 1SPXA 4BO3A 1PJ4A 1EBFA 1O94A 3D1LA 4YTEA 4PLHA 2I65A 3K2EA 4PLVA 1N9GA 2C29D 2PD3A 2AG5A 2GZ3A 4RLHA 3DZFA 4R54A 1PJBA 1UXHA 1V3TA 5A9RA 5BR7A 2FOIA 3EC7A 1CRWG 1VKNA 4J4BA 1MV8A 3TZ6A 4F6LA 1ULUA 1BSVA 5JDCA 3HDHA 3H2ZA 1YKFA 4ALMA 3TDKA 2OZPA 3MTGA 3WXBA 1XR3A 2ZCVA 1JQBA 3DBHB 1GZ4A 4RPHA 1P1JA 4XWYA 4GGOA 4XRRA 4IDEA 5U9CA 2VHZA 4PRKA 3A9WA 4E5YA 3GGOA 2Z5LA 1KVTA 2VYNA 3ZWWA 4CMIB 4BNHA 4J49A 1F06A 3EVTA 4NH4A 4OKIA 3JSAA 3WFIA 4BO4A 4AFNA 4LRSB 5T6BA 1HRDA 2XXBA 2EJWA 3ZU4A 1JDJA 2JL1A 2G5CA 1DIRA 1K5HA 1SEVA 4HADA 3OHSX 4U6SA 1SAYA 1R12A 4FD3A 1GL3A 2ZJ0A 3KUXA 4W9NA 1YXMA 1WVGA 2G82A 1GV0A 4U7WA 5LC1A 4CQMA 3GEGA 3GNSA 3TRIA 2VWQA 3QQPA 3B20A 4XR9A 2HDHA 5AQ1A 3H5NA 1NPDA 3PWZA 1DXYA 4TRJA 5EN4A 1C0LA 3QJ5A 1NX6A 1HL3A 1I36A 3BHIA 2C59A 1UP6A 3L6EA 1LC3A 2JD0A 3PQFA 3QP9A 1NQOA 1A27A 2I3GA 3QWFA 4BNKA 1E3WA 5IDYA 4ZN6A 3TZHA 4B8ZA 4E2WA 1Z75A 1YRLA 2O23A 3LT4A 1LRJA 1LTHR 1GCUA 1PQWA 1Y5RA 2DLDA 1B8PA 4XR4A 4E2XA 3QA9A 5GZ3A 3CIFA 4P22A 2XF8A 4E0BA 3CPSA 4G5HA 4ZVVA 4LSMA 1R0SA 1OMOA 3ABIA 2VNAA 5CEJA 1ZK1A 1PEDA 3DONA 2NQ8A 3KB6A 3W8EA 1QV6A 2J5RA 4GX0A 3OJFA 5CDTA 3ADOA 3U3XA 1WDLA 1G0OA 4F6CA 4C7KA 4YRAA 5IXSA 3OQ1A 4IZIA 3X2FA 1LUAA 3L0DA 3TQHA 3ZWCA 3DHEA 1X0XA 4RVUA 3PYXA 2OORA 2Q2VA 2PK3A 5CHEA 1Z7BA 3MTJA 4E2ZA 5ICSA 1LNQA 5A04A 5I8ZA 2B69A 3V2GA 3ZU2A 3DQPA 4TROA 2H6EA 3VHRA 3LT2A 3PDJA 1I3MA 4CQLB 2Y0DA 1HEUA 3LYLA 4EITA 1A7KA 2DTEA 4FQ8A 3SEFA 1E6EA 1GEEA 2BH9A 2CVQA 4M8SA 2DKNA 4HFNA 1DC5A 1F14A 4Q3AA 4DIOA 2B83A 3E9NA 3H65A 4IQ8A 2C54A 2GF2A 1ISFA 4INAA 3B1FA 2EKLA 5CDUA 2GN9A 3D4OA 5EESA 1P31A 4MKZA 4GPD1 1G6KA 3PJEA 4FBGA 1H6CA 4CM1A 1KVUA 3KBOA 1FDSA 1ZW1A 4BNNA 1V35A 3BHMA 1EVIA 3FRJA 1BDMA 2W98A 5A02A 5HA5A 4GGPA 3F47A 3FPLA 1KIFA 2NQTA 2QX7A 1VL6A 3KXDA 1LI4A 3AY6A 3OA2A 4OH1A 1SO8A 4PFJA 2W2LA 3NTRA 4GLLA 4I9HA 5EMHA 1H2HA 4ZICA 2C0CA 4JGBA 1QR6A 3MCVA 2PH3A 4K9DA 3QVWA 4QFCA 4JN6B 4CJXA 5T64A 2GZ2A 4ALNA 2GDZA 2J3IA 3WNQA 5JPIA 1UUFA 3PJGA 5EINA 3F4LA 3QY9A 5FI5A 1JKJA 4BGIA 4UVGA 3AFMA 3KEQA 4FFOA 1PJ3A 1LSSA 3NAQA 5JY6A 2OBNA 3DDNA 4IGEA 1HYHA 4QT0A 1W8DA 2GSDA 2H63A 2IEDA 1H93A 4DWVA 4XYLA 2NTJA 3NGXA 3H9UA 2OO5A 3PDUA 5EERA 2ZJ1A 4E30A 2B37A 5A9SB 4DLAA 1AN9A 2NNLD 3I9LA 3U9LA 4MIEA 4W7IA 3G1TA 4AJHA 4J9UE 5FI3A 1YOVB 2X0JA 2Y0EA 1PWXA 3PVZA 3RIHA 3LLVA 5JS6A 1C1DA 4HNHA 1Y8QA 3HG7A 4PZDA 3EZLA 4FDAA 5EQDA 4FC6A 3BYZA 1EVZA 5F21A 5K0ZA 4LMPA 3Q11A 4ZGWA 5BNTA 2PKQO 1O5IA 4CQLA 1ZZEA 1T1SA 4MVJG 5CP8A 4FCCA 3UGKA 2IDZA 3PTZA 1QP8A 5KVQA 3LC1O 4OYRA 3OEYA 4YQYA 1ULSA 5B4TA 1LSUA 3WBFA 2ZYGA 2D5AA 3V2UA 4DYVA 4NFYA 1Z45A 5I7VA 3AOGA 3VPSA 4BNMA 2PLAA 4NG5A 1U7TA 2R6JA 1Y9EA 5FFFA 3I4FA 4XIJA 3QLJA 2EW2A 4H16A 1BHSA 4RF3A 3DHYA 1ZCJA 2H9IA 2VQ3A 1WMBA 1YDWA 2G0TA 3DAPA 5HWSA 4J1NA 1P3DA 3MJTA 4QEDA 1U3UA 3C7CB 2J3KA 4B7XA 3R3JA 3WGZA 4JP3A 2C5AA 3WYCA 2EKQA 3U49A 4XZ3A 4DC0A 1ZEJA 4AJIA 4RDHA 3AOEC 1HSZA 3ETGA 1L1FA 1ZSNA 2I66A 4J1QA 1I3LA 2BGLA 1DIAA 4IDFA 4DC1A 1A4UA 5L7WA 1O9BA 3L07A 2PA3A 4CMBA 3FTPA 2JFHA 1HTBA 3JYOA 3KETA 2OUIA 2D3TA 1I30A 3GN2A 3HN2A 3VPXA 2VUTA 2FZWA 4BNFA 4BQRA 3PLNA 2W2KA 1NVGA 4CM7A 3D3WA 3MWDB 1NM5A 1RKXA 3HFGA 3KOUA 3OIFA 5EPOA 1YOVA 4D3FA 4KUGA 1W4ZA 1LJ8A 2C2XA 4O6VA 1PZEA 5HM8A 1ONOA 2IXBA 3U5TA 5IZCC 4XIYA 1I33A 4WGGA 1JWBB 2IE0A 4BS9A 3WNVA 3GFGA 2CFCA 5GY7A 1MA0A 2DPGA 1EUCA 3BMQB 3DTTA 3WGTA 4YDRA 1K6IA 3GZ4A 3SJ7A 4JROA 1NYTA 3G0OA 1P9LA 1VKOA 3HWRA 3ZWBA 1QXSA 4EJMA 5DZSA 3CXRA 3IL2A 2QQ5A 3Q3CA 1ISIA 1E77A 4CMEA 2QW8A 1QYWA 2I67A 1IPEA 1DBVO 3EDMA 4I8XA 4QUKA 3RUEA 3WJAA 3EZYA 2AG8A 4PLFA 5KJFA 4IJKA 5A5FA 3Q0EA 1QYDA 1PJQA 4RVGA 5IG2A 1GUFA 4BV8A 1QYXA 1ZBQA 4IDGA 2NVUB 4QFDA 2CDAA 4AJLA 1SB9A 2ZB3A 3SJUA 2V7PA 4GLOA 2VHYA 3EUWA 2A94A 1HDRA 4BNJA 1Q0HA 2WWRA 2AW5A 4YVFA 5FEUA 4D3SA 3Q6IA 4J90A 3JQ9C 1D7OA 3NJ8A 3UCXA 1HE2A 1T2AA 2BFAA 2HO5A 3EGOA 3SC6A 1BXZA 1DC3A 4LCJA 2EHDA 2DPHA 1IB6A 3GRPA 1HWYA 1Q0QA 3B1KA 4ND5A 2AHRA 4GSLA 4PGFA 4U8GA 2AQIA 4RF2A 4GWKA 4CUKA 2BF7A 3PYLA 2YZ7A 5KJEA 3OETA 3OIGA 2I9PA 4IDDA 1DIBA 3M2PA 1WW8A 4IZHA 1YWGO 4PLYA 1ISMA 1ZXBA 4N18A 2GNAA 4PIVA 3NYWA 3TPCA 1EE9A 4FGSA 1DB3A 4L4RA 1VJ1A 4FJ0A 3UKOA 3PI7A 2PNFA 4IXTA 4I9NA 2J5QA 3G1UA 5ITWA 3VZQA 1A72A 3DHNA 5JDCC 3JQEA 1AHHA 3COSA 4IDBA 3PHJA 5KJ1A 1U28A 4YJHA 1GR0A 4YJGA 3I23A 4ZQBA 1EMDA 5C7IO 3K2BA 4IY1A 3JQGA 2NUAA 2VT3A 1GAEO 1FMCA 4R1UA 4BO2A 1ISJA 3BMNA 1E6WA 2OGUA 2DBQA 1R4NA 2E4AA 2CDCA 3UN1A 1E3SA 2JFFA 2D0IA 3QE3A 3JYQA 4XB1A 1LSJA 1A9ZA 3ZWAA 4LCEA 1ZK2A 4R5MA 4ZJUA 3T7EA 3UXYA 5JAIA 3ZNOA 2BHLA 4OXYA 4KQWA 3BA1A 3WIEA 2DUWA 3PFFA 1LX6A 3F1KA 4E5KA 2Q50A 4ZHSA 2RAFA 4NPCA 2EF1A 1S6YA 3WMXA 4IINA 4GAEA 5C7LO 2Y99A 2BI8A 2PV7A 3WLEA 2IZ0A 3F9IA 3GVHA 3HDJA 1FJHA 3JQCA 5DBFA 1R6DA 2JJYA 4FOOA 4Y8VA 4W6ZA 3TNLA 3PJDA 2GASA 2VOEA 4BNLA 3MJ4A 3GVCA 3PP8A 4J2HA 1OBFO 5JCJD 1N8KA 1XDWA 4B3IA 3TOZA 4K6FA 2EXXA 3M2TA 1JLLA 1H0KA 1XEAA 5AXAA 4HNGA 3IP1A 4MVJD 3HUDA 4CL3A 3DO5A 5U4QA 4KTVE 4J9VA 1R66A 1C0KA 4ITUA 4WLEA 4DMMA 3G49A 4BIIA 1ENPA 2O3QA 3K9QO 4I5GA 4TVOA 2BI7A 2J8ZA 4G2NA 1E7QA 2EGGA 1BG6A 1WLYA 4UULA 4DUPA 1N5DA 4KTTE 1T25A 4YWJA 5DBGA 3IAHA 3VVCA 1I0ZA 1HDOA 1XU7A 1KYQA 1O6ZA 2O50A 4IGFA 3M6IA 4CM6A 1NFQA 4Q3NA 3ZW8A 4YYZA 4JBGA 2Z1NA 3NJ4A 3AM4A 1WPQA 2YDXA 1U4SA 3GA0A 1JVSA 2EJVA 4WLVA 4ONEA 2CF5A 4R9RA 4OOFA 1Q7BA 3WQQA 1RJWA 2Y1FA 3WGQA 4OM8A 1PWZA 2J3HA 3BMOB 3W4IA 4CMHA 1E3JA 5KVVA 2GN8A 4GL4A 5G2OA 4J1TA 5TRTA 2VCYA 4FFNA 1ZSVA 1CYDA 1NQAO 3LDHA 2NV6A 5JAMA 4EUHA 1IL0A 3OFSA 4P4NA 1GQ2A 1U5CA 1B3RA 3VVBA 4E33A 2FHSA 1NPTO 4NJOA 4JNKA 4CMGA 1QLHA 2P9EA 2JCXA 4DVJA 1YBMA 3H3JA 3OF2A 3UH1A 5TJHA 4E6PA 3ZDFA 3HE3A 2ZK7A 2GYYA 1XU9A 3OECA 2WJPA 1NPYA 1QYVA 3TFOA 3DC2A 2FSVA 2AEMA 3S2GA 1BW9A 1EBUA 3KV3O 1AXEA 3JD2A 4AJ4A 3PEFA 3F6YA 1VSUA 1E3EA 1ZK0A 2YV3A 3ULKA 3OM9A 3RU9A 4BKOA 5H81A 3R3SA 1PS8A 4OQYA 4AICA 1ENOA 2ZATA 3QV1A 1PGOA 3E9QA 5EJ2A 5BSFA 3DAFA 3TJRA 4Q39A 4ALLA 3AOEA 1LBEA 4ID9A 5KIAA 6ADHA 3CINA 2CZCA 1DFIA 4NK5A 3QVTA 1Y8RB 3BIOA 4WLOA 1SOVA 1LA2A 3TFQA 1IHYA 3DMYA 1U4OA 4PLZA 3G3EA 1N2SA 3ZNNA 3RBZA 1I01A 4OGWA 3O03A 1DOHA 4UVDA 2C2YA 4B8WA 2EWMA 1UP4A 4N5NA 3H9EO 4R9SA 3RC9A 3DOCA 1TXGA 3GLQA 5COAA 4R3NA 3VC7A 3WTCA 2VN8A 4U5QA 1B26A 1NASA 1FXSA 3U62A 3C7DB 3GHYA 1ZXLA 1YL5A 5JMWA 4NJMB 1TLTA 4GWGA 1DFHA 3DZKA 3NDIA 4JLWA 4RL6A 5THQA 5IZCA 4D0RA 4CUZA 5IAAA 2O3SA 3NT2A 4D41A 5JFOA 4XYGA 1WNTA 2SCUA 3P5SA 3FWZA 3V2HA 5IXYA 5C3MA 4P4GA 3PQEA 1MXFA 2ZYAA 1GV1A 2B4RO 2X1HA 2NWQA 3GPDG 5L7YA 4Z0PA 3ZNQA 1XELA 2NU9A 4IIUA 1K2WA 4DA9A 4M49A 3ZI0A 1NBOA 3GFBA 3RI3A 4W4TA 3FWNA 4Y9DA 1KS9A 1B0AA 1NFFA 4N5LA 4JQCA 4CLRA 2Q2QA 2B36A 4PLGA 1LXCA 2TMGA 4ZA2A 3WGOA 1VJTA 4ZQEA 3E18A 1I8TA 4U0JA 4P8RA 2XPCA 2Y1DA 4E21A 1C0IA 3JQ9A 4M86A 4D44A 4CODB 4PG8A 1DRVA 2Y05A 3INGA 4NIMA 2DTXA 3I9JA 2GD1O 1LDEA 1XA0A 3ROQA 2RH4A 3DMTC 1DLJA 2WDZA 4UEKA 3F3SA 1W6UA 4KUHA 2YFQA 3AWDA 1HYGA 4IJUA 3PRJA 1YS4A 3FTNA 4RCVA 1VPDA 2Q1WA 3EY4A 2PGLA 3OQBA 3H9GA 5F1KA 1M2WA 1NHWA 1KC3A 3LZ6A 3TZQA 2CY0A 2WE8A 3ITDA 4AVYA 2PZKA 4J7UA 1GU7A 3F4BA 4D79A 3KLPX 5CAEA 4CLXA 2H1SA 5DNAA 1W0CA 3GUCA 4WLUA 3O26A 2OP0A 1WDMA 5DCWA 1X14A 2WYVA 3QIVA 4WCFB 3D4PA 4FFLA 5FF9A 4L75A 1ZIDA 3PHIA 1DRUA 4EJ0A 4ALIA 4NZ9A 1F0YA 1IHXA 3ETEA 3H9JA 1IY8A 4HP8A 1ZJYA 3V1TC 3WFJA 5A9TA 3IUPA 5K9ZA 2CVZA 4KOAA 5U1PA 3L9WA 1HE5A 3UHAA 3FNGA 3RC2A 2CMDA 4CM8B 1U3TA 2X4GA 3NDRA 2BD0A 1DLIA 4FSHA 3EMKA 1VJ0A 4RPKA 4XJTA 3DWFA 4PZEA 1N92A 5TQVA 5ES3A 1E3IA 3U4IA 3Q9UA 2YV1A 2PZJA 4CUJA 3BAZA 1EUDA 1YONA 3JQ8A 3ZWOA 1R4MB 2Q99A 4EZBA 1NVTA 1ARZA 5DN9A 3PYMA 3TL3A 1GYQA 3K6JA 3B6ZA 4NMHA 2A9FA 3TN7A 4CM9A 4OIMA 3E5RA 3UCEA 1SB8A 4CMEC 5JYEA 1VLLA 3RUFA 1J49A 4L73A 1Q2XA 1Z6ZA 3GQVA 1ZH8A 3G17A 4K26A 1CDOA 3FR8A 4R4JA 2I76A 3WMWA 3T7CA 3D3EA 1E1LA 5I7FA 5JBIA 5A3JA 4GVXA 1Z74A 3L4BA 1F12A 3JQAD 4NI5A 4YJFA 3RFXA 3UICA 4KMSA 4NFHA 4XQCA 1WWKA 2AMFA 2B4TO 2P5UA 3RFTA 1VRWA 1WZEA 3H5RA 3NTOA 5BT9A 2XOXA 5JLAA 4NK4A 4M89A 2PD4A 3JQ7B 4BNUA 4L4XA 4A73A 3ANLA 4IDCA 3VPGA 1PL8A 1KEVA 3KYCA 4BB5A 4H15A 3CMCO 5TF4A 4IQ0A 3WB9A 2OBYA 1AUPA 2JFGA 4UREA 4ROSA 4XA8A 2X5KO 2ZTLA 5HS6A 4YCAA 7ADHA 4BKRA 5I7EA 4BGEA 2HK9A 3C8MA 2X9GA 3ONEA 5JDIC 4E32A 3QVOA 3OA0A 1E92A 5IDXA 3MOIA 3LC7O 3H4VA 3FHLA 3GC6A 3EAGA 3KSUA 3P7MA 3DBHA 3IDSA 1PJTA 3QVSA 4ZQHA 1DAOA 4AJOA 5C7OO 4UUOA 3RASA 4ND2A 3JYPA 1HXHA 4XQ9A 1IUKA 4CMIA 1QG6A 3MJEA 4AG3A 1ADCA 2FP4A 3AUUA 1E7YA 1GPJA 4LISA 4RF5A 5F1OA 5JCXA 1BRMA 4LVUA 1ADGA 3AW9A 4RQUA 1E1MA 1M66A 1LEHA 4UAGA 3NDJA 2HU2A 3WSWA 5LCXA 1ENZA 1U2GA 4WECA 2HSDA 3BHJA 1R15A 4YEDA 5DF1A 4IM7A 3RBVA 2Q4BA 3IS3A 1X0VA 3I9MA 3HZZA 3QW2A 3GMSA 1E0DA 3BTSA 5T8KC 3I9NA 1I2ZA 2VTEA 1KEWA 1E7WA 3VH4A 1H9BA 3ZWNA 1MG5A 2AEFA 3NKLA 2GUGA 1B7GO 3FPCA 1J4AA 1E1NA 1AGNA 5CDYA 4DMLA 2GN4A 2J5KA 3ZV4A 4CMCA 4DIBA 4RVSA 3K31A 1EUZA 3D4NA 5ER6A 1BVRA 5GZ6A 5T67A 4RO0A 4ALJA 4BKUA 5I8WA 2BKAA 4FPXA 3UF0A 3IOYA 4KWIA 3CUKA 2Y1OA 4J6FA 1IPFA 1XQ6A 3C1AA 1NNUA 4BGVA 1BDBA 4BO6A 1GD1O 4FFMA 3ZU5A 2UUPA 3JQBC 3RROA 4YAJA 1NAIA 2WSBA 1YBAA 3NV9A 3JQAB 5DT9A 4BKQA 4XQEA 3WWZA 1T4BA 4DBZA 3KRTA 2RCYA 3AI2A 1KC1A 1HDGO 3MJVA 5A3VA 1H2BA 5JO0A 1TEHA 4IS3A 3BZUA 3GF4A 1T2EA 4CM4B 2VUSA 4Y6SA 4IIVA 3RBXA 5L4NA 4KP7A 4H7PA 2FY8A 3AY7A 1AXGA 3SX2A 4Y98A 5L9AA 1YB1A 3LSYA 3A4VA 1HZZA 1F17A 2O7QA 3K8ZA 3CSDA 2BFOA 2HMTA 4JXKA 1YO6A 3D7LA 5BNFA 3GAFA 1FDVA 1LDGA 3VTFA 2WTBA 4Y67A 4A03A 4E5MA 3QSGA 3GK3A 2XAAA 1NP3A 1UAYA 4BGUA 1NHGA 1PTJA 4KZPA 2HKIA 4OKNA 3S1LA 2JCYA 3TOXA 2FPGA 3AU9A 2UVDA 2GRAA 1VM6A 3WGIA 5DP1A 1PR9A 3KSDO 3KSZO 2OXIA 2X8LA 4E13A 2IEBA 1N1GA 1UXIA 4MKXA 5DDIP 1SBYA 3QWBA 3KYDB 4HUJA 4L9RA 1LDBA 1I24A 2BGMA 4NBRA 1UXJA 4XGNA 4XYBA 3RSHA 4PG5A 3IC5A 1WDKA 3I52A 1C0PA 3IKVA 1XHLA 4O1MA 5TX7A 1QLJA 4BNZA 1U2DA 1LQTA 2CVOA 3DMTA 1YVEI 3HHPA 1XYGA 4IXWA 4U0KA 1YJ8A 1FDWA 1PS0A 3DAGA 1EK5A 3UVEA 5KVSA 2X9VA 2E48A 3EHEA 4EUFA 2WM3A 2A4KA 1KVRA 3D64A 3STHA 4Q9NA 4R1TA 4K6CA 5DP2A 3IIEA 5HRUA 4HY3A 1ISHA 1B14A 1BMDA 1OAAA 2ZB4A 3I3OA 2X58A 3A28A 3GVXA 3BMCB 4GH5A 4PLPA 5A03A 4AJJA 5A05A 4J0EA 1AE1A 2X7HA 3E5MA 4MVJM 1GZ3A 3JQAA 2JD2A 1D1TA 1MFZA 1YQXA 3NEPX 1ZK4A 4YPOA 2AQHA 2VZ0A 1ENYA 1TVEA 4CR8A 4HV4A 5A9SA 3KEOA 2QG4A 4Q3DA 3FR7A 4WKGA 3ITKA 3ZWMA 4DBVO 2DTDA 3D0OA 4BNXA 1BTOA 2AQKA 4J1SA 4XGKA 2X23A 4HWKA 4YR9A 1QV7A 3H8VA 4ND3A 3E48A 2DAPA 4LW8A 5TNXA 4DRYA 2GCGA 4GBJA 5T57A 3TSCA 1G1AA 3CKYA 3IP3A 4XB2A 4AJ2A 5ER9A 1B15A 5G4KB 4BNWA 4ZRNA 1SMKA 1WZIA 4W7HA 3O9ZA 4J2OA 3VZSA 3LC2O 2CDBA 2DU8A 1R16A 3R6DA 1E7SA 4XDZA 2VUUA 2GR9A 3GGGA 4D43A 2FPIA 3ON5A 2O3JA 2ZTMA 1B8UA 3OJ0A 3VOSA 1N7GA 4RVDA 2BGKA 3BXXA 4A5OA 5L40A 4MP3A 4Z0TA 1NR1A 2X0NA 1NQ5A 1O8CA 4UEOA 3ZHYA 5KOIA 4KWHA 1JN0A 4BNTA 1U5AA 3GOHA 4BL5A 2WMDA 2UYYA 3GN1A 5JNLA 2EW8A 1M6WA 4G81A 1RYEA 4C7JA 5CG1A 3KHUA 4NU5A 2DVMA 4R41A 2X5OA 2UUOA 4RVHA 1GPDG 2PZLA 2BELA 1D3AA 2YHIB 1H94A 1HDYA 5COBA 2IXAA 3AI3A 1A9YA 3I83A 3VDQA 1H5QA 5LDHA 2B4QA 2VT2A 2VYVD 2YW9A 4QQRA 5B37A 4BO7A 4J16A 3SBOA 5A5EA 4YBZA 1PS9A 2LDXA 5IFLA 2CUKA 2OFPA 5L4LA 3NT4A 3SVTA 4CLOB 4DPMA 3ZU3A 3LVFO 2G1UA 3H7AA 4JJGA 4Z9XA 3RUHA 3W6ZA 3LT1A 2ZYDA 4O63O 4J91A 1VL0A 1X1TA 4LGVA 3EW7A 4EGFA 1LLDA 4LMRA 4MOWA 5JDIA 3N58A 4J4TA 4OHUA 3ICCA 2O3TA 7MDHA 4YRBA 1J0XO 1QSGA 2W4QA 5L7TA 3ZN2A 2JD1A 2RHCA 4YB8A 3V1YA 2GGSA 4IDAA 3BTUA 4QSMA 2JAHA 3PZRA 2H5LA 4CMAA 5I7SA 4B4WA 4D42A 1HF3A 1U8FO 2ZQZA 3WGGA 5IDQA 4UUMA 1OI7A 2HMVA 4RVFA 1KEUA 1WXDA 1VSVA 1MB4A 1V3VA 5GZ1A 3CZMA 3LLSA 4PLTA 4TKLA 4UVIA 1MC4A 1T26A 3RKUA 2D5CA 3BMQA 2Y1CA 1K6JA 1DIGA 4R01A 1MP0A 2OL4A 2Q1TA 1NVMB 4NQZA 3OEWA 1C14A 1JA9A 1PX0A 2AEJA 1HDXA 5G0UA 1PIWA 5L53A 4RJTA 3ZV5A 5T8KA 1CWUA 2D4AA 4BNVA 5B12A 2WD7B 3RU7A 2Z95A 2O2SA 4PG7A 2AE2A 1SZJG 2NVUA 3ONDA 3JQFA 4EUEA 5AXCA 4UVEA 1WMAA 1OC4A 2VWGA 2JHFA 2ZIZA 3KTDA 2PR2A 1Y6JA 2AA3A 3L4BC 1LDMA 2D2IA 1FDUA 3DBRB 4TRNA 4QO7A 2G76A 4RQTA 2VRCD 4Z9YA 1P74A 1I3NA 1PQUA 1UXGA 1HE4A 4XRGA 3SLKA 1LLUA 1PJLA 2YFHA 4WLNA 2CNBA 2HUNA 3GUYA 3S8MA 3JQBA 4CV0A 4I5DA 3HB4X 1NR7A 5BSHA 5ITVA 1QYCA 1VE9A 3A06A 3BTOA 3H2SA 4Q3BA 4PG6A 5LDGA 3PIDA 3PWSA 4AJPA 4OQZA 3CMMA 2CSUA 4J7XA 4W99A 1ZO8A 1E5LA 1J5PA 5BSGA 3U4DA 1KETA 4DLLA 4MINA 4WCFC 1UJMA 1Z7EA 1AHIA 2P9CA 3INRA 4GX1A 4PZCA 1C1XB 1GFSA 4I1IA 1I2BA 1JWAB 1GYRA 1RPNA 2NTVA 4TMFA 1LDYA 3PIIA 5EQFA 4TZTA 5B4UA 1Y7TA 4JIGA 4YRDA 3K5PA 5JC1A 1DFGA 3DZJA 3W6UA 4KQXA 4EJ6A 4DPKA 2GERA 3GG2A 4BOYA 1LLQA 3ZHBA 3ZWXA 3O8QB 5JAQA 1PJ2A 1TT7A 4CQMD 4DQUA 1ID1A 3GDOA 1MG0A 1YJQA 2R2GA 1BXGB 1CEQA 4WNIA 3WJ7A 1HETA 1MUUA 4CV2A 2TMDA 3PWKA 4BMNA 4JCOA 4OSOA 5B4VA 3PGJA 4J43A 5G0TA 8LDHA 3GDGA 3PHHA 4D7AA 2I99A 1UZMA 2X9NA 5ENVA 3I9KA 1P1RA 4MVJE 4TZKA 4MO2A 3LT0A 2G17A 5JW6A 1MFPA 5TT0A 4F45A 2POQX 2FMUA 3NUGA 3WS7A 4B79A 3Q9NA 2NM0A 4TWRA 3DBLB 3WQSB 1U3VA 1IZ0A 4RGBA 3RUIA 2EG9A 3IJPA 1K6XA 1R37A 1EQ2A 4MKRA 1SCUA 2DBRA 1DC4A 4NBVA 1BGVA 3PZBA 4PLWA 4CMKA 3GY0A 2HCTA 3C1TA 5KKCA 5ILGA 3TZCA 3PQDA 4CR6A 3MJSA 2IRWA 4Q3CA 5DOZA 1GY8A 1D8AA 2E6UX 2PH5A 4BO0A 4BNGA 2DUUA 4E3ZA 1U8XX 1JTVA 4E31A 4OO3A 2YJZA 2R00C 3WICA 4OL9A 4Q3EA 2VHXA 1QRRA 3Q2KA 3SLGA 5BQFA 4ND1A 1X7DA 1A5ZA 3LF1A 3E82A 1H6AA 1NWCA 2DT5A 3U0BA 4CPDA 1RM0A 4EEZA 2O48X 2XXJA 4HFMA 4WJZA 2J6IA 3BMOA 4YJDA 4X54A 3QWIA 1Y81A 1P0FA 4BVAA 1E7MA 4IJVA 1CJCA 2VZ8A 3O8QA 3V8BA 3UOGA 2X86A 1E5QA 2CF6A 4FR5A 3AUTA 2Y67A 3K30A 1BXGA 1HDCA 4ZQFA 3VH3A 3DEYX 3QHAA 1KBZA 4WNCA 1UXKA 3WX0A 4AJEA 2P4QA 3L6DA 2ZB7A 4OJNA 2DFVA 4L4SA 3JV7A 1KERA 4CLDA 1M6HA 4DREA 4GMFA 3T4XA 1S7CA 2Q1UA 1UDBA 3GZNB 3OIDA 1LSOA 2W2LD 4B3HA 5CDSA 1JU9A 3A14A 4CQMB 1VC2A 4R51A 2E49A 1JKIA 4Y6PA 3U09A 1MX3A 1P1IA 5KJ6A 3WWYA 5B1YA 1CQIA 1EE2A 4IS2A 5F5LA 1CERA 4YAEA 2NVBA 1ONNA 2F1KA 5DBIA 3I1JA 1Y8RA 3HB5X 5G0VA 1LDNA 4GVLA 5I9LA 1TI7A 3U4HA 1GUYA 5L4SA 3PHLA 1ZEMA 4JBHA 5A1TA 4XCVA 2D8AA 4O5OA 2DQ4A 5ENDA 4A10A 4BO1A 2C7VA 2DBVO 4UUNA 2IZ1A 5JCJA 4ND4A 4E12A 4KDFA 3VTZA 3Q1LA 2VRCA 3IMFA 3LK7A 1ZFNA 4CL8A 3DXFA 1LQUA 1ONPA 4MVJA 3FI9A 4PVCA 4RPGA 3UUWA 2PGJA 3GEMA 1YBVA 4NJMA 3GNTA 1HSOA 2PD6A 2QRLA 3JTMA 5JSFA 4JK3A 3RJ9A 3VAZA 2AQ8A 2PKQP 1PSDA 3PFWO 4F3YA 2QYSA 4FB5A 4Y6RA 3RUCA 1GEGA 3P19A 1YGYA 1ORRA 4IPTA 3IQDB 3ZW9A 3AM5A 3B70A 4DQXA 1UDAA 4GX5A 3F5SA 2QRKA 4XEHA 5KNLA 4J3FA 2E37A 3ANNA 3AFNA 1P1KA 4URFA 1ISGA 5KJCA 3HDQA 2V65A 1VL8A 3U4CA 4ALKA 4KUEA 2X0RA 3ZHXA 1T1RA 1YH3A 3P2OA 4PN3A 2PTGA 2VOJA 4KDEA 2NU8A 4YT4A 1KVQA 3SC4A 1HLPA 3VKUA 1W73A 3VPHA 2FN7A 2NLOA 1HT0A 4A2CA 4Z9FA 4DYDA 1Q7GA 1GDHA 3WGHA 3DZGA 3W4KA 1U9JA 1DDOA 3KM0A 3MEQA 3GZNA 5JO9A 2Y66A 3D5QA 1Z73A 1GZ6A 4A26A 4K1LA 2Q4EA 1N7HA 1MGOA 1PL6A 1ZVMA 3UAGA 3C85A 5I9MA 4JP2A 4JBIA 4DL9A 2AXQA 1YL7A 5K6AC 1GQQA 1RM4A 4CM5A 2DFDA 1HZJA 1EK6A 2VTDA 4D45A 1GTMA 5J23A 5CG2A 1B2LA 1YL6A 1A71A 4A0SA 2EGHA 4IBOA 3TL2A 1O0SA 4CV3A 2RH8A 4DGSA 4BMVA 2A92A 1I5RA 1ZSYA 3LF2A 1PU2A 2Q46A 3DZBA 1YQDA 4I5EA 3GRKA 3RD5A 1EDOA 2E82A 4D0SA 4WCFA 3HDYA 3RKRA 5TGDA 5DULA 2Q45A 4ZU3A 2C82A 2VZ9A 3HFSA 4RPJA 2P2SA 4BQPA 5DCYA 5DOVA 1XLTA 5GMOA 3CZRA 3WR5A 2EKPA 2RIRA 1GCOA 1UR5A 3DFUA 4BB6A 4CM8A 3WBBA 1TB4A 4FN4A 2HMSA 5CDGA 5JYDA 1CETA 2HRBA 4CLHA 1LRKA 3R1IA 3WOHA 5TLSA 3W8FA 2B0JA 4YT2A 1Y9AA 1R0KA 1RYDA 5EL0A 4TQGA 1R4MA 1PGJA 3VZPA 1C1DB 4IQGA 5JY1A 1ZMTA 1Y8QB 3HSKA 1P0CA 1CF2O 1D1SA 5F5NA 2CD9A 5A06A 3EK2A 4L74A 1ZKMA 1CIVA 1EQUA 3RCBA 3ICPA 2NU6A 4F46A 1V0JA 3FBGA 3F1LA 3WGYA 5KVCA 3RQSA 1YQGA 4XX0A 1FDTA 3NGLA 5JE8A 4MIOA 4C4OA 3WDSA 4IUYA 4BO9A 3JQFC 2EIHA 3OP4A 1UAGA 4M55A 3WTBA 2P4HX 1LU9A 1M75A 1YE3A 1ADBA 4MP6A 3QWAA 1QORA 4OMUA 3WG9A 1C3VA 1F8GA 3GG9A 3ZH2A 4HKTA 3ST7A 1IE3A 5TIIA 1X15A 4YXFA 3OJEA 4MVJF 2YQ4A 5KKAA 1M76A 3EYWA 3JQ7A 3RUDA 2V6GA 2BFMA 3MJCA 9LDBA 2HLPA 4MP8A 3C3XA 3HNPA 4H3VA 4AJKA 2RBEA 1EZ4A 4R5HA 1PJCA 3FSRA 3GDFA 4LN1A 1U3WA 1DC6A 1B8VA 2FPPA 4B7CA 3C24A 4MIYA 2R00A 4OSPA 4XD2A 3R0IA 1EEHA 2X6TA 1EVJA 1LLCA 3T4EA 3TWOA 1D4FA 3PXXA 2NACA 4D3DA 3OBBA 3PHGA 1PZHA 2DBZA 3L4SO 4YQZA 3E8XA 1U7HA 3FF4A 4A27A 4R68A 1I10A 1EVYA 2W90A 5IN4A 4FGWA 1UP7A 4OOEA 2OOSA 3FNEA 4MVJI 2RHRA 4ESOA 3S2IA 3JYLA 5AYVA 1JAYA 2W2KB 1IOLA 4LSWA 2ET6A 3D3WB 4U6QA 4RV9A 2Y68A 3RVDA 3RFVA 4ZRMA 4B3JA 1XKQA 3ASUA 2UV8A 3INTA 3GNQA 3DL2A 4RZIA 2PY6A 4DTIA 1YDEA 3UFXA 1Z82A 3JQDA 1LRLA 1OFGA 5L95A 3PPIA 2Y1GA 4XYMA 1PZGA 2IYPA 3GAZA 5IJZA 4Z6KA 2W8ZA 5IZ4A 2FRDA 4HBGA 4FFRA 1XSEA 4FS3A 3HADA 1T2DA 4M1QA 4EDFA 3VH1A 3ENNA 3O4RA 3TZKA 3GVPA 5AVOA 3ONFA 4PG4A 1PR3A 1TT5B 1P44A 4R1SA 2C5EA 1NFRA 3MWEB 1L7DA 1E6UA 3FD8A 1P1FA 1U1IA 2NSDA 1B3BA 3ANMA 3KO8A 2VNSA 4WEQA 3NRCA 3RC7A 3V1UA 3WYEA 2BRUA 2YY7A 1PZFA 5IF3A 1H9AA 3FNFA 2O2YA 1DAPA 1G0NA 2BMAA 2JHGA 3AY3A 3HN7A 1OOEA 3IJRA 5FWNA 4WASA 4HX5A 3AJRA 3I6IA 3GR6A 5CEEA 3ROPA 3JCZA 3W4JA 4R69A 2JKVA 1Y5MA 2NADA 1GYPA 4DLBA 2ZTUA 3DBVO 4FJ2A 5IDWA 1A4IA 2X22A 2NTNA 4RZHA 5HS4A 2HJRA 5KTKA 3DTYA 2V6MA 1HE3A 5EIOA 5COQA 3JD3A 4GI2A 3WIDA 5F1PA 3E1KA 1N1EA 4CM4A 4CLEA 1MC5A 2VRBA 1K89A 3S55A 1XGKA 2PZMA 2D59A 1EFLA 4P4LA 4O0LA 4WOJA 3ZNPA 3F46A 1CQJA 4WUVA 2HMWA 4NDNE 2GZ1A 1BWSA 2Z1MA 4R16A 4D46A 5CEFA 3AUAA 1X1EA 2EP5A 3K73O 1KVSA 1T24A 4EBFA 3GHHA 5AXDA 1A7AA 1K0UA 4YJGB 4YJHB 3W8DA 4I9UA 2BFPA 1T2CA 1KOLA 5JC8A 3CE6A 5ADHA 4TSKA 2B5WA 3JQGB 1E1KA 2HRZA 1RWBA 2QIOA 1DSSG 4NNJA 3N74A 2DC1A 3BMNB 4NHEA 1R4NB 2JAPA 1V8BA 3KYDA 4BNIA 2O3UA 1SOWA 4CV1A 3H5AA 3QVXA 1PL7A 2A35A 2PGDA 4OAQA 4TKMA 3RC1A 1ADFA 4GSKA 3WQRA 4B4UA 2YUTA 3ZGYA 1NQTA 1I3KA 1TT5A 3GGPA 3DOJA 4XKJA 4GQAA 2HQ1A 5K6AA 5F3RA 2VWPA 1TA4A 4IMRA 2VWHA 3WSVA 3OQ6A 2EEZA 1DO8A 2GLXA 3KVOA 4TRMA 2VHVA 3ENKA 4A7PA 3QWHA 2OP1A 5AXBA 5MDHA 1FK8A 2QZZA 4Z3KA 4M87A 2UDPA 1SNYA 4XJSA 3BMCA 3S2FA 4TRRA 4Z0HO 2HK7A 1VI2A 1WAMA 3ZWYA 4K28A 2ZCUA 2JCVA 3WYBA 3E9MA 2V6FA 3ZCXA 3IUSA 3JD0A 4ZD6A 1JKFA 4BMSA 1XQ1A 3HQ4O 1GQYA 2LDBA 3CTMA 1Q1NA 3DR3A 4P38A 2ILTA 1HYEA 5CPFA 4TVBA 5FYDA 2ZQYA 4CLOA 2YDYA 3Q2IA 1HDZA 4L0QA 2WEKA 2NU7A 3OSUA 2QRJA 1E7RA 1NWHA 4MVJP 1UZNA 3KZVA 1O89A 5G4KA 4MPDA 4E2YA 1V3UA 5I9NA 2OMEA 2Q49A 3FCOA 4BKPA 4BNYA 8ADHA 1XIVA 4WK6A 3L77A 1JW9B 3ORFA 2ZB8A 1H6DA 1P33A 4HXYA 3GT0A 2C7GA 3PK0A 2O4UX 4OXKA 4BUCA 4E4YA 3ZV3A 2P68A 1ZNQO 4CMJA 1KEPA 2ZKLA 1X7GA 4N7RA 4FIZA 2PWZA 1IULA 2EERA 4S3MA 1DIHA 1NXQA 2Y1EA 1I32A 5BNIA 4W9NC 1DJNA 3IKTA 4L8VA 2V6BA 4GX2A 3RUAA 4UEJA 1SEPA 3AI1A 2WYUA 2YHIA 2GN6A 6LDHA 1OC2A 3V5NA 4QECA 5JAZA 4EEXA 1BW9B 2WYWA 3DB2A 5CFZA 2P9GA 4N5MA 3VH2A 1XG5A 3ROMA 3EVNA 4GMGA 2Q1SA
chains in the Genus database with same CATH superfamily
4MR9A 4E4RA 1TK3A 1ZM3A 2I6TA 3MC1A 1M9NA 1Z2CA 1FMFA 1R0LA 2I8CA 3RS2A 4M9RA 5FJIA 4CEJB 2FSIA 1DE0A 4GE3A 1OZFA 1EFCA 1EVQA 1GGNA 1H6BA 3M0EA 4LVCA 2HMUA 1T4DA 3TF5A 1UM8A 3DR5A 1SBIA 2DM6A 4G8JA 3JYNA 5EIAA 4QO8A 3BB4A 1PGNA 1PKEA 3KD2A 5KWEA 2HSEA 3OH8A 4PO3X 5CD9A 3MCUA 5TS3A 3DZHA 1FF9A 1Z6GA 1UADA 4UVHA 3I3SR 1DRWA 4ZQCB 2IS1A 1T8TA 3FRHA 4OGLA 4NBUA 4G0NA 1UM9A 1I2AA 3I4CA 1QV9A 4LF9B 2E85A 3VKVA 1I1QB 4RDIA 1MLDA 2IYEA 5E7QA 2WQ7A 3E03A 2WR8A 3NHYA 5E3HA 3SWWA 4ZOBA 1TF5A 5BP7A 1QS0B 1LX7A 2X1LA 2W70A 4XQGA 5G53C 4ZZ0A 3VR6H 2Y0CA 4WESB 2RAVA 4UBMA 2AS0A 1RJFA 1OWOA 2EZTA 1EU1A 1YIDA 3AYXB 3I64A 4LTDA 4X8OA 2OENG 4ZEMA 4IJWA 5I7WA 1NE7A 4QXMA 3NTXA 2FWIA 2FR8A 1QTNA 1NF2A 2JFOA 3KYBA 4Z3DA 4EHJA 4KXVA 2B9VA 3QU4A 5DHAA 4YMVA 1JVNA 3JATB 1JJIA 1DQZA 1ZJZA 1YC2A 3L7AA 5LZ8A 4EVRA 1E89A 4GKVA 3UJCA 2BMJA 2J7PA 1QFMA 2FN9A 4O8ZA 3K4PA 1C9KA 1TFRA 2GTIA 4WXMA 1UBHS 3L5KA 3I04A 3UCFA 3K0CA 4JJ8A 5EE3A 5JTTA 3IEVA 3S4YA 5G0SA 3OZCA 1EFKA 3GCGA 1R4AA 4HAVA 3K70B 4C4RA 2VK4A 1XMXA 4NXMB 1R3UA 1IMOA 2FR0A 2NZ8A 2YQ5A 5CPBA 1CQWA 3KL2A 1G5QA 4CTJA 2B3DA 5EWMA 1NULA 3WHIA 821PA 3EASA 4XXHA 1WXEA 4D99A 1TTTA 2J3JA 4RH3A 2Q07A 2PG3A 1SC6A 4JEUA 4YHBA 1NAHA 5H3LA 1GQRA 4FWBA 1PUIA 3VDRA 4EI2A 5J4YA 1YFZA 5F1YA 3BGOS 3OZAA 4NU6A 4RTLA 1M7BA 1YJAA 3MFQA 3VSAA 2W0MA 5JG7A 3T1OA 1D5WA 1KARA 3C7TA 3S2EA 1GA6A 2Q9BA 2H7YA 3ZY3A 2I2CA 1E79A 1ETHA 2R8PA 5HCUA 4FZJA 3M1LA 3BZBA 1M2FA 3UENA 5CFPA 2VIIA 2J7KA 2A0KA 4EY6A 1TTHA 3HJAA 4I5FA 4OQPA 1HUQA 2LCQA 4L5CA 3B1JA 4OLBA 3A58B 1C1XA 2BKUA 2PANA 1EDDA 2D4HA 5IBQA 2PX4A 3CGWA 4YPVA 2JFVA 3GMIA 3ZPXA 1EVKA 1NSFA 3OJOA 5H59A 3GPIA 1MGPA 2BFNA 1Z2DA 2GZRA 3F96A 2YYYA 4FC7A 2UYQA 2FLKA 4FW8A 3W1VA 4XEUA 5A3QA 3NBXX 3ZCPA 1CUCA 3GFQA 3JQQA 1AO0A 3JPYA 1VHQA 2BZ0A 5B2FA 5GJBA 2YQZA 3L7LA 4JH0A 3ZV6A 4WEOA 2F00A 1IEVA 2C07A 3R5SA 1E9DA 1M67A 4EW6A 1GO2A 2BMVA 4H1VA 4RKEA 721PA 4X45A 4QTZA 2B5VA 2E1RA 5ALIA 3CEAA 4A2PA 1HE1C 2O0LA 3ER9A 1VCNA 3RTBA 4A8PA 4HVCA 1Y1PA 4HRXA 4JB3A 3ZE2B 1P2UA 1RHMA 2OG1A 3N7UA 4FM9A 2Q2WA 4AX8A 1OWMA 4PX9A 4BCCA 4WKOA 1KHTA 5AVZA 2FRDC 4ZKDA 2QZPA 1FFDA 5B7PA 1OT5A 4PZLA 3LVQE 3WK8A 1NTOA 2C8LA 2VEDA 5F3DA 4F06A 4OYHA 2F7SA 3H5OA 1Q7CA 3MT7A 4KITB 4MVJH 2FSSA 1DXOA 3V2IA 4LHEA 4UJ3A 5KNBD 3DBLA 1XROA 3OX1A 4Q02A 1Y48E 3C45A 2H1OA 1SHUX 2IU0A 1G55A 1RABA 3E6AA 3GV0A 3PITA 1MQSA 1RM3A 4H27A 4J0CA 2JH8A 1OZAA 1SUCA 2XOEA 4H6VA 3VPFA 4F12A 2QYHA 4G0MA 4ZIRB 3ZE8A 1WZNA 3QEKA 2J30A 3G9XA 1J42A 4RH1A 3AJEA 2WTMA 3WLFA 3ZW8A 4CT0A 1FRFS 1XWFA 2M32A 3ZCVA 2IY7A 1BE6A 4RHXA 1YJCA 3PJFA 1SCJA 2EV9A 4AL4A 2C4WA 1X13A 1YZQA 1X8LA 2UZ3A 2SKDA 3C3PA 5TT1A 5C80A 4YT5A 3TTTA 5HJEA 2C7OA 1U2EA 2I3AA 3IYLW 1Z0DA 1ZUD1 3OFND 4CF4A 3EODA 3U56A 1Q0LA 5IYZA 2I2XB 2V0CA 3HBFA 5HW0A 3NV7A 3SP1A 1P1HA 2ONCA 3WLHA 3DAHA 1PNOA 1CPYA 4JKIA 2EX4A 2ORED 2DGDA 5E4YA 4A2WA 3KYCB 1UZLA 1JS1X 2EKBA 2I5PO 4HFRA 1PJ4A 1GFWA 4JP5A 1OLOA 2NTEA 3CX8A 1UZUA 2C9DA 4GM4A 3AJ8A 1S3IA 2H2AA 4H3KB 2PN1A 3K2EA 3DWIA 4OHRA 3RSFA 3FCEA 5CM8B 1N8TA 1ZONA 1K97A 4GLJA 4WMLA 3A1EA 5AOCA 3VR3A 1PJBA 1UXHA 5J2TA 3G5AA 1QP4A 4MR8A 5BR7A 1GPAA 4J0JA 1CRWG 3E1GA 5FHRA 1MV8A 1JALA 1MAVA 2PJDA 2Q6OA 5JDCA 2QLJA 3TBKA 3H2ZA 2XBUA 8MHTA 1S5PA 2P3QA 4IUDS 3D6UA 4XGQA 1L7XA 3MTGA 4AS2A 3PENA 3U44A 4AF8A 2HSJA 1T35A 3OCCA 2I03A 4XWYA 3HJTA 1QNFA 1K98A 2NO5A 2W2XA 2QI9C 2VHZA 4Q4HB 5FXMA 4AN4A 1XT6A 4PRKA 1QDLB 3ZWWA 2Z5LA 4CF3A 1UFOA 3TR6A 4CEHA 1V8ZA 4PEVA 4DYHA 3HCRA 4EHNA 3IQIX 3S44A 4IFIA 2ORIA 4FMCB 4Z0NA 2Q3DA 4H1TA 4IMJB 4LXTA 1GAXA 4FE3A 1DIRA 4IHJA 5DTRA 4W5OA 4HADA 1YK1A 4QICA 1SAYA 4JKOA 3ZJ4A 3WNBA 1NN3A 1H3FA 1GL3A 1Y8AA 5F2NA 3LQRA 1TZ2A 2HZ7A 5M5BA 3ADCA 1WVGA 2Q3MA 1GV0A 1NGSA 1WY7A 4IYJA 4CQMA 3GEGA 3TEMA 5A4KA 3OC6A 1NP6A 3QQPA 1FTNA 2JRLA 5HF8A 5AQ1A 1J23A 2WYHA 4PHCA 1XZAA 1DXYA 5AK4A 2CLEB 1MAAA 4TRJA 5EN4A 1C0LA 3MUOA 4HDNA 1I2MA 1NX6A 2Y1XA 4PXAA 1KRHA 3P0FA 1QRTA 1GTRA 4YI3A 1BQEA 1I36A 4AJ9A 1UP6A 2YOHA 2VBFA 4RKYA 5ARDA 2X5NA 4CG0A 3DEAA 1OTXA 3CX7A 2VAVA 3F3YA 3PQFA 3QP9A 1NQOA 4GNKA 2NTYC 1A27A 4OU5A 2I3GA 3E05A 1PF7E 4TX1A 1U2TA 3W5HA 4L50A 1FS6A 4ZN6A 4MXDA 3U7JA 1Z07A 2VHCA 4EIWA 1L9XA 4E2WA 3FRIA 3AVPA 4TTTS 4RAQA 1RHJA 4LGMA 1LRJA 3C98A 3URKA 3QTLA 1B8PA 2HNKA 3AR2A 5J5AA 3EN0A 2HYDA 3HB0A 5GZ3A 2VPZA 3PNYA 4E0BA 4F7WA 1TIBA 4HEA6 4ZCIA 3VBEA 1IJBA 1MX9A 2WTNA 2A2ZA 3EEIA 4IICA 4KODA 4PBSA 3ZOZA 1UJ6A 5D5HA 5LQUA 1R0SA 2C1ZA 3BSFA 2BONA 3ABIA 4MYRA 1L5WA 4XUDA 3U9SA 4HYYA 2FWAA 3G02A 1C1HA 1QV6A 2J5RA 1L5KA 1G38A 4QODA 4FNGA 5K8TA 4OGFA 4BVGA 2EJCA 1G63A 3LQKA 2GB4A 4LGYA 4V0NA 4B6SA 3BF7A 4EW2A 2V7QD 3HO6A 2OPHA 3TQHA 3DHEA 4JP1A 1AB5A 1LNZA 4KPFC 1XZIA 2CW5A 4L85A 4LNUB 4BB0A 4CGZA 4NU8X 5ALHA 1LNQA 3FOCA 3KKZA 3RNLA 3KWMA 3MUEA 4L22A 2ISCA 2Z4TA 3ZU2A 4Q7JB 5J2UF 3KTAB 1L7MA 3PDJA 1I3MA 3RSLA 3ELYA 1L4GA 1JG7A 1TZBA 3LYLA 4ZOEA 2DTEA 3VYVA 4BIIA 4OI0A 2KE5A 4RU1A 4KXNA 1F4PA 3B8EA 3DPIA 1F14A 4BX0A 4KN5A 2G8NA 4MRVA 4DIOA 1DUIA 2A0UA 1NQVA 1ST2A 2DUMA 3FFTA 1K9SA 3Q7IA 1MA3A 2R8OA 2DPMA 3LECA 3QY0A 2Q1YA 3U19A 3B1FA 1YD7A 2ZRKA 4L27A 5CDUA 3I5AA 1JMYA 1MPXA 2IY9A 2CV1A 2C4KA 1GG8A 4C4TA 2ODWA 1NW3A 5FB3A 1X7XA 4DIUA 1X7ZA 4B5KA 3RVOA 1H6CA 1P4SA 2WJYA 3DH0A 2IIQA 2GVDC 2R5FA 1FDSA 2Q4TA 3OU2A 4MRRA 5DRYA 4GI5A 3PXCX 2HJWA 3L8EA 4C5CA 1JILA 3FRJA 5LUAA 2QT1A 3RABA 3QBVA 1KIFA 1IY9A 5EMLA 1VL6A 3GMTA 2LP4Y 1LI4A 3AY6A 4U6NA 5AVKA 3OA2A 4L72A 4OH1A 2CC2A 1GQFA 4IH9A 4PFJA 5ECGC 1B0PA 4B47A 1WUYA 4YRIA 5EMHA 8AT1A 3RT1A 2C0CA 4V3BA 1QR6A 3TX6A 3C3CA 3TD9A 3QVWA 3R40A 4JN6B 4DQLA 3KVNA 3OCZA 1A5AB 4KAXA 3HN6A 3KKQA 4RACA 5EINA 3RO7A 5BRJA 4UVGA 1N2CB 3KZMA 3X43A 3FWHA 3SGLA 1V96A 5ALKA 4BN0A 4DLUA 1LSSA 2FWJA 3NAQA 3O1IC 2OBNA 1IN8A 2VUHB 3DDNA 1OZGA 1HYHA 3KZCA 1AZLA 1QHNA 1JR3E 1V41E 2J9GA 3UO8B 4U7JA 2B5OA 2Z2IA 5I9IA 1H93A 2AGVA 4HAUA 4DWVA 4HNUA 3L7IA 4G0PA 4BYMA 5BW8A 5EERA 3TNDA 2B37A 2BGJA 4DLAA 1AN9A 4JUIA 4R8KA 2C84A 2WV9A 2VRNA 4MIEA 3G1TA 3U9LA 5GWXA 3G85A 1U65A 1DJMA 1CJVC 2ENWA 2Y0EA 2OV3A 5ITZA 1ISSA 4A6DA 4DABA 5FR2A 3IB3A 2HRRA 4UUBA 3KKMA 3CUVA 1XJWA 1RYBA 3I8OA 4HNHA 1C81A 4R1QA 3C87A 4ASUA 3OQHA 4FBMA 4PZDA 4EM6A 5K3OA 1DMSA 2O6HA 4HZUA 2MR5A 5K0ZA 1EEXB 1U1CA 3VPBA 4O4LF 1R0BA 1ZC4A 4LMPA 4Y6LA 3AKEA 1OYOA 5A4IS 3LVBA 4U7PB 3DT9A 1RKUA 4CQLA 4F6RA 5K0EA 4MLZA 3BFXA 2H65A 5JALA 1PBTA 4MVJG 5CP8A 3VTKA 2G70A 5AJZA 2FN4A 4EA6A 1HY3A 3U2QA 2FPIB 2IE8A 1A9TA 3LC1O 1UPAA 4FI3F 4QYTA 4XGRA 3A9VA 4YQYA 1M34A 1OFIA 4EQ6B 1LSUA 2OXEA 4FX2A 5JVDB 1R5OA 5CYFA 3WBFA 2ZYGA 3A4NA 4RTPA 1WA5A 5C51B 2QLMA 1O95C 1YNSA 1YS6A 3C3DA 4NFYA 3V2UA 1QTRA 4KYUA 3O1JC 5FTKA 4BNMA 3M7IA 1U7TA 3MS2A 3PR3A 1ZLYA 1V5FA 1T34A 3UK7A 2PVPA 3GLTA 5C3UA 2X0DA 4YUYA 3NS7A 3QBEA 5EFZA 1KDOA 3FPEA 1U1EA 3DGEC 1BNCA 2H9IA 3DHYA 1NG1A 5DEIA 4OLHA 2R7MA 4XUGB 5LZ7A 4AG5A 1WMBA 1R18A 1ZGCA 1JAHA 3DAPA 3GCXA 2WAMA 3MJTA 4G4SO 5JECA 7REQB 3C7CB 1C8BA 2J3KA 4BUZA 3TNFA 4QYXA 2OLEA 3S99A 5CNKA 2FW6A 3WGZA 4PZZA 3AIOA 1U0RA 1MX1A 2QORA 2WIAA 1D4AA 3BK1A 5ESDA 1GTZA 5B36A 1GT91 3DP9A 4NYJQ 4XZ3A 4DC0A 4H9GA 3T7KA 4RDHA 5F23A 1HSZA 4JEMA 4W8OA 4KR0A 4DXAA 3H7IA 5MFPA 1N5LA 2QK4A 4QGHA 4I1PA 1I3LA 1DIAA 2VSQA 1XTPA 4DC9A 1O9BA 5AJYA 3PC8C 1ZCZA 1PR6A 1UKEA 1V43A 2VHQA 1ATIA 2AI2A 3NIDB 2JFHA 4G5RA 1ABBA 1KZHA 4FGKA 3JYOA 3U1VA 3KETA 2HHHB 3KVVA 2D3TA 1I30A 2OUIA 4LTMA 4CNBA 2QTMA 4QDKA 1H1TA 1ZM2A 2QPOA 4JJKA 4ZJZA 3O0DA 5E0OA 9ABPA 2PLWA 2R68A 3LUKA 4WXEA 3E3AA 1QP0A 5FL7A 3V7UA 1PV2A 3OIFA 2LW7A 4M4SA 5EPOA 3HJCA 1WQ3A 5K3BA 1UDRA 4M9UA 3RLFA 4D3FA 1BU5A 1S1MA 4N49A 4CDNA 2I6UA 4BTEA 4O6VA 4RA9A 4YJ2F 3RYCB 2IXBA 3T7DA 3U5TA 2HDNB 2MJLA 2OHOA 4XIYA 4KSCA 3MD0A 1QC5A 1KIAA 3SSMA 4H0NA 3OE5A 4N47A 1MA0A 4ARIA 9ATCA 1EUCA 5LXTF 2O8FA 3HUTA 1U7ZA 1NYTA 4JROA 4MH0R 3SHVA 1Z0KA 4MWEA 4PWZA 5FPYA 3IL2A 4UFNA 1GPWB 1Y1QA 1SKUA 1X80A 3QUSA 4K87A 3BM5A 4HL6A 4C0LA 2X8AA 1LBSA 3Q3CA 2IF0A 4CMEA 3LBYA 4EFNA 1DBVO 1NW5A 4I8XA 4KQ6A 4QUKA 1LPBB 3WJAA 2WWTA 1Z4NA 4D9IA 1KJYA 1RI1A 3EZYA 3OTGA 2V7XA 2V8OA 3MWEA 4LYDA 5EIWA 4IJKA 2GK7A 4XVHA 3K8YA 1HLFA 3Q0EA 5E38A 5DISB 1QYDA 1R64A 4I99A 4TWAA 5D1HA 3SYRA 4D92A 1MH9A 4BV8A 5IG2A 2XTAA 1QYXA 3G23A 4G5YA 2WM2A 1FFXB 4AJLA 3A9CA 1SB9A 3SJUA 2V7PA 5FLYA 2FGKA 3HFRA 5H3HA 3ZW7A 2ACWA 2PAFA 2Q9UA 1NW4A 5GIPE 4YVFA 1QH8B 3TB4A 3JALA 1TMOA 1Y0BA 2X77A 4HB0A 2VPIA 4J90A 1D7OA 1AF7A 3NJ8A 4M53A 1ZMXA 1T2AA 2HO5A 3FB1A 3GXOA 5IAJA 5REQA 4ZVMA 2ZXFA 4HTAA 2OR3A 1SURA 1DC3A 3GLHE 3C16C 2J3DA 1IB6A 3IEKA 1HWYA 4CRWB 5IC6A 4PGFA 2C4HA 4R7ZA 4U8GA 2FN3A 2V7BA 5EHQA 2P1RA 2P40A 4TVKA 5DXJA 5CX4A 4MQUA 2AJLI 3OETA 3HKCA 2I9PA 2ANCA 4IDDA 1DIBA 1KI1A 4PYKA 2ZETA 3M2PA 3TM5A 3WYGA 3ZJTA 1YWGO 4HXFB 4LNHA 1KMHA 2FMFA 1PEYA 1MO5A 3PBKA 4GP9A 2WIFA 1XNGA 4K9SA 3WK7A 3ACDA 5LU8A 4EFKA 4PIVA 4LFBB 3FMVA 3KD3A 1EWRA 1AUVA 4Y2GA 4FGSA 4N3BA 4WBSA 5ALJA 4ISBA 1JU4A 3FVQA 1YMUA 1OTHA 3AFHA 3CYFA 3MRXA 3QXGA 1KFCB 3DDCA 4FJ0A 5JZSA 3GLIE 4IXTA 4B45A 4TOIA 5T41A 3LUAA 4G86A 2CWDA 4DJJA 4ENVA 4EB3A 3BILA 4NE7A 3R4VA 3IEUA 4AP9A 4EW3A 4RKQA 2NSHA 3NONA 3OCVA 3COSA 3STWA 2UKDA 5KJ1A 2YVLA 2GHQA 1GR0A 2G71A 3BCSA 4MPTA 4KOEC 3FUTA 2PL5A 1Y37A 3I23A 1IIRA 3QPVA 2W4IA 3DW3X 4B7AA 5C7IO 1SCAA 3K2BA 5CFLA 1F7UA 1D07A 1NKTA 2NUAA 2Z9BA 3BKWA 3IDAA 3OKPA 4K86A 4D97A 2C5LA 5K0LA 1XVLA 4N76A 1E6WA 1ZCAA 2OGUA 3KCQA 2CDCA 1RHKA 3UBMA 3G0IA 2DQZA 3P0HA 2EATA 3A9UA 1KYYA 4N41A 2QZSA 2ZBDA 4LEIA 4ZREA 2N1BA 3UGQA 2BC9A 4MGZR 4BC1A 4R5MA 3SQOA 3T7EA 4RXUA 2P27A 3BXGA 3ECCA 4G1MB 4BU1A 1E6MA 2BHLA 2OVBA 4OXYA 4KQWA 5F7XA 4GI7A 2X1VA 1CUAA 3AO0B 3EPPA 1PR4A 1JEJA 3N75A 1LX6A 1X8JA 3F1KA 4ZAXA 4ZYXA 3Q5GA 5JMTA 3Q15C 1TD9A 4X94A 1D2HA 2EF1A 2P9TA 3AVUA 1S6YA 4IINA 4HK4A 2PUCA 2Y99A 4BZXA 1M1YB 3KLBA 1QVWA 1XXHA 1AURA 1VSQA 2IZ0A 2J4CA 3F9IA 3NNSA 3OZEA 4OFBA 2JJYA 3LOQA 4FOOA 3FDXA 1THTA 4Y8VA 4CT5A 3O47A 6CHYA 5IWCA 2VOEA 3MJ4A 2XYRA 3KJZA 1OBFO 3D59A 3HB1A 4TWIA 3L0YA 4B3IA 4FOPA 1SCUB 4K6FA 4RY8A 4X91A 3Q88A 3QPCA 1H0KA 3GYGA 2VF7A 3PI6A 5AXAA 3IP1A 4CL3A 3HUDA 3NTLA 1JSRA 1R9GA 1XD2B 3DO5A 1MF7A 3DLAA 2PZ8A 2AD5A 1C0KA 4ITUA 3PGVA 2P62A 3IAM1 2OAEA 3CLUD 2NO9A 1VCMA 3GJYA 3K6KA 3K9QO 3NH6A 5LQAA 4TVOA 1B42A 2BI7A 1LBTA 2F6RA 1G3RA 4G2NA 1SKYE 2WUGA 1E7QA 4K6MA 3RHFA 4R8SA 1JBKA 3DJFA 1BG6A 1WLYA 4TTIA 4KTTE 1JPVA 3MCWA 1TM7E 2XZPA 1HDOA 4A8HA 1XU7A 1DX9A 4IGFA 4QHSA 3ZLUA 4BFXA 3A2MA 4L5AA 4O3MA 3AYZB 2XMGA 3NJ4A 3ZDRA 2YDXA 4W5NA 3ZKWA 1UC5B 4D9HA 1Q16A 3W78A 4X1YB 2EJVA 3A2KA 3QKTA 1T1GA 4WLVA 3EG9A 2CF5A 3IO5A 1CLUA 4R9RA 1Q7BA 1WABA 3WQQA 1X86B 4RMIA 2Y1FA 4CETA 2D2EA 3A1WA 2J3HA 4ZOLF 3T3GA 2YWCA 1E3JA 4MQEA 2FMKA 2XT0A 3S70A 5FPTA 2OCGA 1WCIA 2VCYA 4OAOA 4NC9A 3IESA 1NQAO 1Q95A 3ET4A 2WBLC 2NV6A 1SQGA 1NY5A 1NBMD 1TU4A 4KH1A 3RE1A 3WGMA 2D1TA 1DAGA 2F3QA 1U5CA 2G7ZA 3NKFA 4MQFA 1L5HA 3UT5A 5KPJA 5CBPA 3MF4A 3PUIA 1NVDA 2WJAA 4G9BA 1SA0B 3KE8A 1BE8A 3KEMA 5J4LA 1XEWY 4XSHA 2QGNA 5C31A 1QLHA 2VHEA 3PPVA 3OF2A 4NMMA 3ZTTA 3QU2A 4R8LA 3FROA 3NYRA 2P6MA 3FPSA 3HE3A 1T13A 4ZAYA 5I3ZA 1YCHA 3AV0B 3HU3A 1FP6A 3EGDB 5ES4B 2FF7A 1DQPA 5E1OA 5AM0A 1AXEA 2VJNA 1UFRA 3PEFA 1MT3A 5F2OA 1VSUA 2ONJA 4MV4A 4OAPA 1CB7A 1KJ9A 4WXHA 2UVPA 2RE8A 4V0LA 3RU9A 1RADA 2E4UA 1LFAA 4AICA 2J5BA 3HABA 1SKQA 4NH0A 2IHYA 4UM9D 4CEJA 4ALLA 1LBEA 4ID9A 5J5CA 3CINA 2CZCA 2VP9A 5IC4A 1J21A 4Q16A 2JFYA 3BIOA 2M9MA 4KXLA 4FEYA 3PC8A 4MUGA 1G20B 3SQDA 3TFQA 3DMYA 4EL0A 3PF8A 1K8ZB 3GPBA 1U4OA 4NOMA 3V7WA 4RDXA 5JBNA 3A3NA 4OX9B 4OPMA 3S40A 1X3LA 1HEYA 2DYKA 3A6PC 4KX5A 3OEHA 1JAIA 2PBRA 4OXRA 4XJVA 1FP4B 3RGGA 1W7AA 2A67A 5FA8A 2Q2NA 1BXRB 4PYMA 1SVKA 1UP4A 4P0QB 1OBCA 1W6RA 4WBNB 3KEGA 4TLCA 4B3MB 2PUHA 4KFTA 3RVJA 1DCKA 4ZAWA 5KNDD 4ZAZA 3GLQA 5COAA 3WMEA 1CF9A 3U1TA 4R3NA 3TGWA 3VC7A 3IALA 2WVAA 3WTCA 3ZHVA 1TYEB 1R3DA 2C3MA 4U5QA 5ALNA 4LDAA 5AW1A 1BAPA 4A1OA 3R5FA 4ZV9A 1YL5A 1QS0A 2YIJA 1DFHA 4GWGA 4RL6A 1L5ZA 5HG0A 2AOTB 5DK4A 4X84A 1SUPA 3VPAA 4WESA 3OTWA 1Y4SA 2EFJA 4HMOA 3HVHA 2B99A 4I7EA 2O3SA 5B30A 1E62A 2PGOA 3FYHA 3O4HA 3EA4A 3MW8A 5JFOA 3OCUA 1HZZC 2V74B 4XYGA 3P5SA 2YINC 2QS9A 2QLNA 3JATA 3LY7A 5IABA 5IXYA 3RAGA 1IEWA 4U00A 2XGJA 3GJ5A 3O8DA 1U0BB 2B4RO 4JASB 1M1XB 1ZY2A 1EA5A 5L7YA 3ZNQA 2WTXA 2OV4A 4FXPA 1ORDA 4BX2A 2HUPA 1BX0A 3PF9A 5AI5A 2WWGA 2ZUUA 3FMPB 3DMGA 4IDQA 5DWQA 2G1AA 1LV7A 3I92A 4P32A 4QOSA 3ZXXA 4KMRA 2IUFA 4E88A 4BE7B 4PC3A 1YVUA 2FZGA 2E5LB 1UBKS 5CLJA 1QIDA 2BFCA 4OV6B 4DLSA 3SG0A 3O74A 3TRJA 4DLXA 1UJBA 2BHRA 1OYYA 3B3AA 2YXBA 3WGOA 3QG1A 4HGZA 5IT0A 4QGSA 3KJGA 4U0JA 1G16A 4DHEA 4NX2A 1H1DA 4JLDA 4PG8A 4YLYA 2OLKA 1ZI9A 4C3UA 1Q19A 2DTXA 4F93B 4Z53A 2GD1O 1LDEA 1V25A 3DMTC 1T5BA 4NYMR 1JHQA 4FSDA 3H11B 4Z8XA 5ALQA 3TLJA 3F3SA 1W6UA 2FW7A 2FSHA 3LCRA 4KUHA 1MOQA 3R0JA 4RIHA 2OD2A 1PDVA 1EGVB 1DV1A 2WIJA 1UJ4A 1Z13A 3FTNA 1AUQA 3PRJA 3QIAA 1PFUA 4R2JA 4RCVA 5EHIA 3VV2A 5BUQA 4D25A 4RLFA 3W8NA 3A1FA 1L5RA 1IXKA 5F1KA 3AINA 3QEMA 1SU4A 1A97A 1KC3A 2PZKA 4J7UA 3F4BA 4D02A 5IC5A 5F78A 4D79A 1SZCA 4WNYA 1P17A 3EDYA 5CGZA 4CLXA 2FGJA 5DNAA 3HGTA 4X1OA 5DCLA 5EP1A 3T5DA 1X14A 1V6SA 4ISCA 3D4PA 1T9GR 2OAGA 1FYEA 4L75A 2IC5A 3ED5A 5PNTA 3KQMA 4NZ9A 1E0KA 1VHJA 1Q3HA 2ZB2A 2PS3A 1DAMA 2ZIXA 3L2OB 2QR5A 2JA1A 5LLSA 5AVJA 4PXSA 3HB7A 2QAGC 4HB2A 2ZBFA 2RI6A 1BN7A 4HBZA 4EGCB 3KS9A 1FFWA 3C3EA 1MRNA 3QF4B 3M3DA 3RC2A 2CMDA 2QNIA 4FIDA 2QTZA 3P2IA 1DLIA 2WUDA 3P9XA 1XN4A 3LUGA 1VJ0A 4RPKA 1M7GA 4PZEA 5ALPA 4EABA 4UPEA 5EIBD 2B7LA 1ZLXA 2Q0SA 2FXVA 1Z4KA 5ES3A 1C8LA 3Q9UA 2YV1A 2H0QA 1UJCA 2PZJA 3AVOA 3BAZA 5IAKA 1FLAA 2P69A 1R4MB 4EZBA 4FDUA 2WWHA 4I1RA 2XUZA 3EIQA 2SNIE 3DYIA 1GYQA 3K6JA 1ZYUA 3B6ZA 3TN7A 2QTCA 3AF0A 4YS6A 4CM9A 3L6UA 2OBLA 3RS5A 1UMBA 2HA2A 3I9FA 1KQFA 3O8OA 4OATA 1W25A 4N1AA 2NU6B 1J49A 2EL7A 3CLRC 4AMGA 1Q2XA 4BVBA 2H85A 3FCUB 2HA7A 1H4VB 1MD9A 3NP7A 4B83A 2YZGA 3COVA 4IRMA 4NXNB 2ZJYA 1YR7A 3FR8A 2I76A 4ZIRA 1JECA 1E98A 4B84A 5C5CA 3H18A 1VB5A 4RZ2A 1R5BA 4V0OA 5TPZD 5DWVA 1TQ2A 4AULA 2R60A 3L4BA 4PS0A 5TPWA 2C61A 1NJFA 3CJTA 3UH0A 2H7CA 4Q4JB 2FLVA 2J9ZB 3IPCA 4NFHA 4XQCA 5AOAA 5LMUB 2EL9A 2B4TO 2LXNA 1OVMA 1EP3B 1FCJA 3DV0B 4FSXA 4JYBA 4O2BB 4M46A 3KQPA 4MUAA 3T3PB 4ZO7A 1QO9A 3H1AA 2PD4A 2NO1A 4HYQA 3LYHA 4L4XA 5IX8A 3HJRA 1U6KA 4IDCA 4J16C 2AFHA 1DEAA 2D0OB 4H6WA 3KYCA 5I7SA 2ZWPA 4O4JF 1M8JA 5TF4A 1OYVA 1KO1A 2ETXA 3WB9A 3ZWQA 3ZUGA 2Y1WA 1KP9A 3E3OA 4K9NA 4KXXA 2H18A 2HA6A 1O5TA 5KWVA 2ZTLA 3IPRA 5J58A 4CU2A 4BKRA 5BV2P 4ZK6A 2IS4A 2GJ4A 4HDCA 1PT6A 3RJTA 5HPYB 2QM0A 3PNVA 4QUHA 3C8MA 4KAFA 1C50A 1OWPA 4AYTA 1RLJA 2J08A 3BICA 3DEJA 2ZRNA 3KDPA 4CHGA 4BFUA 1RBMA 3H4VA 1VG9B 4L0CA 1TNDA 2X7XA 1E4OA 3EAGA 3FHLA 1U2SA 4ZQHA 5C7OO 1A5SB 4EF4A 3I1YA 3AG5A 4E5SA 5I4IA 4Q4HA 3R8FA 2PMCA 1W0JA 1HXHA 4ILEA 2Q1SA 2W6JD 3NBUA 5BSTA 4JXZA 4F91B 1L7NA 3ZY4A 3AUUA 4DLRA 1E7YA 4KH0A 2QDKA 2WPDD 3PNPA 4FYIA 2FTKE 3IRUA 1BOFA 3UWOA 3UFXB 3VHQA 3Q3EA 4PZAA 3NYIA 4X9XA 1ZI8A 3VU9A 4IRUB 1XCLA 1ADGA 3AW9A 5HJ2A 1GLNA 4TL7A 3CZQA 4A6XA 3S1AB 1PQYA 3NDJA 4H7DA 2H59A 4K88A 4B34A 2WWIA 1ENZA 2M6SA 3EG5A 4WECA 4YP5A 1KK1A 4ZCRA 1YR6A 4NZNA 5HSGA 1A9RA 2XDWA 5DF1A 3T7TA 3CJRA 3EZGA 1XK7A 4JS0A 1PV1A 5SZHB 1FTGA 1BFUA 1I3CA 3HZZA 3IBCA 3V4OA 2EJTA 2RGGA 4EVSA 3FWKA 1XTRA 3GMSA 1E0DA 5T8KC 5THXA 4B17A 2ZSBA 4LV8B 2PKEA 2GHRA 5K4HA 2PJZA 1H9BA 2WSYB 3GJ7A 5DIFA 5BO5A 2QSYA 2GUGA 4HYEA 4KVZA 2HI0A 3JVVA 1E1NA 1J2YA 1L7PA 5CDYA 1MZPA 4LY0A 1CY2A 3K5WA 1LB1B 1ICEA 4CMCA 2J5KA 4DIBA 5I7UA 2QN6A 2JJ1D 3PRKE 3KAJA 2IVFA 4C78A 5HGJA 5DN6D 5BYAA 1BA2A 1GZ5A 5GZ6A 3W3AD 1O3YA 2JAQA 3KOXA 5FPHA 3UF0A 2EJUA 3OOJA 1BA3A 1KJNA 4J6FA 4HAYA 3AUJB 1U94A 4NLLA 4OMCA 3RVLA 2VBGA 4Y7CA 1ZL0A 3KHTA 2CJWB 2GQ0A 4FFMA 1UC9A 4P4TA 5ETJA 3ZU5A 2BDEA 1TC2A 1VMKA 3JQBC 5IKPA 1OH5A 4TN5A 1HV8A 3VI4B 3RROA 4V0ME 3F6SA 1NU6A 3NAGA 4E4TA 2NPIA 5DT9A 3LFHA 1FRZA 2VAPA 4JUCA 4RJJA 2JCGA 2X40A 4N39A 5BYJA 1UJ5A 1Z2EA 1LF0A 1J8QA 2GLUA 4FHGA 2B2NA 1T4BA 4TT3A 5EP3A 2G1PA 3IHTA 3P9KA 1NY6A 1PK7A 2RCYA 1FP2A 3WA7A 2QUZA 3AF6A 1U99A 1X2EA 1LVHA 1YRAA 2YRWA 2PL9A 4KO4S 3V4LA 5AUNB 4Z1MD 3IAS1 2Z2JA 1CIJA 1NMYA 1RCUA 3GF4A 2ZU6A 4GMDA 5CMLA 2FUG6 3GRZA 3RBXA 2Z2KA 5L4NA 2AX3A 2VHUA 5ECDA 3EZXA 3AY7A 3JTEA 3ZE9A 3SX2A 4Y98A 4B31A 1YB1A 3TQOA 1HZZA 1F17A 1DL5A 3K8ZA 4LYEA 2CXQA 3CSDA 1BDIA 2L2QA 4JXKA 5SYAA 3P9IA 4R31A 3KTAA 1UOOA 2DHQA 2VI5A 1LDGA 3G5MA 4P4UA 3U80A 2RHBA 2WTBA 4ZT6A 2QR3A 4J29A 1EGQA 1J9GA 2WIBA 1IUOA 2HQOA 2XAAA 1UAYA 1JHUA 4BGUA 1Y4ZA 3IH5A 3OPYB 4KZPA 5KOHA 2ZI6A 4JBNA 4FFWA 1JHYA 4Y18A 3P0EA 1VM6A 3PDIB 4TYNA 3AKDA 3CLSD 1V26A 3WGIA 5DP1A 2FMIA 1PR9A 1RI4A 3GFOA 4RTKA 1OBOA 1SC3A 3INNA 3ESDA 2X8LA 3GA7A 2IEBA 4QTXA 4WIAA 4I19A 3U3DA 1N1GA 1SIWA 2WAOA 4JL5A 1KQGA 4Z4IA 4HUJA 4N8SA 1YFKA 1OGIA 1LDBA 4KAAA 1I24A 1UXJA 3PTAA 1BDHA 3K0SA 1KNXA 1WE2A 3IC5A 4PG5A 4R8VA 1FP7A 4L57A 2XOKD 1KSJA 2X4LA 3OZXA 4HR7A 1M83A 3O4FA 5TX7A 3CUWA 4TTVA 2IH5A 2H4FA 3DMTA 4X93A 5GM1A 5LOVF 1VIMA 4EKEA 4IXWA 4KSBA 4B3RB 4CL2A 2HCBA 3N86A 3GP5A 2GI4A 3CURA 4WZZA 1YHZA 3UVEA 3OFJA 1ULBA 4G89A 2E48A 2W2MA 2NZUG 3A25A 4OB6A 1YA4A 5B1EA 1KAMA 1KVRA 4I4TF 1MVNA 4L5IA 4R1TA 5HRUA 1ISHA 1P4RA 4KCGA 3ZLBA 1X87A 4XCXA 4AWBA 1J70A 1IB0A 1SVOA 4QUJA 1N2CA 1NXTA 4KJXA 2WF8A 5JT1A 4MGHA 5C7LO 5A6SB 2P0EA 4AJJA 5LDDC 3HSSA 1LPOA 4L16A 5EIFA 3EPRA 1MX5A 5EXEA 4B33A 1SVWA 2AOUB 3SHTA 5HKBA 3O73A 4IOMA 2JD2A 2R96A 1MHPA 1ZK4A 3ASYA 1EFRD 2CYCA 3W6ZA 2QAGA 1LW7A 1NJ5A 4JLJA 2FA9A 4OHCA 3IEXA 3FR7A 2FX5A 3SZMA 2DTDA 3D0OA 1E0SA 2IEZA 4MKFA 3KL4A 1BTOA 2AQKA 4PICA 4XM1A 4ZCPA 4BNXA 2CHUA 1VLVA 4OP2A 3E48A 2IY8A 1GKLA 3A37A 1VA5A 2GD2A 3Q9SA 3VNQA 3G59A 4LW8A 1V8DA 4F5DA 4GBJA 2J6CA 2WSIA 3DOIA 1E1DA 1F51E 1G1AA 1X6VA 3N2ZB 1YQEA 3LHIA 3NHSA 4XB2A 4AJ2A 4BNWA 4RV4A 3B60A 4MS3B 1BOOA 1QTQA 4J2OA 4NECA 2Y0BA 3L1IA 3RIMA 4B0OA 2AEEA 2IOHA 1XTSA 5EZYB 1FPQA 1OQAA 4TLMB 1M3SA 3GGGA 1VE3A 1SVNA 2FPIA 4TV9F 4OLJA 5K0CA 1B8UA 3QE0A 4XQ0A 2P30A 2CNDA 3BXXA 4P9NA 4M1OA 5EZQA 4A5OA 5L40A 4Z0TA 4LXYA 1XZQA 4AY4A 1M0SA 5J59A 1D0VA 3CY6A 2Y6VA 3EAFA 5H5JA 2HR1A 1O8CA 4CCAA 2VP5A 3B5IA 1E1QD 1JN0A 3ROEA 4NWIA 4N0PA 1U5AA 2JFQA 3UQZA 4KK4A 2PA0A 5LUBA 2HWKA 5E9AA 3RV3A 2QF7A 3GJZA 3MD9A 2WF5A 1S8OA 3OUZA 2G6BA 3QA3E 1ISRA 3M4YA 4H1UA 2O1EA 1HI9A 3H42B 3SS9X 4C7JA 5CG1A 4NU5A 2EHJA 3TUIC 3LX5A 5DGHA 4J6EA 2UUOA 5JNUA 3AETB 1QE0A 2BELA 7REQA 2P4UA 3FWYA 2YHIB 4G85A 1KI2A 2OSBA 1BYUA 3ZHTA 3AI3A 1DUVG 5HOQA 1H5QA 2VDJA 1QZTA 2QA5A 2VT2A 3LGSA 4N03A 4NARA 2VYVD 2YW9A 1MVLA 2PNJA 2Q7OE 5HQ3B 2ORYA 4J16A 4U02A 3SBOA 4OJMX 1BWQA 2CYBA 2O0JA 4KO8A 3F3KA 1M1NB 1WIWA 3CSSA 4PCLA 5HEKA 2CUKA 2GCOA 1RPZA 5CH3A 3SVTA 3NT4A 1E5VA 1WQ4A 1X39A 1YQWA 4MK4A 3ETLA 3W90A 4PX2A 1I94B 1N2EA 3T9FA 4EPVA 4RVCA 4RIEA 3CBQA 3CE9A 1I2DA 3CF2A 3LT1A 4O63O 4ZO4A 1U0HC 3E84A 5KUTA 1X1TA 3MRSA 5CT8A 3CGGA 2QRMA 5JISA 3I5UA 4DA6A 2UYOA 3F8TA 5CRIA 1CY6A 2O3TA 1J0XO 2HFKA 2H7XA 3D7NA 4D9MA 3R24A 2B4YA 5ADWA 1Q91A 4M9SA 4DT1B 5LLTA 1ZN7A 3B12A 1G21A 3NTVA 3MGCA 2JAHA 2Q6VA 1R8QA 1R9MA 3AJAA 2UYGA 1H5UA 4JMPA 3C3MA 4ABYA 3RS3A 1ZQ1A 4JJ7A 2IXEA 3DKRA 2WU3A 1E2FA 3RYCA 2HMVA 1N2IA 3MG9A 5JEDA 2XVMA 1WXDA 3ZHQA 1VSVA 3J7TA 1TW2A 3HCCA 1FUEA 4HQFA 1V3VA 4IG9A 4PLTA 1WBDA