4QO8A

Lactate dehydrogenase a in complex with substituted 3-hydroxy-2-mercaptocyclohex-2-enone compound 104
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
331
structure length
331
Chain Sequence
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of substituted 3-hydroxy-2-mercaptocyclohex-2-enones as potent inhibitors of human lactate dehydrogenase.
pubmed doi rcsb
molecule keywords L-lactate dehydrogenase A chain
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Homo sapiens
total genus 119
structure length 331
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4qo8A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4qo8A02
1VSVA 1D4FA 2FY8A 2Q1SA 1E3IA 3HDJA 2JHFA 3O9ZA 3ZI0A 3EGOA 3CPSA 3FWNA 5EN4A 3RKRA 4A7PA 4DPMA 2VN8A 3QVSA 5KNLA 1EDZA 1H0KA 3UAGA 4XRGA 4KWHA 3KYBA 4OO3A 5I9LA 4LCJA 3IQDB 3V2HA 1RJWA 3Q9UA 1LSOA 5EQFA 1PEDA 2Z1NA 3SVTA 3ZHBA 3HE3A 3VZSA 4XR9A 1E3WB 2IXAA 3KETA 3JQ8A 4GVLA 3JYQA 1R4MA 5AXCA 3BTUA 3WYBA 4DXHA 2BFAA 2DTXA 3T7CA 4DPKA 3W4JA 4R1UA 4WEQA 1M2WA 4RVFA 2VRCA 4B3IA 2CVOA 5IDXA 4NMHA 4Y6SA 4XQEA 4EJ6A 3D1LA 2J3IA 4YJGA 1DFHA 1Y8RA 3HUDA 4R1TA 4TWRA 1K0UA 4CUZA 2BFOA 4LK3A 2F1KA 4GAEA 1MB4A 3BZUA 4IM7A 4BQRA 1GPDG 3F9IA 5FEUA 3V1YA 4JP3A 1F17A 1WDMA 5TF4A 5DBGA 3PJGA 4UVGA 2NWQA 4Q9NA 1HSZA 2X5JO 3K2EA 1J49A 2C20A 4UVEA 4RZIA 1JW9B 1BXZA 2VRBA 3W8EA 4YAGA 3NJ4A 1UP4A 5DF1A 1EUZA 4QQRA 1E7SA 4I5EA 4M8SA 4H15A 5EJ2A 3ZNQA 3GA0A 4J2HA 5CEJA 4R5HA 4IJKA 2GUGA 1XQ1A 1AGNA 1NPYA 3VDQA 3DMTA 1EMDA 1W0CA 3ANLA 2GZ1A 2WEKA 4OMUA 1ISHA 3MJSA 4BNJA 4HADA 2FP4A 3ETDA 3WFIA 3C3XA 5COAA 3L0DA 3GOHA 4P4NA 3HN7A 3CXRA 3C1OA 5GZ3A 3GG9A 2PA3A 1PJSA 4ND3A 1ONNA 2RH8A 3H9UA 4JXKA 1ORRA 3CUKA 3KLPX 4YAJA 4S3MA 2HK7A 3WBBA 5KIAA 4WCFC 4PLVA 1TVEA 3FN4A 4Q3DA 4E5KA 1EQ2A 2C07A 1VL0A 8LDHA 1DXYA 4I9HA 3W6UA 1Z73A 4C7KA 3H9EO 4CQMD 5KVCA 1Z6ZA 1U2DA 1XU9A 4CR8A 2FPGA 2Q46A 1O95A 1X0VA 3ETGA 2VCYA 3GN2A 4KP7A 5JW6A 4IXTA 3ROMA 3PYLA 2P9EA 2ZATA 3PK0A 3UGKA 4KOAA 2JD0A 2J5QA 1JAXA 4YAEA 1NASA 4EEZA 2VNAA 5AYVA 1N92A 5TQVA 1OBFO 1C1DB 2BI8A 3GMDA 5A9RA 1JLLA 2Z5LA 2NNLD 3JSAA 4FC7A 5KOIA 4R3WA 2Y68A 2AEMA 2UAGA 3WYCA 2X0IA 4J4HA 1EUDA 2VZ8A 3PDUA 3ZU3A 4IDDA 4TROA 1IHYA 4D0RA 3LT2A 1PU2A 3ADPA 3ZV3A 2EJWA 3NX4A 1Z82A 3ZWAA 4HFNA 4CLDA 4IQGA 1Y8QA 3HZZA 3K6JA 4GX2A 4C4OA 5TT0A 4RZHA 1LQUA 2HAEA 1X14A 3K31A 2AW5A 1J0XO 1U2GA 2WDZA 3WGHA 4HFMA 3P5SA 3L77A 1HDOA 2Y93A 2VYND 3R6DA 1K3TA 1BMDA 4L75A 3JQ7A 4Z0PA 5KJEA 2DTEA 3H65A 4UAGA 3OETA 4DUPA 2JFFA 3ZWCA 2IZZA 1PS9A 5JY1A 4PGFA 1DSSG 3D4NA 3D4PA 1P0CA 3ENKA 2OORA 2D5AA 3QSGA 1A4IA 4Z9FA 4XYMA 2JL1A 4JX8A 2IEBA 1E1NA 1CF2O 5KVSA 3ITKA 1NAHA 3GT0A 4K26A 4MIEA 4GKBA 2HU2A 4FFOA 5B4UA 2I65A 3TF5A 4L4RA 3IJPA 1VI2A 4B8ZA 1Y8QB 3DOOA 4WNIA 2O2YA 1K6JA 3EMKA 3DFZA 4R1SA 4YT2A 2DBRA 1J6UA 2Y66A 2RHCA 1DOHA 2EGHA 5KKAA 3VH1A 2FR0A 3ZWMA 5BNTA 1KEWA 3PYXA 1HRDA 4RPLA 2CFCA 5JFOA 5JY6A 1WZEA 1BSVA 3N7UA 4J90A 4EGFA 3SC6A 5KKCA 4NBWA 3FPLA 1UDCA 1ZMOA 5I7VA 4GSLA 4M86A 2I9PA 2QRKA 4ZRNA 3RD5A 1KC3A 3AW9A 3ZWOA 3BMQB 1O89A 1RM0A 4OXNA 4ZD6A 1JN0A 2PH3A 1ULUA 1UUFA 1SOWA 2DC1A 2JJYA 5L53A 2P68A 1ZSVA 3U4DA 1N5DA 3SJUA 1RKXA 2ILTA 5JAIA 3WX0A 1IY8A 4ALLA 2DVMA 1P1IA 5GY7A 4JJFA 2FWMX 4FFLA 2EXXA 3GUYA 3KEQA 4D44A 3WOHA 1DFGA 2E82A 4LSMA 2D8AA 1V3TA 3HHPA 3KZVA 1TA4A 2J3JA 4QFDA 4E4YA 4R1NA 1X7GA 1PIWA 2DM6A 2FMUA 4Y67A 3ZNNA 4AFNA 3AOEA 3ZWPA 2VUUA 1H9AA 4XGNA 3D3WA 2AMFA 4BUCA 3HJAA 1W4ZA 5BR7A 1E3EA 3NUGA 4W7IA 2ZYAA 4FFPA 4ZN6A 3I9JA 4JK3A 1XU7A 5H83A 2BHLA 3V5NA 3B70A 2OP1A 5F1OA 2CZCA 2FRDA 4BO5A 2WE8A 3INTA 3ZHYA 1L7EA 2ZB4A 1ZXBA 4P38A 1PR3A 1BXGA 4PRLA 2YDYA 4L0QA 1K2WA 5TRTA 3UVEA 1IE3A 3EK2A 4OQZA 2C82A 1T26A 4K6CA 4YR9A 4OKNA 5T5QA 1AXEA 2IE0A 3GGPA 1D8AA 3DDNA 5I8ZA 2X6TA 1R6DA 1ZNQO 1DC5A 1HT0A 3LVFO 3VH4A 1LA2A 1PGQA 5LDGA 1I3MA 4Q3EA 4IY1A 4Q39A 5A04A 4J1QA 4UEKA 1T2FA 2ET6A 4GWGA 4I8XA 2V6FA 1GZ4A 1HSOA 1NAIA 1ZJYA 3NAQA 4BNVA 1R4NB 1DPGA 2AE1A 4PG6A 4RPGA 3P2OA 2F00A 4RV9A 4FOOA 3MTGA 3MOGA 3R1IA 1T4DA 5IAAA 4BKQA 2G5CA 4KWIA 1ENOA 4DC0A 5I7EA 2P9CA 4K1LA 1VM6A 3KYCB 3F3SA 1B8PA 1K6IA 2PKRA 5AQ1A 2RBEA 3FNEA 3HDYA 4ND5A 3QA9A 4I5GA 4W7HA 1F0YA 4YCAA 4MP3A 4GPD1 1HETA 1V3UA 4A73A 5K6AC 1V3VA 3PJEA 4FFRA 4IIVA 4O0LA 3F4LA 1UH5A 4CQLB 4GMFA 4MVJG 4AJJA 4E5NA 2WYVA 1G1AA 1GV1A 3L6OO 1DDOA 5U4QA 3ZGYA 2AG8A 5TJ9A 4NDNE 4MVJE 4BNWA 5J23A 4NFYA 4UVHA 2O23A 5CDGA 4O63O 1KVRA 2HMVA 1GQ2A 4ESOA 4L73A 1H94A 1I2BA 4B4UA 3DZFA 3ZN2A 4RPKA 4PG4A 3OIFA 1NVTA 3FR8A 2XXJA 3I1JA 3DBRA 2IEDA 3R3SA 3A1NA 4XJTA 4Z6KA 4Z3KA 4WCDA 3UCXA 4MDHA 4NR0A 1U4SA 3F5QA 1HL3A 1LDEA 4XGKA 1XIVA 1GD1O 2ZB3A 1XYGA 1MC4A 4PCVA 2NLOA 3NGXA 3D5TA 4A03A 3HG7A 1ZK2A 1GADO 3WQQA 2Q1WA 3E9NA 3MEQA 4N5LA 1I0ZA 4II3A 1I2ZA 4HFJA 1M75A 4MKXA 4OL9A 4YAKA 1Y7TA 1V6AA 3ICPA 1NP3A 1PJ4A 3OIDA 5ER9A 3UN1A 5JYEA 3K5PA 3E48A 1LQTA 4Z0HO 1DBVO 1SB8A 4JIGA 3UKOA 3OHSX 1EEHA 1KEVA 4BNXA 1BW9B 2W2LD 4QUKA 5JSFA 2BGKA 2P4QA 4AJNA 4YJFA 3GZNB 4NIMA 4B4WA 2DAPA 3UXYA 3E18A 3ZWXA 3GVHA 5A9SB 4RO0A 3EC7A 3QWFA 2BF7A 1OFGA 4RPJA 2EIHA 5JO0A 1KC1A 2HRZA 2YHIA 2XF8A 3F1LA 1C1XA 1DRWA 4O1MA 4DBZA 2VYVA 3WMXA 1K6XA 2BFMA 1XWFA 2O4UX 4DMMA 5BSGA 2EJVA 3AUSA 4M89A 1I10A 4EJ0A 4EYEA 3ZNPA 1NR1A 3ETEA 3ONEA 5THKA 4OM8A 4WECA 3AOGA 3FPCA 4BOYA 4CMKA 5F1PA 3UCEA 3C7DB 2B83A 2X5KO 3TJRA 2WMDA 1P0FA 1HKUA 3IUSA 4R69A 4RVDA 3ONFA 5KJ1A 1PJQA 4CR6A 5IXSA 3JQGA 2GASA 4NBTA 3PIDA 2Q2QA 1PL8A 3DEYX 4XIJA 1NBOA 3WLEA 1NR7A 4CM6A 5K9ZA 1R15A 2PD4A 1H2BA 3C1AA 4WCFA 3WFJA 1NVGA 5A9TA 1PWZA 1E3JA 3OICA 3QQPA 2GRAA 4CL8A 1NWCA 4YVFA 3WTBA 3PJFA 4G81A 3OM9A 1WNTA 1DAOA 1HE4A 3RASA 1GYPA 4KMSA 4B3HA 2YQ5A 3DQPA 3PHLA 3TSCA 1CIVA 1OAAA 2O3TA 2X22A 3LLVA 4ZU3A 4E12A 1ISIA 4ZRMA 3AFNA 3KEOA 3LT4A 3ICCA 2NVUB 3ROKA 3BTOA 4YB8A 4J4TA 1SO8A 4BNYA 5JDIC 3HQ4O 1A72A 2UVDA 2PGJA 2JFGA 2DPGA 4E21A 1LU9A 3BAZA 2FOIA 3D4OA 3LSYA 3NDJA 4PIVA 3D0OA 4J9VA 1EVIA 4BIIA 2X9NA 4IZIA 3ZW9A 1T24A 4L4XA 4IS3A 4CV3A 3S8MA 3ONDA 3DZGA 4NBUA 1E6EA 4J0EA 5TLSA 1IZ9A 4GX1A 4NH4A 3PFWO 3WGZA 4DYVA 1U8FO 4CODB 1I24A 3RU7A 2OL4A 4JGBA 2NV6A 2P9GA 1ZBQA 4DQXA 2ZYDA 1B26A 1SNYA 4DA9A 2BGMA 4IQ0A 2GERA 4WEOA 3WBFA 3KRTA 4BKRA 3LU1A 1WMAA 4BMSA 1HDXA 4O5OA 2VWQA 3TPCA 5I8WA 1R0LA 1G6KA 2AHRA 3HSKA 3WGYA 4BO0A 2O4CA 1E7WA 4R16A 2CY0A 2EKPA 1UXHA 4UVDA 4W4TA 3H9JA 4YQZA 3TRIA 1IHXA 4GGOA 2PGLA 4EJMA 3NTQA 3I6QA 4RF3A 4AJEA 3RBXA 1NFRA 4NBVA 2J6IA 4RL6A 4Q3AA 2X9VA 5G0WA 1GEGA 4CPDA 1KETA 3QLJA 4J7XA 4XEHA 1PS8A 4N5MA 4DLAA 3PGXA 3M2PA 2NM0A 3GQVA 3GMSA 5DBIA 5JCJA 1AXGA 4PLGA 2NVWA 1ZH8A 4FJ0A 4H7PA 3GRPA 3ZU5A 1PQWA 1HXHA 1DC3A 3HFSA 3IS3A 3ABIA 1QV7A 3MZ0A 4UEJA 9LDBA 1HLDA 1PGOA 1UDAA 4JQCA 4CMCA 1P1JA 3RC2A 1YB4A 1YS4A 2OHXA 3KVOA 3CMCO 3H2ZA 4OGWA 4H3VA 4CLXA 3KYDA 4U0JA 3E6AA 2HMWA 4TKLA 1MP0A 4MVJI 3KBOA 4ZQHA 4PN3A 2GLXA 2BMAA 1WZIA 2ZIZA 3GH3A 4GLLA 4WGGA 1FDSA 3RROA 3EZLA 1U7TA 4Y8VA 4LGVA 1VJ0A 1UP7A 1ADBA 3ZNOA 4GL4A 2WD7A 4KZPA 1YONA 3PTZA 2RHRA 4BGUA 4R51A 3WWZA 1UAYA 5IXYA 1EK5A 4JBIA 1H6CA 1PJ3A 1BG6A 2VT2A 2GYYA 2Y0EA 4QO8A 4FW8A 5I9MA 1OI7A 4OOEA 3UHAA 5CEEA 3DBHA 3ASUA 1DIGA 2YQ4A 3WJ7A 2V7PA 3RJ5A 2VWPA 1EVZA 1Y9AA 5B4TA 4XZ3A 1B14A 4R9RA 1X7DA 2BELA 2O3RA 4YACA 2GSDA 4NJMA 1NTOA 1FXSA 3OEYA 5AXDA 2FN7A 3GNSA 4L76A 2Q2WA 1OC4A 3GFBA 4BO2A 3DTTA 3K30A 1GU7A 4Z0TA 3DAFA 2W90A 4GQAA 1ARZA 2CDCA 4BV9A 3HN2A 1DJQA 4ID9A 3EYWA 3H5AA 4IJVA 1ISFA 1MG0A 1PWXA 4TRJA 1ZO8A 4NQZA 1J4AA 3W1VA 5ILOA 4L8VA 2DBZA 4DIOA 5A3JA 2JAHA 3STHA 2B4RO 2FR1A 3WNQA 3CSDA 3H6KA 2CMDA 3ROPA 4TSKA 1PL6A 4I5FA 4JLWA 4EUHA 1GQQA 4UREA 5COBA 4BGVA 3VH2A 4KUEA 3AJRA 4CV0A 1FDWA 4XQ9A 3GAZA 3VZRA 2Y99A 4N18A 2EHDA 1Z75A 1R12A 3C7AA 1BTOA 1OOEA 5BSEA 3RUFA 3GK3A 1ID1A 1BGVA 3GVIA 3S2IA 1CRWG 3BHMA 3PQDA 5CDTA 5CFZA 3WQRA 6ADHA 3H4VA 3JQAA 3B1JA 1BHSA 1I30A 2IZ1A 3C85A 3KOUA 1IL0A 1TB4A 4MO2A 2GN8A 2VHWA 3JQ9C 5I9NA 1Q7BA 2FHSA 2YV1A 2YV2A 4HBGA 2VHVA 4P22A 1XR3A 2CDAA 1X15A 2OO5A 4O59O 2Q4BA 4WKGA 5A5FA 3LC2O 3DXFA 4PLWA 4F3YA 5KCZA 1HE2A 2JD1A 1A71A 3OA2A 5LC1A 3KXDA 1DFIA 4CM7A 3DO5A 1Y1PA 5HRUA 5ITWA 3WR5A 2OP0A 1E6WA 3JQ6A 4PLHA 1LJ8A 2E48A 2HJSA 4RCVA 1LSJA 1LLDA 3QP9A 4LRTB 5DP2A 5L7TA 3JQ8B 1NM5A 1R4MB 3T4XA 2G76A 1HE3A 2DQ4A 1L7DA 1IPFA 1UXGA 2FPIA 3K9QO 1JWBB 1JWAB 4XDYA 1U3UA 3FCOA 5K6AA 4TMFA 4XD2A 3WGQA 2OOSA 3TL2A 2YY7A 3FI9A 1P33A 2YFQA 2VOJA 4NK5A 3I5MA 2EERA 3COSA 3I4CA 1LLUA 3LLSA 2OZPA 4YJGB 4BO1A 4FB5A 4XYBA 1Y8RB 2FZEA 4GGPA 4D79A 3I9OA 3AK4A 4ND4A 1ENYA 3VKUA 2D1YA 4RORA 4E0BA 1XHLA 1D7OA 1HF3A 3C1TA 1SOVA 2AE2A 3K96A 4I5DA 1XQ6A 1C0IA 4EUEA 1BWSA 2YFHA 3AUUA 5T67A 2ZB7A 3WYEA 3S2GA 3ZH2A 1MV8A 4FSHA 3TZCA 4IGFA 2ZJ1A 3GEDA 4ZVVA 5DOZA 4JP2A 1C0LA 1IB6A 4CLOA 3FNHA 3TFQA 1D1TA 1KERA 4WK6A 1YQDA 3PLRA 4AJ1A 2VHXA 3B1KA 1P1FA 2SCUA 2QG4A 4RVGA 3EW7A 1SBYA 4D45A 3WGGA 5A05A 1EDOA 4CMEC 1PQUA 3DAGA 3GPDG 4J1SA 1PR9A 5TNXA 2Q45A 1KS9A 5L40A 2X4GA 3O8QA 3IP1A 2C0CA 5B12A 4QT0A 3IMFA 2EW8A 2NTVA 2PGDA 4KDFA 1FDVA 1AN9A 4D41A 3E9MA 4MVJA 2QW8A 1GEEA 3IJRA 4BV8A 3RBVA 1JKFA 4AG3A 3GY0A 1ZK4A 4DMLA 3ANMA 1P44A 1I01A 3GHHA 3NKLA 3M2TA 5JDCC 2QYTA 5TJHA 2BLLA 4BNZA 1HE5A 1ENZA 1TT5A 3CH6A 1RM3A 4Q3CA 4J2OA 4GWKA 1F06A 5C7OO 2Q3EA 2AEFA 1RM4A 5L4LA 2H6EA 1PGPA 1YWGO 2O3JA 4TRRA 3JYOA 4KUHA 1LRJA 2O7QA 1HYHA 1VRWA 3W8FA 3AM3A 4FGWA 4XYLA 1CERA 1B16A 2JKVA 3NTRA 3PGJA 4IDGA 5TC4A 1YL7A 4CM4A 4CMIA 2I3AA 3NT2A 1B0AA 5ICSA 2Y67A 4ILKA 1MG5A 3DZJA 1DRUA 4BKUA 2PNFA 1R0KA 2UUOA 5DBFA 2A92A 2QZZA 5IF3A 4PG7A 4CM9D 1NQOA 1XDWA 2BI7A 3L6EA 2JFHA 3B1FA 1KY4A 3RKUA 3WICA 1EFKA 4S1VA 1P74A 2Z95A 2A9FA 3H9GA 3NDIA 5JDIA 3V8BA 1PGJA 3VH3A 1NVMB 1P1RA 2I5PO 1FDUA 1Y6JA 3EDMA 1ZW1A 1ZEJA 1ZIDA 2PWZA 4D3DA 1E1KA 3U62A 3I9NA 2PFGA 3WWYA 3GVCA 1DHRA 3AU9A 3JQ7B 5EINA 5A02A 3EVTA 1HDGO 1OZAA 3SBOA 3RFXA 1CYDA 2ZKLA 4M49A 4PFJA 4BO4A 4YT4A 1SCUA 3NT4A 4LRSB 5A03A 5T6BA 3U5TA 3PHIA 2CD9A 3W8DA 3U4CA 2Y0DA 2Q50A 4E6PA 4DWVA 4GLOA 5K0ZA 4BGIA 2C7VA 4HY3A 2VOEA 2GZ2A 5MGBA 4W99A 1E7MA 2QHXA 1CJCA 2TMGA 2R6JA 4I9NA 1XCBA 3JD2A 3PHHA 2I3GA 3LDHA 3WJAA 3WS7A 4NU5A 4BO3A 1YL5A 4MP8A 4DLBA 5JAMA 1E3LA 3TZHA 1M76A 3TOZA 2YZ7A 3BMNA 1JVBA 5CG2A 3EUWA 3DBLA 4OAQA 2XXBA 3H8VA 1YBVA 4ALIA 1PJBA 2C7GA 3LT0A 5L4NA 2X8LA 3DC2A 4CLRA 4PG5A 1VL6A 3MOIA 1DHTA 4BNIA 4J4BA 3CIFA 1Q7CA 5CP8A 3PHJA 3AI3A 4KDEA 4E2XA 1GTMA 2IYOA 3AI2A 3OSUA 3QJ5A 3D64A 1U5AA 2X86A 2E49A 3MWDB 4NI5A 4I1IA 4XYEA 3KM0A 2HMTA 1H9BA 4QXMA 1DO8A 4X54A 3ZZNA 4HV4A 2I76A 5L51A 3TFOA 4B3JA 4QX6A 5L7YA 1ML3A 5JBIA 4J9UE 4CMJA 4G5HA 2B5WA 3VKVA 2ZTLA 4ROSA 3RUAA 3QY9A 3I52A 4DQVA 4KTVE 2GPTA 3D3WB 3WGOA 1H6AA 2DU8A 1DC4A 2OFPA 4MKZA 4B7XA 3K73O 4IINA 3CZRA 1B7GO 3CTMA 4BNMA 3GNQA 5BT9A 3DHEA 2RH4A 3QVXA 1PJ2A 4ZQBA 1ADCA 3RUDA 2EGGA 3OH8A 1UZMA 1MFPA 1JKIA 3RFVA 1BXGB 2X1HA 3ST7A 5DOVA 2EV9A 3TL3A 3KSZO 5FI3A 3ZHZA 4M87A 3PWKA 3INRA 4AVYA 4DIBA 3H9QA 5FFFA 5JS6A 4GVXA 5JCXA 1MUUA 4FOSA 2VRCD 3RC1A 3JD1A 4A27A 2X0RA 1H6BA 3PZRA 4RVSA 1DB3A 1GYQA 1U3TA 4R54A 5EERA 3FNGA 1HDCA 4P4GA 3JV7A 3LYLA 4BNLA 1UXKA 5TX7A 5CDSA 2I99A 5L4SA 4KQXA 3VPXA 1ZMTA 1PQPA 4ZA2A 3WGIA 1E0DA 3I23A 3I3OA 2C29D 1QKIA 2NQ8A 4Y6PA 4UEOA 4GX5A 1N1GA 3GN1A 1NQ5A 4E3ZA 1WPQA 4K9DA 4PLYA 1A9YA 4WLFA 4BQPA 1R0SA 2PH5A 2TMDA 4JBGA 2ZCVA 1B15A 3DB2A 4YQYA 1LLCA 1R16A 4U7WA 1HEUA 5KTKA 2VUSA 1M6WA 4LSWA 1O9BA 3CINA 2EP7A 3X2EA 5IDQA 2X0JA 5IDYA 2AQ8A 4IGEA 3QHAA 2OMEA 5DNAA 2BD0A 1LX6A 1QYWA 9LDTA 1PZEA 4R68A 2GN6A 2JHGA 3IDSA 3ZDFA 1QR6A 1BDMA 3JQ9A 3JD0A 3PIIA 4XQGA 4EI2A 3PEFA 3HDQA 1HZJA 1ZCJA 2V6MA 5HM8A 3AWDA 5DULA 2R2GA 4XWYA 4GH5A 4AL4A 1WWKA 2W2KA 1P9LA 4E32A 3JQDA 1YH3A 4RJTA 1Y5RA 3PP8A 4JN6B 4ZQFA 3DBRB 1V0JA 3H3FA 3LF1A 4M54A 4BO6A 3GF4A 2R00C 2HQ1A 4ALKA 2QX7A 1LDGA 1N7HA 1UJMA 3AY3A 1GZ3A 1EBFA 1IPEA 4KQWA 1QP8A 4RPHA 4Y6RA 3C24A 1D1SA 3OECA 1A5ZA 4UULA 5KJCA 5HA5A 1O6ZA 1HLPA 5ICMA 3RUHA 4NNJA 4PZCA 1ISJA 2JCVA 3OJFA 3X2FA 2D59A 4OXYA 3ADOA 5JC8A 3RI3A 4C7JA 3I9MA 5F1KA 4WUVA 3K2BA 1E92A 1W6UA 1NQAO 4TZTA 4YJFB 5U1PA 3P19A 4FPXA 3BIOA 3AY6A 4CMHA 1TEHA 2QZ9A 2ZJ0A 4FFMA 1LUAA 3UW3A 5IZCA 2XOXA 4TVOA 2W2KB 3BHJA 2HK9A 3QVOA 2W4QA 3VZPA 4CUJA 1EE9A 4JCOA 4RF2A 4YPOA 4PZEA 1AHHA 1YO6A 4WASA 2YHIB 3ZWYA 1C1XB 1NFFA 3ZCXA 1NNUA 3ZV5A 5IZ4A 2CF6A 3L4SO 1Q2XA 1YOVA 2PD3A 3JQEA 1G0NA 2QRJA 2Y1EA 1TI7A 4CLEA 3OJEA 3VC7A 3W4KA 4PVDA 2B37A 2O3QA 5A1TA 4FFNA 2Q4EA 5JPIA 4B4VA 3E5RA 3BYZA 4WLEA 1IUKA 4CMEA 5JAQA 4NG5A 3F47A 3PJDA 2QYSA 4W9NA 3E8XA 4UUMA 3VPFA 5HWSA 4FCCA 4K6FA 4RF4A 4CQMA 1U7HA 2PZKA 3UFXA 1ZK3A 1WLYA 2PY6A 4BMNA 3JQGB 2WTBA 4JROA 4N7RA 1R37A 2C5EA 2VZ9A 5AOVA 5JE8A 3WSWA 4EEXA 7MDHA 4E33A 1QG6A 4H16A 1VC2A 4L4SA 4WCFB 1MLDA 3OF2A 2YYYA 3H5RA 2X58A 5JC1A 2WD8A 1EE2A 3EAGA 5JDCA 1ZZEA 1QV6A 1MA0A 2PZMA 4YYZA 1PSDA 2P2SA 4WLUA 2P5YA 4UUPA 3T7EA 3A14A 3BMCA 3UUWA 1TXGA 2IXBA 4F45A 1JVSA 1KOLA 4I08A 3TNLA 2HK8A 4YRDA 1EBUA 2HJRA 3Q11A 2ZQZA 3SXPA 3RQSA 1SEVA 2G1UA 1YL6A 5DCYA 2DFDA 1ISMA 1JKJA 4NFSA 3JD3A 4UUOA 4CM8A 1RYEA 1C0KA 2VQ3A 1T25A 4IXWA 4ZICA 2VYNA 1GUZA 1KVUA 4YXFA 3A28A 4OKIA 4WE3A 5CPBA 5IJZA 2OUIA 1T2DA 3QE3A 3QWBA 1XELA 5G4KA 3GR6A 3GEMA 5FWNA 2XPCA 3JQBC 4N54A 2JCYA 3DOJA 3NTOA 3ZWNA 2EKLA 3ZWVA 2PZJA 5G2OA 4CM9A 3BMOA 4BHTA 2AQIA 3DFUA 2Y05A 1EVJA 2PKQP 4MKRA 4IDEA 1A27A 3WMWA 1XG5A 1TT7A 2NSDA 3SX2A 1LSUA 4CV1A 4HXYA 4D42A 2PV7A 1DJNA 2EW2A 4QEDA 4AJIA 4B8WA 3CZMA 1RPNA 3H7AA 4NFHA 4IPTA 3ZW8A 5C3MA 2LDBA 3DOCA 3PQEA 5DP1A 4NU6A 3QRWA 1H6DA 3LT1A 3H2SA 1V8BA 4IDFA 4BNUA 5KVQA 3IIEA 3GAFA 5JO9A 2RIRA 4MOWA 1YDWA 3VTFA 4YJHA 3W4IA 3K8ZA 3ZU2A 1ZUD1 1VPDA 3U3XA 3OJ0A 1YE3A 4PVCA 5TT1A 1MC5A 3KLMX 4E2WA 2X23A 3F46A 3FBTA 3ITDA 4DLLA 3AM4A 4GI2A 2W98A 2QQ5A 1U4OA 2V6BA 4Q3NA 4YRAA 1QLJA 2PD6A 5ES3A 4D0SA 4FN4A 4J43A 1T1SA 1ENPA 4MP6A 4BL5A 1NXQA 4TQGA 3PDJA 4CL3A 4WLVA 5CG1A 4CMBA 2AQKA 5C37A 4R3NA 4DBVO 1GV0A 2Q1UA 4J1NA 3AU8A 4FJ2A 5IG2A 2VTDA 3G3EA 3OJLA 2VTEA 3PWSA 4FBGA 1XSEA 4MIOA 4I9UA 1MFZA 4MPDA 5JAZA 3OJOA 4MVJH 4YDRA 4AJKA 4W6ZA 3OEWA 2VNSA 3OQBA 5FYDA 5EPOA 2J3KA 1MGOA 3GNTA 2H5LA 1E77A 1M67A 3GDFA 3GG2A 4R9SA 4YTEA 2GR9A 2BH9A 3KYDB 4Z9XA 2P91A 3F1KA 2AA3A 5EQDA 5F5LA 3S55A 4AJ2A 1J5PA 5TIIA 2EKQA 1GCUA 1GL3A 3PVZA 4LCEA 2JAPA 5EESA 3MJTA 3WIDA 4YEDA 2NU9A 1CQIA 1EQUA 2ZK7A 4FQ8A 4XYGA 3GDGA 1E3WA 5GZ6A 1B3RA 1F8FA 1B2LA 1XKQA 4D46A 2WD7B 1ONPA 1YBMA 5U9CA 2GD1O 3SC4A 4YT8A 3DBVO 4DGSA 4ITUA 7ADHA 1QYXA 1JQBA 1U1IA 4F6LA 2QRLA 2CVZA 3HWRA 3TZKA 2AXQA 3BTVA 1PZGA 1SC6A 2IDZA 3DBHB 3GPIA 4WOKA 3BXXA 1NQTA 2H1SA 1X1TA 4ZQEA 1QYDA 4XA8A 4BNHA 4MVJM 2GO1A 1ULSA 5HTOA 2I66A 1M6HA 4NJMB 4A5OA 2BGLA 2OXIA 4LISA 3U49A 1DAPA 4J7CA 5DCWA 4E5PA 4AJOA 3LK7A 3RJ9A 3DL2A 3JYPA 4OOFA 2B36A 1K5HA 4IJUA 4RQTA 3R3JA 4AICA 3MCVA 5F3RA 1O8CA 5G4LA 5AXBA 1RM5A 1KVSA 3NYWA 1ZVMA 3ANNA 3WLFA 5CDYA 2YJZA 1LEHA 4KTTE 1I36A 3JQCA 3S2EA 2C54A 3I83A 3ORFA 1NHWA 4TRNA 2VHYA 3RFTA 1BXKA 1UP6A 4LMPA 4FD3A 2NACA 1FDTA 3O03A 1YJ8A 4PLPA 3GLQA 2NU8A 1KYQA 1HDRA 3Q2KA 4CLHA 4CJXA 2VYVD 3VVCA 3FWZA 1UXIA 2B69A 1HYEA 2EP5A 3ENNA 3Q6IA 4AJ4A 1N2SA 1ZSYA 4BS9A 5GZ1A 2PK3A 3GZ4A 2AQHA 3JQAB 4B7UA 1I3KA 1ZFNA 1Q0HA 4FGSA 4QO7A 4YRBA 4DREA 4Y98A 2H9IA 1T2EA 1DLJA 3NGLA 2E6UX 3DONA 4WOJA 1A7KA 5IZCC 5T57A 3H3JA 1KY5A 3RBZA 2C2YA 5A3VA 2Q99A 1T1RA 5C7LO 1YRLA 3OFSA 1OMOA 1BDBA 1Y5MA 3RUCA 5DDIP 4IMRA 3P7MA 3FNFA 3E5MA 3QVTA 3F4BA 3GEGA 4DTIA 3I9LA 1C1DA 1HWYA 4XCVA 3DZKA 1CETA 1UZLA 1VLLA 1VJ1A 5I7SA 2BFPA 1KVTA 4BMVA 5CPFA 3MJ4A 4XX0A 2O7SA 2R00A 5IN4A 3ROQA 2W2LA 2I6TA 4RGBA 4W9NC 3ZWBA 3JYLA 2FR8A 1P3DA 3PI7A 2UYYA 2J8ZA 4RVUA 1EVYA 2NADA 2NU6A 3CMMA 3U9LA 1ONOA 5KWEA 1ADFA 4BKOA 4URFA 1QSGA 2D3TA 2ZB8A 2D0IA 1Q0QA 3DZBA 4N5NA 4E2ZA 1S6YA 3PYMA 4E5YA 4A10A 3INGA 1F14A 4HNHA 3GUCA 4RLHA 4CM5A 3GVPA 3JYNA 3MWEB 3WQSB 4OQYA 3WGTA 3S2FA 4MIYA 4CLOB 1IOLA 3D5QA 1WXDA 4XKJA 3IP3A 1KIFA 5ENVA 3C8MA 4BB5A 5JLAA 3VOSA 2NQTA 1SEPA 4ALNA 2YV3A 4CM1A 2O50A 1PJLA 1FF9A 3QWAA 1P77A 1I3NA 4PLCA 3WSVA 3UH1A 4AJPA 4BO8A 1N9GA 2E4AA 5B37A 3TQHA 2Y1GA 2D5CA 4FDAA 4BNFA 1U9JA 5B4VA 3O8QB 3PFFA 3IC5A 1YJQA 4OXKA 1VSUA 2HLPA 3A4VA 3DZIA 4WNCA 4O6VA 3U4IA 3I4FA 1PZFA 2C2XA 4JJIA 4W82A 3RUEA 1NFQA 3QW2A 2POQX 3AM5A 4M1QA 4BO9A 1W8DA 3JQFC 1JU9A 1Z7EA 2EG9A 3BHIA 8ADHA 2IODA 2HRBA 3B6ZA 1MXFA 1KVQA 2WSBA 3DAPA 4G65A 3V1UA 1FJHA 1SAYA 4U8GA 5F21A 2GF2A 3KSDO 1IYZA 3HB4X 1Q0LA 4A2CA 5EL0A 1GYRA 2AG5A 3ZV4A 1TT5B 2CVQA 3OQ1A 3BMQA 5KJFA 3PHGA 3VPSA 1DC6A 3K92A 5DCUA 2PKQO 4EITA 2VWGA 1ZJZA 3HFGA 1OC2A 3E1KA 5JCJD 3E03A 1GY8A 3HADA 1A9ZA 4L9RA 3ZHXA 2G0TA 1X0XA 5G0VA 1GDHA 1SMKA 4ALJA 3A06A 4OJNA 4CMIB 2Q1TA 2FZWA 4CM4B 1N9GB 2IRWA 1E5QA 1ZSNA 5ILGA 1PL7A 4NZ9A 4D3SA 5TSDA 3I6IA 4HWKA 5KVVA 4J1TA 2JCXA 1N8KA 5EMHA 3G49A 1PJTA 2WYWA 2X9GA 3OQ6A 4OH1A 2WYUA 1U3VA 3QVWA 1B3BA 4NPCA 4RVHA 1LRLA 1XGKA 5T8KC 2FPPA 3IOYA 4AJLA 4XGIA 1Z74A 3RU9A 3DTYA 3A9WA 1PGNA 2ZCUA 1DIAA 4J3FA 4NK4A 3WDSA 1E7YA 1C0PA 1RWBA 2OBYA 4EUFA 4F6CA 3NRCA 3TZ6A 5BSFA 4B4OA 3L4BA 1HZZA 3PWZA 4E13A 2LDXA 1JTVA 5DZSA 3FR7A 3M1LA 1IZ0A 3OIGA 3JQBA 1LC0A 2O48X 4DIFA 3D3EA 4BO7A 3WB9A 3VAZA 3EZYA 2ZYGA 4IMPA 1CDOA 3TOXA 5T64A 3DMYA 3BA1A 1GQYA 1UZNA 1GFSA 4YJDA 2FSVA 2PZLA 2V6GA 4IZHA 3IL2A 1AHIA 3KV3O 1VJTA 1YXMA 1T4BA 2Y0CA 5L9AA 1CWUA 4LVCA 1F8GA 1H5QA 2HCTA 1JA9A 2Y1CA 4DPLA 4E30A 1C3VA 4NBRA 1EUCA 3DHYA 4RDIA 4TZKA 1R4NA 5BNFA 2VUTA 2NVBA 1LRKA 1YDEA 1FK8A 2XAAA 3I9KA 5H82A 4A0SA 5FF9A 3EVNA 1DIBA 4LW8A 1X13A 2DLDA 2QIOA 2NTJA 3KYCA 3KB6A 3BMNB 2B0JA 2GCGA 1Y9EA 1NPDA 3DBLB 4XQCA 4ZHSA 1K89A 3QIVA 4AJHA 4A26A 1I5RA 4FJ1A 4PLTA 1QMGA 2HMUA 3MJVA 1O0SA 4D3FA 1DIHA 1LLQA 3VPHA 1PS0A 1DRVA 2O3UA 3JTMA 1QORA 4XB1A 2J5RA 4INAA 4CLRB 4CQLA 1V35A 4WLOA 3L9XA 3OBBA 2PR2A 1T2CA 4RLSA 2Y1FA 3OMLA 2ZTUA 4EZBA 4Z3DA 4IUYA 2X7HA 1NX6A 1AUPA 3N58A 5G0TA 1DIRA 3TWOA 1P31A 2DBQA 4R4JA 3L07A 2EEZA 3LZ6A 3ULKA 5FI5A 2CUKA 4J0FA 4RQUA 4DRYA 1QRRA 3E82A 4K28A 3JQAD 2CNBA 5G0UA 4BNTA 1I3LA 3WXBA 4E31A 3O38A 1U5CA 5G0SA 3PZBA 3TDKA 3R0IA 4HUJA 1H93A 3G79A 3IUPA 5L95A 1Q7GA 1YQXA 3BTSA 1UR5A 2A35A 1YB5A 3KO8A 5DT9A 4QECA 2DUWA 3WIEA 5H81A 2B35A 4PZDA 4BNGA 3NT5A 1YQGA 3OP4A 2VHZA 5JMPA 1GCOA 2NTNA 3O4RA 4XJSA 4Z9YA 5IN5A 3O26A 4IDAA 2YUTA 4HFRA 5JMWA 4CMAA 3AUTA 3LC7O 3RAJA 1I33A 1R66A 4M55A 4D7AA 5IFLA 3UF0A 4R41A 1LDMA 3G0OA 4EDFA 3KSUA 2O2SA 3E9QA 2UDPA 1KEPA 5THQA 4Y9DA 1I32A 1FMCA 4DC1A 3VTZA 1BW9A 3Q3CA 3AY7A 4NJOA 1YVEI 3GZNA 1HDZA 3DZHA 2EF1A 1PJCA 3PPIA 1M66A 3NJ8A 1CEQA 4L74A 3UOGA 5A9SA 5LDHA 3GVXA 1BRMA 3Q9NA 3G17A 4J91A 4B79A 3DMTC 1YGYA 2YHUA 4BVAA 1B8UA 3V2GA 2A4KA 3QV1A 3ON5A 3FBGA 2WM3A 1GZ6A 1KBZA 4EBFA 4JNKA 1LC3A 3FD8A 3FF4A 1P1HA 5JXWA 4E2YA 1LDBA 1ZK1A 3MJEA 4U6SA 4P4LA 2IZ0A 3TZQA 2B4QA 4YBZA 1P45A 3F6YA 4YAIA 3RCBA 4GBJA 3RWBA 1N1EA 1GUYA 2HO5A 3L9WA 3GRKA 2DFVA 5KJ6A 2GZ3A 1E5LA 2VWHA 3OA0A 1I2CA 1UAGA 3PXXA 2V65A 5C5IA 2HMSA 5HBRA 2B4TO 3HDHA 3Q1LA 1RYDA 4OSOA 5TS3A 2J5KA 3V1TC 4G2NA 2ZQYA 2CDBA 4LVUA 5A06A 5L7WA 1U3WA 2EWMA 5HS4A 2OGUA 3ZV6A 5AXAA 2PLAA 3H5NA 1GPJA 1PTJA 4MVJD 4QTZA 5CEFA 5LCXA 1VL8A 2DBVO 3DWFA 1P1KA 2H63A 4CM3A 1UXJA 4XDZA 1Y81A 1XEAA 4ND1A 4MINA 2BRUA 3CE6A 4U0KA 3HB5X 1SZJG 1Q1NA 4YA6A 2OBNA 1L1FA 1EFLA 1NHGA 2Q49A 1C14A 1D3AA 4QFCA 1ISGA 2NVUA 5A5EA 1V9LA 3L6DA 2DUUA 4EW6A 3U09A 5CAEA 2HDHA 2NUAA 3RC7A 3DR3A 4P8RA 4IDBA 1EZ4A 2DKNA 4CR7A 4J6FA 4U6QA 4XIYA 4PRKA 4ZGWA 2HKIA 1JAYA 2DT5A 1HYGA 3NEPX 4UVIA 3UICA 4GMGA 3T4EA 2CF5A 1DLIA 4TRMA 3U0BA 1LXCA 4U5QA 5AVOA 5JYDA 4R5MA 3GDOA 3VZQA 2CSUA 4HP8A 2Y1DA 1BVUA 1YB1A 4CUKA 1CQJA 3KHUA 3SEFA 4YT5A 2GNAA 4IS2A 3AUAA 2YDXA 1WVGA 5MDHA 1E3SA 4XR4A 4CMGA 5COQA 1VKNA 2NU7A 1AE1A 4KUGA 4MVJF 1SPXA 1PZHA 4J7UA 5BQFA 5JNLA 2VT3A 3LF2A 5C7IO 4HX5A 1B8VA 3VPGA 4IIUA 1YKFA 4LN1A 5CHEA 4J49A 1ZK0A 5F5NA 3VDRA 4FC6A 4E5MA 3PQFA 4WPGA 1U28A 3EHEA 1YOVB 2B5VA 1PX0A 2P4HX 4RF5A 3ZWWA 1E1LA 3JD4A 5I7FA 2HSDA 1IULA 3GGOA 2JD2A 4IBOA 4OIMA 1ZKMA 5EIOA 2GN9A 3SLKA 4BNKA 1UDBA 4QSMA 2ZTMA 1E1MA 2D4AA 1A7AA 2C5AA 3G1TA 4PG8A 4OYRA 1T2AA 4CQMB 3LC1O 1QXSA 2YW9A 3SJ7A 4BB6A 1SB9A 1JDJA 4BNNA 2I67A 2Z1MA 1QYCA 4TVBA 1S7CA 1W73A 3JQFA 4GX0A 1MXHA 2X5OA 5TGDA 5ITVA 3L4BC 3RIHA 1WDLA 1XLTA 3M6IA 1YBAA 3N74A 3GC6A 4WLNA 1WMBA 1GR0A 3LQFA 1ZEMA 2DPHA 1LNQA 4YWJA 1NYTA 2UUPA 1E7RA 3D7LA 2W8ZA 1N7GA 1LBEA 3G1UA 3GFGA 4GSKA 4II2A 3U4HA 4GKVA 3ASVA 3WTCA 1E6UA 2HUNA 1MX3A 2ZTVA 1O5IA 3FSRA 1Z7BA 1WP4A 1WDKA 2PTGA 4DVJA 3BMCB 3QWIA 2O3SA 4ZJUA 5IDWA 3AI1A 3FRJA 4FR5A 3Q2IA 3AOEC 4IQ8A 1X1EA 4ZQGA 2A94A 4HKTA 4TKMA 4MVJP 3KTDA 2C59A 3KUXA 3MTJA 3S1LA 4BGEA 4MJLA 3GGGA 4Q3BA 3RUIA 1G0OA 3Q0EA 4NHEA 3EY4A 5DN9A 4FIZA 4BKPA 2FSSA 3M1AA 2P5UA 1HDYA 4CM8B 2GDZA 1H2HA 3QWHA 4D43A 1F12A 1E7QA 5ENDA 4FS3A 4WJZA 3GHYA 1VKOA 3IAHA 5A4DA 4HNGA 4IJWA 5T8KA 2D2IA 4ND2A 5G4KB 3AFMA 1WAMA 2G82A 2WJPA 3W6ZA 3UCFA 4B7CA 1EK6A 3DHNA 4OHUA 3CKYA 1LI4A 1NPTO 1VE9A 5HS6A 1LTHR 2X0NA 3BMOB 1QLHA 3HNPA 2WWRA 1GUFA 4R01A 1TLTA 5L3ZA 3V2UA 4ALMA 3RC9A 4LMRA 1LDYA 3WNVA 4ONEA 4DL9A 2UV8A 3F5SA 2GN4A 3C7CB 5GMOA 5B1YA 1BVRA 3B20A 3SLGA 1ZXLA 2IYPA 4JBHA 3MJCA 3VHRA 2E37A 2AEJA 4XRRA 1KEUA 1GAEO 1HTBA 3FTPA 2VZ0A 1LSSA 2DTDA 3PLNA 1WW8A 3FTNA 1O94A 2GGSA 6LDHA 2Y1OA 4J16A 2J3HA 5L45A 1DEHA 1QYVA 3NV9A 4YJHB 5BNIA 3PRJA 4PLFA 2Q2VA 4CV2A 1A4UA 1I8TA 2WE7A 1LDNA 3JCZA 5CDUA 3IKTA 1ADGA 2RCYA 4F46A 3P2YA 4IDCA 4UUNA 3ZU4A 1U8XX 3RSHA 5ADHA 1Z45A 4JJGA 1X7HA 4OSPA 3CEAA 4PLZA 5BSHA 4XB2A 3IKVA 5ER6A 2BKAA 2G17A 3TN7A 3RVDA 3NDRA 4DYDA 2RAFA 1NWHA 3FHLA 1XA0A 4RDHA 3WG9A 3VVBA 4DQUA
chains in the Genus database with same CATH superfamily
1VSVA 2ZI5A 1WXGA 2FY8A 3ILVA 1VTKA 5FBLB 5F9FA 3HDJA 2JIQA 3O9ZA 2VSQA 5AM3A 3S68A 2WR8A 5EN4A 2O2IA 2PMKA 3NORA 1V48A 1Z29A 3QVSA 1WEKA 2EYUA 1XCJA 1CJUC 4OQPA 3E9YA 4MUFA 4PYNA 5KDLA 4C78A 4ETNA 1TQHA 3E7DA 3K09C 1V9CA 2C9DA 4ZGGA 1NE7A 1BMFA 1BS2A 4A8PA 3V2HA 1F3OA 3FX2A 4HHEA 4RSMA 2ID9A 3H2HA 4X6LA 1V1MA 2XCRB 1X1RA 4HNTA 1JHXA 1CQIB 1G16A 2ENUA 4U2KA 3RYCA 3L40A 1JZQA 3R5XA 5CW2A 3Q12A 5DBHX 2V0NA 1E5TA 3JQ8A 3QXCA 3QEOA 3Q3GE 2O1WA 2VJKA 9ATCA 1U6IA 2WFAA 2ORWA 2W6CX 2XGSA 4CKYA 1L4KA 4IVQA 1LKZA 1IY1A 3E22B 4Q1BA 4EENA 3OZ7A 2BFAA 5ALQA 4ZARA 5LQNA 3EZ6A 4UU1A 4DPKA 3MSCA 4WEQA 5I7RA 1M2WA 1QS0A 4GGMX 2CVOA 4O29A 2I34A 4Y1RB 4DV5B 1YJCA 3LVBA 1TFUA 5LWHA 3IQEA 1B4DA 3AFGA 2O8EA 4FZJA 1DKNA 2GILA 1U8ZA 2J3IA 2WJGA 3LUPA 1A9XB 2LIPA 4M98A 4BCDA 4K6GA 3HUDA 4TWRA 5F12A 3MCUA 1K0UA 3MIIA 4CUZA 3Q7SA 1UK6A 4BXOA 3HO1A 3FOFC 3CLVA 1IWOA 3GEIA 2GN2A 3MGAA 1XXHA 1GPDG 2DHQA 1XA3A 1WEHA 1C9YA 3T9FA 4UPDA 5EE3A 1WDMA 1RI3A 2VCEA 5TF4A 2HR1A 3OCZA 3PJGA 1SC4A 2NWQA 2X15A 5EHIA 4DEVA 1KDVA 2GUWA 5J2TF 4CVNA 1MQSA 1FU4A 2ODQA 4KN5A 3VAYA 4ZVUA 3ZE8A 4DQLA 4WOCA 1SKBA 2WSSD 2A33A 2DWQA 4YAGA 4C6TA 3QI2A 5DHFA 2HU8A 4U7GA 1EE1A 2F48A 3AG5A 4ZO6A 1XQVA 5D00A 4V38A 3ZNQA 1T5IA 4GL2A 4J2HA 4TWBA 3TXYA 3QPWA 1TADA 1RZRD 3QNUA 2QTVA 1XQ1A 4US1R 1FYEA 1NPYA 4HPWA 2GLTA 3DMTA 3UAZA 3VDQA 1EMDA 4DDKA 4TTTS 2WEKA 3AMVA 3EWSA 4OMUA 5AQEA 3BWDD 2GHRA 4JGIA 4RHFA 4B35A 4Q7MB 3ZLBA 3UB3A 3QE9Y 2JEOA 4ISBA 2CT8A 3C3XA 1CZOA 3HNRA 5BYBA 3GOHA 3DMGA 4YI5A 1MRSA 3LQRA 2NU8B 4YRLA 2QMEA 3RS4A 5CCXA 1HTTA 5GZ3A 4K86A 2PA3A 5ICGA 1GNLA 1ZRNA 4TLBA 1ZCBA 4JXKA 1SCQA 3BE4A 3UJAA 3OEED 2EFDB 2L0XA 4JYAB 3FRIA 4YRPA 3WBBA 3OE7D 2AYZA 5JJKA 3R23A 5KOJB 4P4UA 4AM8A 4ML3A 3EOBI 1TVEA 4PLVA 2VDJA 5ITZB 1JIVA 2WU8A 2WWGA 1J1IA 3C5WP 3NBMA 3STUA 4DNQA 2QTWB 3QE2A 1DXYA 2NV0A 2FSFA 1Z73A 4FVTA 3H9EO 3W6UA 2ZRMA 5C8YF 1OYWA 2PUAA 4HQ6A 4AS3A 1NNLA 1U1EA 4X60A 3ETGA 1O95A 5D5QA 3DTNA 1XCMA 2JJ8A 1SHUX 2O8CA 1YSCA 3HCDA 1FVOA 4IXTA 3ROMA 3CW2A 5JJCA 4IILA 2JI7A 2BKUA 2PWYA 2ZATA 4GOMD 5FR2A 1RYMA 3R9KA 1X9HA 1RBZA 1CP3A 2JD0A 1JAXA 1DBRA 4EEZA 1SXPA 1U28C 1H2YA 5AYVA 5JSHA 1MC8A 1N92A 1RHMA 3GLSA 3O4JA 2JBAA 4KXNA 4Y9TA 4F4JA 5J5VA 4ZAZA 5I7WA 5TQVA 2L82A 3HJNA 1JDVA 1SXJB 1OBFO 1C1DB 4ZXPA 2FAXA 1CUAA 3GMDA 5CB0A 4HRYA 5KEIA 3Q7RA 2NNLD 1N5KA 3WLSA 2ZRHA 4R3WA 4K9NA 1C3LA 3ZG6A 2NZYA 2FPWA 1WSWA 3WYCA 4AUMA 5HZHA 1C0EA 1EUDA 2V6IA 4UU7A 2F2TA 4H35A 3UYLA 2X13A 1II8B 1KKLA 2D2FA 2EJWA 2OYSA 2Z9DA 4G6ZA 3SC2A 3FWKA 5JXGA 4NY1A 5HGJA 3I92A 3KFLA 4YJ2A 1ABBA 5CT4A 2OB1A 2B4AA 2C4VA 2I6XA 1Z6PA 3DJYA 4FZVA 4O4IB 4DF3A 3COPA 3QKSB 2X6QA 2GPYA 3SYKA 1I2DA 4MGEA 3WGHA 3P5SA 5EMJA 3L77A 4OK5A 3Q8WA 2VYND 4LJYA 1BMDA 5GV7A 4DLRA 4EKDA 2ZJ4A 2WU4A 2FX2A 2JFFA 3WXMA 8OHMA 5FQNA 1Q7EA 4H7FA 1PS9A 1U94A 1XRPA 3SYNA 3VZCA 3D4NA 3D4PA 3A2LA 3KLOA 4ZO7A 1L4GA 2ZULA 2D5AA 1MTOA 2CL7X 2WK1A 3LX6A 3QSGA 4O4LB 4Z9FA 3SVZA 3QE4A 1ESZA 1RWKA 3DDWA 2JL1A 3MW8A 4DDUA 4JX8A 1E1NA 2CWDA 2QY6A 3EG5A 3A32A 3GT0A 4XI9A 3CE9A 4EFKA 2LCFA 3I8XA 2G63A 1BVHA 3NM6B 1R5OA 1FYXA 4IOJA 3HGMA 4EIWA 1PHPA 1DQZA 4FFOA 4RKFA 2I65A 5AKKA 4A2PA 2BI4A 3DMPA 1DAEA 3GBSA 1IXSB 1YIOA 4YIKA 1Z5GA 2PGOA 3DOOA 1QP7A 1IAQA 3EMKA 1K6JA 1OW3B 4DNPA 4YT2A 3GNLA 5AOBA 4WA8A 4UU8A 3N0XA 2EGHA 5JXIA 3FPGA 1KMQA 2HGSA 3PCXA 4HGQA 1W36B 2FR0A 2ZAIA 3COZA 2R8EA 2XGOA 3L7DA 5FUBA 1XZEA 3KZKA 4J0GA 3TKAA 5JFOA 1WZEA 3ER6A 3N7UA 4J90A 3KJHA 4H0NA 3SC6A 4MYSA 4NBWA 1YRQA 2PYDA 4EG0A 1VFNA 1ZMOA 2QT0A 1SIUA 3AJDA 4GSLA 4OFXA 2DPLA 2ARKA 4PYMA 5HIJA 3ZWOA 3V7UA 1RM0A 3VI4B 3EGXB 4HQ0A 2K4MA 3MF4A 1ULUA 4ZVSA 2JJYA 2X2EA 2Y1WA 4CT5A 2FW6A 4RFSA 4DCMA 1ZSVA 3P9NA 4MWCA 1UEIA 3SJUA 1RKXA 2GAOA 3OUUA 5CLHA 2X9LA 5ALFA 3SZRA 3A0RB 1U0OC 1TA9A 2DVMA 1Y3HA 3TLKA 1SXQA 1R88A 4YRSA 1OD6A 1M34A 3TXAA 1SOMA 4F1KA 1KI9A 2EWVA 3N2GA 3TNDA 3S1AB 3MCAA 1DFGA 4HOYA 3HHPA 3ZDBA 2IVFA 2VJAA 1TA4A 3PQ6A 4JB2A 4PONA 3SEAA 1EP9A 1S2NA 3LUGA 3LG2A 1VCIA 3ASZA 2OFOA 4R71A 5EP2A 2VKQA 2QKYA 4Q66C 4JJ4A 1J2TA 2VJOA 4X63A 4DJTA 4A23A 3NUGA 5AVJA 3E27A 1KPIA 2Q41A 2ZUWA 4ZN6A 3I9JA 4EGSA 2BJWA 4JK3A 3R9WA 1IXZA 2BHLA 3V5NA 4HQOA 3FKJA 2CNDA 3LQQA 2BHNA 3EEQA 2WE8A 3INTA 4JXJA 1L7EA 4C06A 4MR8B 5CH5A 3LFTA 3QXGA 2AUMA 2BFEB 4GYKA 3ADKA 3RVMA 2H1HA 4JV5B 4CZ2A 3HCPA 3W3ZB 2IHYA 3GFRA 5LUBA 5TRTA 5JCOC 4RTMA 5JZ9A 1KY2A 3EK2A 1EGQA 4FDMA 4K6CA 4YR9A 2NO9A 1XZDA 1Z35A 2GRUA 2ZIWB 4OKNA 4RGVA 5EVCA 3VX4A 1QR2A 1AXEA 2IE0A 1D2CA 2VI5A 3FKQA 3D81A 3ND7A 4LDJA 1YZUA 4QYXA 1CNMA 1TW3A 4RA6A 3PUYA 1LA2A 3DW3X 1MJFA 4WUTA 1PO7A 2ATXA 3OTGA 4LYEA 3CEPB 4NX2A 4IY1A 1U8EA 4R2KA 1LBHA 3MC1A 3UUGA 3P9RA 4BPRA 1R0RE 4D98A 4NHOA 1GZ4A 1NAIA 1QFYA 1ZJYA 3NAQA 3P2EA 4GBGA 4YN3A 1KHHA 2IGTA 4BNVA 1R4NB 1DPGA 1U6KA 2GRJA 3CTPA 3EXHA 1MX5A 4XEUA 4Y6GB 4E51A 1E8MA 1XI2A 4BWYA 1SUCA 5CM8B 3MTGA 3MOGA 2L42A 5AKEA 3LPCA 5E1DA 4BKQA 2G5CA 4D9IA 1NMZA 1JHUA 4HYTA 4OJQA 2HWWA 4NEQA 3TNFA 2YFKA 4L8WB 3QFFA 5EVJA 2OPHA 4ND5A 2ZR0A 4DDWA 3QA9A 2JRLA 1KI7A 2LIVA 4HUTA 3FLAA 4YCAA 4HH0A 4MP3A 1RRGA 1WM1A 3AUKA 1Y5IA 1HETA 1JG6A 2P8JA 2ZETA 4GPD1 3S7ZA 1HORA 3NANA 4A73A 4IEFB 4IIVA 1QH1B 1Z08A 3BF8A 1GFIA 3DHVA 3KTFA 1ZH0A 4GOND 2ZOSA 4X1IA 1G7CA 2C84A 4OGFA 5LP6B 2ECOA 3D2AA 2D1TA 4JBLA 3G0CA 3SXUA 2JAUA 1RXSA 1S8AA 5K0TA 5KQLA 2DRIA 3DZDA 2ETVA 3BL6A 3WLOA 3NFYA 1XMIA 4KI7A 5TJ9A 4D6YA 4TXHA 2ONKA 4EA6A 4NFYA 1MVOA 2BONA 1U0TA 1JHQA 3GLVA 1GGHA 2OFXA 4Q93A 3D4BA 2HMVA 2W58A 5IF9A 4P3KA 1GQ2A 4L73A 4K46A 4B4UA 5KYYB 3IUYA 1UBFA 1XHEA 5BVGA 3GD5A 1H2EA 1NVTA 2ZJOA 2J9FA 2QRVB 4XOIA 3A1NA 2NN3C 1M2OB 3A36A 2CLIB 5E9WA 2EJCA 4IEIA 4YRCA 3F5QA 1F2UB 3ETHA 4J0HA 4U7JA 1BJKA 1QIKA 3RVJA 3T3HA 5MN5A 4LRQA 4AN0A 4KJXA 2PZFA 4JI6B 3SGLA 1MC4A 4PCVA 4B34A 3NP9A 5K3OA 2JRCA 3D5TA 4L8FA 3HDTA 3WQQA 1ZOPA 3E70C 3MEQA 3HBLA 5CJ2A 4DHWA 4M1MA 4N5LA 1I0ZA 1GGEA 4N9WA 3I6MA 1FSPA 4HFJA 5KVAA 4MKXA 4KR7A 4QREA 2PSJA 4YAKA 1Z2EA 3AEUB 1SXJD 4TTIA 3G9QA 1LQ2A 4O4JF 5TXGA 3E48A 5JYEA 3A25A 4HPJB 4DT1B 3Q0IA 3UKOA 5F35A 2BGRA 1YBFA 4EMTA 2BKXA 2XHEA 3ZVRA 4HXFB 4BNXA 3EXG1 1OE0A 2MJLA 1X2EA 4Z53A 3D7RA 4P92A 1E5VA 4NIMA 4OFBA 1GPLA 1EJ6A 4TSFA 1VHJA 2DAPA 4GBED 3UXYA 4MGIR 2VT6A 2PAAA 1JI0A 3ZWXA 1YRBA 1TM5E 2I8CA 4RO0A 4OFWA 2LV8A 1OFGA 5NLLA 2BW0A 4BFUA 5FX2A 1T9DA 1XDGA 1EP2B 2QYHA 4XM0A 5IJ9B 1IUPA 4Y18A 4KC0A 2XF8A 1IUNA 2OCIA 1V41E 2J33A 3A6EA 2XVAA 3IODA 4RKQA 5F76A 3CXUA 4O1MA 4YASA 5I5EA 3CURA 3EGVA 2BFMA 2I4RA 2QPLA 3UMRA 1KO5A 5JROA 1R9MA 3DWGA 5UKDA 2AKAB 4BVBA 2B9EA 4ZDKA 2AX3A 3AUSA 4M89A 1OGJA 3AQIA 5A71A 5FH9A 2AF3C 3DS8A 4OBEA 4WECA 2ZM5A 3FPCA 4CMKA 4I1RA 3TE6A 1KGDA 3N7TA 1G20A 3BSYA 3SDZA 3ZE1B 1UMCB 3I9FA 3KQHA 1LY1A 2B83A 1VJGA 3KZXA 4LFAB 5G1OA 1P0FA 2B5OA 3SQLA 1HKUA 4ZMRA 1C9EA 4WESA 3EQ9A 5LM3A 2FW1A 5CA1B 4PGMA 3DLHA 3FBWA 4CCSA 2QJOA 1CZHA 5CNJA 5EJMA 3JQGA 1RZRA 2WYIA 1VZ3A 2Y27A 3OSZA 4U7HA 2M6KA 3DEYX 1PV4A 2Z2XA 4RACA 4G5SA 5DYIA 1NR7A 2V3WA 2QJFA 1PBTA 1RWWA 3U56A 4HH1A 2Z3VA 4ZV7A 3AFIA 2VH5R 2WV7A 4IG4A 4JR2A 5ECYA 1NMXA 1R6BX 1XZ8A 3LQYA 1SVNA 1NVGA 1EWTA 2JCGA 1L7AA 5A9TA 5JQWA 5FTKA 1W36D 1E3JA 4M1YA 2XB2A 1DT5A 3H1TA 2E21A 1E1CB 1NWCA 1KZ1A 4PHHA 5CGZA 3WTBA 3C5HA 2V1UA 2Z8ZA 2BMJA 3AGPA 5FEMA 1GDDA 1GYPA 3T1YB 1FFCA 3SDBA 1T9GS 1NATA 4URVR 1USWA 2O5VA 4LJKA 1FBTA 3HKCB 4UE6A 4URUR 3K71B 1GG2A 3N05A 4E46A 1E2IA 4G25A 5EZ5A 4C4XA 2I7TA 2NVUB 5BSWA 4F97A 1JHDA 2GN0A 3ADBA 3MN1A 1SY7A 2XVZA 2PRKA 5EYPA 1Z36A 1F5SA 2Q5JA 1P7YA 4PIVA 4E7OA 1V16A 3HUUA 4BIIA 5D3KA 4IZIA 1ECJA 1FYDA 1N2ZA 1TKRA 2IIBA 3SZOA 3L6BA 1W4RA 4CV3A 3ZD7A 4AKSA 3ONDA 3OO1A 3RASA 1TOAA 1E6EA 2IHVA 1HFEL 5TLSA 3RYHB 4KAJA 4DB2A 3O92A 1LJLA 5A4KA 5LQDA 4RLFA 1IZ9A 2KLBA 4DFDA 4ZQCB 1GZ5A 1JFVA 1CQJB 3GUZA 5AVZA 3RB8A 2XKAA 3MXTA 4L16A 3E58A 4TM8A 1JU4A 2P9GA 1XZIA 3NW9A 1OYOA 1U7ZA 1B26A 1F0PA 2I62A 2D1SA 2NU7B 1YIAA 3D4IA 3GJ0A 3PUVA 4IQ0A 3O4VA 3WBFA 4HTFA 4MV1A 3BGIA 3M6AA 2YC4C 1ZNZA 1DTSA 1NT4A 3N5KA 1Z9BA 3ZCQA 1XX6A 2WIAA 5T3UA 2VT7A 3PGA1 2AHRA 1G6KA 3HSKA 1D2GA 4HLDA 3SHOA 5KWSA 3FHTA 1O57A 4EZIA 1YOBA 2XRFA 5CJPA 6ABPA 3X1DA 4LRXA 1QBGA 4QUBA 3SN6A 3QA3E 3S29A 3H0EA 3LW7A 2NSJA 4EJMA 1C30A 1NIJA 1ZS9A 1T3ZA 2OOKA 2AI1A 1KI1A 3HY4A 3I6QA 1RYHA 3RFFA 2EQAA 4RF3A 1NFRA 4RL6A 1H8ED 3OOJA 3HB9A 1GEGA 1ZVVA 1ND6A 1O87A 4ARUA 5HRAA 2YTZA 4MVYA 1YZKA 1FX1A 2WD9A 1T15A 2OM6A 4C0KA 4PIMA 3GQVA 1X94A 5DBIA 5B53A 3ZGLA 2YS7A 4L8GA 2F64A 4QFMA 4Q9HA 5M7EA 3U3ZA 1XTPA 5AT1A 4UJ3A 5BOSB 1AHPA 4JWTA 3R7WB 4FJ0A 1NW8A 3RTDA 4H7PA 3M7IA 4KPFC 2KM1A 3HFSA 3IS3A 3A7EA 1AQYA 2HZBA 3S4YA 1DKUA 1HLDA 2XSZA 9LDBA 4CDRA 1TAUA 1P4HA 4GE3A 4Q02A 3CCCA 3WNBA 2A8YA 2VC2B 1X7ZA 1XVVA 2PT6A 5CA0A 3L7OA 4R7TA 4TN1A 5BQPA 2E4XA 4JLJA 4TKUA 3FNRA 4PW0A 4DW8A 5FNZA 1UK7A 2O57A 3IAXA 2ASVA 3HN6A 3KYDA 4U0JA 4YO7A 3T1VA 1MP0A 3U7EB 3U7QA 4MUMA 2R11A 1VPVA 2VUIB 3KBOA 3LP8A 2EOAA 3NYIA 1FXWA 2GLXA 2BMAA 1TCCA 3OU2A 1WZIA 5DTIA 4ZALA 1R0CA 2YRXA 3GH3A 4OP3A 1CUGA 1JXOA 3ONVA 5DH9A 2IH4A 3H2JA 2O6HA 1GTJ1 3DEFA 4BZPA 4BFLA 3NHKA 4P98A 4H3SA 1CPYA 1UP7A 3E0QA 3RLIA 3UMVA 3H75A 3QUCA 3DEHA 4KGXA 1YONA 1E9FA 4BGUA 1SCIA 2ZYVX 3ZJVA 2Z6QA 3PL1A 4RK5A 3DLTA 3TL3A 4TXNA 1UPBA 1PJ3A 3X1XA 4I50F 1BG6A 1B6TA 3KQWA 3LWZA 4RQAA 1PVOA 2GJSA 1HQYE 2GYYA 1YIDA 4QO8A 2ZEJA 2FCAA 3CVWA 3B52X 4FW8A 4OP2A 4C03A 2RHWA 4N7BA 1O6FA 4CIBA 3F9CA 2YL2A 4JB0A 3NPMA 2XGGA 2V7PA 1EFDN 1EVZA 2QGNA 4P6VF 2W4IA 5B4TA 2GPWA 2IHJA 4OU5A 4TMTA 3FGNA 1A4RA 5ALEA 1ODJA 4KK4A 5CW1A 4IJ6A 2O3RA 1QP4A 1JDUA 4K9QA 4Q9KA 4B76A 4OJKA 3BQNB 5J43A 4QELA 1ZD4A 5AXDA 3GNSA 4GP9A 4H4DA 3BWYA 4Y3UA 3DB1A 1RKBA 2D5IA 1OC4A 2F59A 1HG0A 3EIQA 3GFBA 2NO4A 3MMNA 1GU7A 4RBNA 5LOVA 2CUTA 1F51E 4HC4A 3PD0A 2A9OA 3P8ZA 2CDCA 1WMDA 2C98A 1IN8A 1PN3A 1YCGA 5HTKA 3CZQA 2OAP1 3GRFA 1MG0A 4YXWA 4A8JB 2G4LA 1SR8A 3OIUA 4TRJA 3VR6A 1J4AA 3WIUA 5K8TA 1UM9B 3TAXA 5ILOA 1IXYA 2EKDA 1E0JA 4YCJA 3E7XA 1V5EA 4DIOA 5A3JA 4ESEA 1AA9A 3ZWQA 1FTNA 3FB1A 3SJBA 1QZTA 3H6KA 1L1EA 1CRPA 1PL6A 4KVFA 2IYUA 4MPTA 1J56A 2Q3JA 4MLZA 1FOEB 1IATA 2G1PA 1GPYA 3TNYA 3VH2A 1FY2A 4CV0A 1HNXB 2D06A 2DJ5A 1A9OA 3DVAB 1USUA 4DGQA 1DP4A 4N18A 5TPZD 4O3FA 3TW6A 5A4JA 1TPZA 2EHDA 3BGWA 4V0KA 4KAAA 2EYQA 1E79A 4PFQA 4L1KA 2VTBA 4WN9B 1OOEA 4WERA 5TR9A 2H1LA 4XOUA 1YF3A 3VC2A 4YUWA 1KSGA 3GK3A 1ID1A 3RUFA 3S2IA 4N0PA 5CDTA 3PQDA 1CUZA 5KTRA 3UANA 3EZFA 4OHKA 3R75A 1QIJA 1US8A 3C85A 4TSRA 1IL0A 4H1VA 3L1UA 2FHSA 2XJ4A 4HAXA 2DQKA 1V71A 1QJ4A 4ADSG 1XR3A 2CDAA 4DV3B 2P90A 4O59O 2Q4BA 2KBEA 5H9WA 1KPGA 1N9KA 1VMEA 4IFEA 5ADWA 4C0LA 1ANKA 1XVLA 2B2NA 3KEFA 1COZA 5IM5A 1R4ZA 3GB9A 4MPRA 4TTPA 1Z3CA 4LSZA 2OC9A 1RRCA 1ULHA 2AFHA 3THYA 1DJMA 4OXQA 3P2IA 1KNQA 3WWDA 5ITWA 3PITA 2P2DA 4TTQA 1DG3A 1IZYA 1R64A 4DNFA 1SWVA 3OCXA 1OI2A 5FBHA 1VP9A 2PLWA 2PBLA 2HJSA 3H5OA 2AFIE 3F3YA 1LSJA 3RK1A 1OWNA 1GAQA 1YMVA 5IVDA 2IS2A 2HK6A 5LA6B 1IM8A 5FBZA 2GA8A 1NM5A 3T4XA 2X4LA 1XVUA 1WDTA 1AUQA 3E81A 3EA0A 3V32A 4A92A 1L7DA 2FPIA 1JWAB 4P7GA 4XDYA 3GJ8A 5D3MA 2AF4C 2VA9A 3FCOA 1KDYA 3KTAB 1A5AB 4UM7A 1RQGA 4I36A 1RWPA 2ZVPX 3TIIA 3OM1A 5IYZA 2QTFA 1UKEA 3RSOA 5KNDH 1JJBA 3JYHA 3LZDA 2XKBA 2OLJA 3I5MA 1DWOA 2EERA 3COSA 4ARSA 2BVNA 3RFUA 3WP0A 1E9RA 2IKSA 4BO1A 1IHDA 1Y8RB 4GGPA 3WO1A 4IRXA 2ZJFA 3I9OA 3I2KA 4EX7A 3AF4A 2D1YA 3RVKA 3PBKA 3BD7A 3C1TA 2I2AA 3UJNA 4GYWA 4QJ5A 3OKPA 3T9DA 1KYZA 2XAUA 3EFBA 4H08A 5JRZA 2JFNA 1JG7A 1K9VF 2Q3MA 3BB4A 3FLBA 2G77B 2IU4A 3ILSA 4NOKA 2UYCA 2TMKA 1XL0A 5DK4A 5DYNA 4IGFA 3GEDA 1RP1A 4I3HA 3VGPA 3JZAA 3KNZA 2XIQA 5DOZA 4CLOA 3K9WA 2YJ5A 2AMJA 3ND8A 4ZJZA 2PN1A 2YBEA 2KJQA 1E89A 2A0WA 2E9SA 4MW6A 4B9AA 3N3BC 3ADCA 3WV4A 2VHXA 1VDZA 1RE1A 1RYZA 2QG4A 3A1VA 4UAJA 5BQFA 3EW7A 3RANA 2ZI6A 1QH8A 1EDOA 4CMEC 1NVKA 3TLMA 1KQFA 4H6WA 3GPDG 1PR9A 2FP4B 3AH8A 2PWBA 3MYYA 4WXYB 1XZAA 2I3ZA 4ILEA 4NFLA 1KI6A 2C0CA 3G2OA 5DB4A 3EWIA 1YV9A 4Q03A 2JGJA 3BXPA 1NSTA 5DTRA 5HVNA 1WZUA 3IUBA 5ISMA 1AN9A 3UEOA 4MEJA 2F7SA 2X1VA 3E8SA 1SKQA 2C9ZA 1GEEA 3I6BA 4GEKA 2YNMD 3AZOA 3RBVA 3JRWA 4YJ3A 2GKGA 4XX1A 2QAGA 2JCBA 1WQ3A 1JKFA 3OD5A 4XH9B 4AYTA 3GY0A 1ST3A 2WVGA 3NO4A 4V2IA 1YR7A 2MHCA 2QX6A 4CG0A 3OE4A 2L17A 1MJGA 5K51A 3BFXA 2H7XA 4NZZA 5TJHA 1OZGA 1WCIB 2BLLA 1HE5A 4RD0A 1GCAA 1RM3A 4Q3CA 5I47A 5JD4A 1WB6A 5C7OO 4KK3A 1QRAA 2NZUG 3CPEA 5EWJB 2QUIA 2PT9A 2H6EA 1H05A 1PGPA 2OD7A 2GCPA 2WRZA 5L4LA 1NVDA 3JYOA 2FPGB 3ANYB 1MX9A 1J9EA 1N3BA 4ZT3A 4RVNA 4A1FA 4F3NA 3DDCA 5K0CA 4ZT7A 3AZPA 2JAOA 1PR4A 4P33A 3W8FA 3AKCA 1DKMA 2J08A 2H31A 4H3HB 3NTRA 1E2EA 3X44A 1OR8A 4CMIA 4XYLA 2HSWA 2P6PA 3HR7A 2QE6A 3ZHRA 2JIMA 1MG5A 2ZRDA 1DRUA 3C5VA 3BFJA 4X7PA 5EZSA 1NYQA 1J33A 2BP7B 1LBQA 5EC8A 1KY4A 3WICA 1OVMA 1ZN2A 3QEKA 3TECE 4M0MA 1P74A 1WCYA 4N7MA 5CTAA 4UNRA 5DKFA 1WRBA 2ZSEA 3H9GA 3NHWA 2K6GA 4DV4B 4WI1A 1UKYA 2H2FA 1PGJA 1W34A 3O8BA 3P9YA 4G26A 4OYHA 2FDRA 1NVMB 2QUZA 5KCMA 2I5PO 1ZA2A 2F3RA 1JEQA 1X3SA 2VPYA 5KQRA 2VDWA 3C7KA 4G0OA 2F9FA 2CLEB 3EZ2A 1TQ2A 3HDVA 5ELMA 1P2DA 1CDZA 2XADA 5EJ4A 4LFBB 1AQ6A 4RYLA 4EYOA 3I0NA 3P45A 1QGAA 2ZI9A 3CGWA 4HN2A 4CTKA 4CL2A 1E0SA 5DIFA 2TSYB 4GG1A 4JT2A 3WGJA 3WK6A 4JEMA 3GVCA 3WK7A 4MV3A 2V59A 4UBIA 1VA5A 3E4CA 1DHRA 1E2FA 1OPRA 2NNWB 3AB7A 1EB9A 2HWYA 3H19A 3WK4A 4DJJA 3EAFA 4Q16A 3UENA 3N0WA 4DN6A 3R44A 3EVTA 1TA0A 2AOUB 3A3KA 1KP2A 2ZBUA 3GL9A 5BSTA 4PCUA 2ZKLA 3JAWA 4B0OA 4Y9SA 1SCUA 2XVXA 3D3QA 3P4XA 5JJBA 1JALA 3GA5A 3U5TA 1QOZA 4YH1A 3PHIA 3GX1A 3W78A 2AG6A 1DEKA 3W8DA 1C8VB 2I4OA 2HWUA 4P83A 4X7MA 4E6PA 5LQKA 2V96A 3FTQA 5K0ZA 4PCLA 2XDAA 4KSCA 1EGAA 4TOIA 1ITZA 5CXXA 1X7XA 4BUZA 2R6JA 2GTHA 4MYTA 4OAPA 3VKWA 1EAYA 3EODA 1S2OA 1TTQB 1HK7A 2CHUA 3JVVA 4TLLB 1OZHA 1YDHA 5EJFA 1T0PA 1E69A 5K4AA 3WS7A 1T6XA 3C7TA 1E3LA 3IDAA 5E7JA 4NPHA 4C4OA 1M76A 1H4TA 1NLFA 1TLLA 5AKHA 5E7MA 1OZFA 4YY3B 3BMNA 3JWPA 3PFIA 4RTLA 5CG2A 3AR8A 3EUWA 3DBLA 3H8VA 2W70A 3KPUA 1JE0A 2BEWA 1YBVA 3PC7A 3CV3A 2C7GA 1XDBA 3ORSA 4MWSA 1ZUNB 4GDFA 3V8NA 2JFXA 3IAM6 1H4SA 2SKCA 4JNCA 4UD6A 1MORA 3EEBA 3LJKA 3DC2A 4CKWB 5IVKA 3UMBA 1VL6A 4QOJA 4JBYA 4KACA 1DKQA 3D7KA 1Q7CA 5CP8A 5BUSA 3B2EA 3NI2A 1FS6A 5AICA 1YQ9A 4YHBA 5C81A 3AI3A 3ZE6A 1FVXA 1GZVA 3F5DA 4EI7A 2IYOA 3AI2A 2XUPA 2JFWA 2NX2A 1CB7A 3C1UA 3QJ5A 1QE3A 3TGWA 3AHIA 2X86A 3QE0A 4AZSA 2E4UA 2WNSA 4LWPA 3ADDA 4I1IA 4HNSA 5EMLA 2AZDA 3KM0A 4BLUA 4UXIA 4QXMA 3TPFA 1DO8A 2OILA 5ICEA 3ECAA 2O1EA 3DL4A 4OXXA 3ZJTA 2JFUA 1ML3A 2A9QA 3TW8B 5JBIA 4OMDA 3H6GA 4J9UE 3T61A 4M21A 3U1VA 2WIBA 3CBGA 4CMJA 4UNQA 4F3KA 3M34A 3WWCA 3COWA 5C5EA 5LYYA 3OKAA 1PFKA 3V34A 2YJNA 4HNUA 3KAJA 3LK6A 3P4UA 1DC4A 4PZLA 4MKZA 4J07A 2ZYWX 3K73O 3R76A 1XRJA 4A2QA 4IINA 4FDTA 3M6FA 4EZEA 3MAJA 5C5DA 3K5WA 4ALIA 2EZ4A 5K3DA 1Y0BA 4B3RB 1C7IA 2LCIA 3GUVA 1PJ2A 3PSAA 3X0DA 4XWAA 1ADCA 1Z7YA 5EJ6A 1D7AA 1PTKA 3ST7A 3RFVA 5AP9A 3ZHZA 1OT3A 3D6MA 2EV9A 4LC9A 4W63A 4Z1MD 1KK1A 2E4ZA 3PS9A 3OT4A 1Q6YA 1SRQA 3PA6A 4WCVA 1N4AA 4AVYA 1ADJA 1RXVA 2GCIA 4FOSA 2VRCD 2A5GA 3RC1A 2FN4A 4HATA 1X1SA 3EPLA 3PZRA 1DB3A 3SI7A 1MR3F 3H1PA 4D9GA 4F93B 1JQ3A 3I1IA 2B6NA 4BNLA 1UXKA 3PUJA 4C87A 5TX7A 1ZUWA 2I99A 2X77A 2HF8A 4K0KB 4ZHQA 3QMPA 1ZHHA 4KQXA 3NG1A 1RWVA 1Y63A 1ZMTA 3CU5A 4TL7A 3I3OA 4QPNA 4Q4HB 4IIJA 1Y89A 2ATEA 2IPXA 1UT8A 2RDMA 2NQ8A 1T1JA 4UEOA 4M1KA 4K88A 1ZGBA 1JJAA 3REQB 4TWAA 2F3QA 3QX7A 3X3HA 2PFSA 3SBXA 4K9DA 4OJYA 3K5HA 4PLYA 4CKBB 4N8SA 2PH5A 1EFCA 1SG9A 5FA8A 5TVGA 3QU7A 4YQFA 3FOAA 1CBUA 2ZCVA 1B15A 1AX9A 1QQ7A 1XZLA 1DZ3A 3URMA 1R16A 1NX9A 1L4UA 3IUEA 4IJQA 4MEBA 2ZBGA 2N42A 2X7JA 5CFLA 1IU9A 1EM6A 1YR1A 2G9RA 2VUSA 4BYGA 3BERA 2OESA 4HT3B 4KRGA 2ZLBA 2VRWA 3ESAA 2PTHA 1O9BA 1UCFA 4UU0A 1RLMA 3X2EA 2C8KA 1N36B 5CLGA 1VL1A 1JSLA 1MB2A 5JWOA 2BD0A 8GPBA 4JLAA 5M04A 3ASYA 5LB2A 4DRZA 5EMMA 2GN6A 4Y9UA 2YX1A 3CLTD 3IDSA 4NV3A 1SCBA 1SBTA 2FW7A 1RLJA 3SEZA 2GBFA 2FKNA 3ZXIA 2GXSA 2PXHA 1NW9B 4XQGA 4I2VA 5CB4A 4CDMA 1HZJA 4X6UA 3TO5A 5AK3A 4XWYA 4ARAA 2TECE 1WWKA 2W2KA 4EDHA 1YCHA 1LPSA 1KS2A 4PSUA 1YH3A 1Z2PX 3K9NA 3PP8A 4JJEA 1IEXA 3GJ4A 4NCHA 3FCUB 1V7ZA 2PGNA 1P0IA 4RNDB 4AUNA 2C4KA 2HQ1A 3PT9A 4KXYA 2QX7A 1SHTX 5FLXA 3O83A 4MX8A 4B09A 2FK8A 1YZTA 3S70A 4P58A 4IF6A 4NH0A 3V9PA 2FR8C 1MMFB 2Y1LA 5SZJA 4E14A 1UJMA 3AY3A 4BUJA 4Q6BA 3VSBA 4QXQA 4RPHA 1AD2A 3C24A 3ESRA 5EIBD 3AYZB 4EW3A 4R2WA 5LN1A 4QVKA 2WHPA 1DBQA 4UULA 4UDXX 4F7DA 3EIWA 2PJZA 3FPKA 4BQFA 1J23A 2EFYA 3PTLA 3GWZA 2HIAA 1B6RA 4IR7A 4XDHA 1S2LA 4CU2A 2PUGA 3MWJA 4TKVA 2I7CA 2VAXA 1NUPA 1OFHA 1UMDA 2IWRA 1GNQA 2ZSAA 4I66A 2D59A 3AV3A 3EXEB 4IV5A 4OXYA 4L6CA 1BDHA 5ICFA 4QEZA 4CKXA 6AT1A 4AP6A 1W6UA 2R4UA 4XM1A 4YJFB 5U1PA 2YVAA 3Q10A 3BIOA 4KQJA 2QZ9A 4K9KA 5DWDA 1LUAA 5E9AA 3ESDA 4JBWA 4TVOA 3EWNA 2GPSA 4LY3A 4TLAA 5LSAA 3UV7A 2DGDA 2Y71A 1VPTA 5ALXA 5TY0A 4BVEA 4DMRA 4YPOA 4RF2A 5EIAA 3DUWA 3IQWA 4Q4JB 4WASA 3CCFA 2YHIB 4G0VA 3NMUF 1C1XB 1JQEA 1NFFA 1E98A 2C9OA 4L0CA 5IZ4A 3T1TA 2CF6A 4ON9A 4EY5A 3U61B 2GXAA 1L5HB 4FUQA 4N1AA 4P5DA 2FGKA 2CVHA 4P0PB 4B6RA 1QF6A 2Y1EA 1MDBA 4CLEA 3OJEA 1KJNA 4PVDA 2B37A 4FKMA 3N07A 1L7BA 2P4UA 4PY2A 2E1RA 4FFNA 4KQHA 4D8WA 1HE8B 4BVLA 1OLSA 3O7WA 3E5RA 2O2JA 1TU4A 3BYZA 4LG1A 4O2BB 4WLEA 4NG5A 4CE6A 4D4HA 1O97D 2W6JA 1VQ1A 4W9NA 3JAKA 1QC5A 2WKRA 1GLNA 4KIFA 4B6GA 5AHXA 4LOLA 3U5ZB 1WLYA 4UNNA 5IDVA 2AK3A 4R8VA 1R37A 2PRIA 2VZ9A 4MUYA 4N40A 4X1KB 4IIBA 3WSWA 3LL4A 2PLNA 2A9JA 4B3DA 1UINA 1MO5A 3DP7A 3HYSA 4LAFA 2EZ8A 1QG6A 4H16A 3LXXA 2P78A 1VI6A 3TD2A 2WIFA 3LBYA 5K3EA 2RGNA 1NBIA 3B5IA 3OF2A 4Q15A 4WCFB 3TNJA 1NW6A 3W7VA 4CYMA 2YBDA 2RC6A 2WAAA 1J8VA 3BAFA 1EE2A 3EAGA 4BZZA 5JVDA 2B2CA 2MR5A 4MV0A 5DTEA 1YHNA 2G07A 3EIOA 3EZGA 3G2KA 2IT1A 3QKRB 2AOVA 4YJ2F 3BEOA 1U8UA 2P2SA 4H9GA 4WTOA 2YNMA 1L5NA 3ZQ4A 3KL2A 3VO1A 1ODSA 3MUEA 3A14A 4OI0A 1JEJA 4Z2AA 1TXGA 3KOZA 1KAOA 1NJGA 2IXBA 4QNRA 2OAQ1 2J09A 3GGSA 3MBKA 4F45A 1J2JA 1YB6A 5AKZA 2C0QA 2Y92A 2CXHA 5KHLB 4L9SA 4NYJQ 4OLHA 3U60B 3SXPA 1OWLA 1DAFA 3B3AA 3KQLA 1WG8A 1DAHA 4WK4B 1JHMA 3SFZA 1ISMA 2B8TA 5DI3A 4IX1A 2HRDA 3IEXA 1CLEA 4FMDF 5E95A 2VH1A 1T25A 4NJEA 4ZICA 3R8CA 3C3JA 1QBKC 3IJEB 1KVUA 4YXFA 3SFTA 1T2DA 3FB4A 1HZZC 1JSRA 1XELA 2JGDA 4NL4H 1WR8A 2XTJA 3AILA 1R3DA 2IHBA 3GEMA 3KEGA 1A5SB 4RMGA 5AHRA 5DFAA 2XPCA 5KNDD 1W5SA 2JCYA 1I2AA 3DOJA 4ARCA 3QFRA 2C00A 4BC0A 1MHTA 5EHQA 1M5TA 1T6BY 1W85B 4PPNA 5G2OA 2YJ6A 2JF0A 3BMOA 3CF4G 4Y6OA 2AQIA 3JY6A 2BN4A 2Y05A 1EVJA 2PKQP 3QXJA 4IDEA 1OFUA 3V8RA 3UTDA 1FYWA 2FSVC 3WMWA 3WK9A 4LHWA 2G72A 1KO4A 5KX5A 1MAUA 1LSUA 1YD7A 2G8NA 1KTVA 2AXEA 2I2XB 2ZUTA 3SX2A 4D42A 1DJNA 1G3RA 2EW2A 1Z26A 4MULA 4B8WA 6REQA 3LRTA 1DTWA 4CEHB 1VPEA 1RPNA 2BKVA 3VSEA 2PNJA 4MQEB 4S0XA 5C3MA 3GJYA 2H92A 1TGVA 4CEJA 1PNRA 4CKCA 3QRWA 4O3MA 2J6CA 1H6DA 3GOQA 3W05A 2YC2C 1EDEA 5JSZB 1KO1A 1PQ4A 2CJPA 1E5DA 1Y48E 1Y82A 2WJYA 3U3KA 3IIEA 4IYJA 3UY4A 3GELA 4JUDX 5GJWC 2W8BB 1M54A 2YCBA 3UJHA 4IQ4A 4MI9A 2JFOA 2YWHA 3DMDA 3K8ZA 3A3NA 3OJ0A 1MC5A 4DV1B 4QOFA 3FBTA 4YCLA 5EKTA 4PXSA 4OQDA 1U4OA 4F1JA 3KG2A 1QLJA 1K63A 4D0SA 2JZCA 3LUKA 2O2HA 1QHHA 1AVTA 3CR8A 3GPLA 1KKUA 5E7QA 3G7SA 2G06A 1BE6A 2PZGA 3G6KA 2FMHA 1NOIA 2F3PA 3BWXA 3QLVC 4J76A 2CLOB 4K9MA 4X85A 2AQKA 1E2JA 4EO7A 4UOZA 2FG6C 5C37A 5IARA 4RSRA 1GV0A 2Q1UA 1ZISA 4LE2A 4GM0A 2VTDA