4QT0A

Crystal structure of human muscle l-lactate dehydrogenase in complex with inhibitor 1, 3-{[3-carbamoyl-7-(2,4-dimethoxypyrimidin-5-yl)quinolin-4-yl]amino}benzoic acid
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
332
structure length
332
Chain Sequence
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of lactate dehydrogenase A (LDHA) in apo, ternary and inhibitor-bound forms.
pubmed doi rcsb
molecule keywords L-lactate dehydrogenase A chain
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Homo sapiens
total genus 109
structure length 332
sequence length 332
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4qt0A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4qt0A02
3DHEA 1PQPA 3FNHA 3ICCA 3PHLA 4WEQA 4J90A 3LT1A 3KBOA 4YJGB 3I9MA 3JYPA 3WQRA 4NHEA 1YE3A 1LLDA 2EWMA 1GPJA 4FGWA 2AEFA 4CV1A 5CDYA 1WVGA 4WCFB 3PFFA 1ONNA 5JLAA 5IDQA 2AE2A 3GN2A 1W8DA 3P2OA 1GZ4A 2TMGA 2H63A 2HJSA 3IUSA 1J5PA 4MVJE 2FR0A 3K30A 3GR6A 4XYGA 4AG3A 4DYDA 1B8VA 3VH1A 4M86A 2IEDA 2BFAA 3H8VA 1NPYA 2JKVA 3ONDA 2BRUA 5T5QA 3FN4A 2OMEA 3E48A 3SVTA 4HKTA 1V8BA 3I6QA 4F3YA 3GMSA 4D46A 2PGDA 3ZU5A 2VRCD 3ZWYA 3SLKA 1PJ2A 1W73A 4R54A 1I0ZA 3NKLA 3I9NA 3FD8A 4N18A 1MC4A 3DZBA 3GZ4A 4W9NC 1MX3A 1UP7A 2NTNA 3NT5A 4RVHA 2O48X 4NBTA 3HDHA 5BSEA 1ISHA 4PLHA 2CVZA 4ZHSA 3FNEA 2W90A 2RIRA 3DFUA 5I7VA 5KTKA 3F4LA 3FRJA 3WFJA 1W0CA 4KP7A 3UF0A 1A7KA 3E8XA 3LK7A 3GFBA 4ZA2A 4BO8A 5COBA 4AJNA 2GD1O 4BKPA 1IY8A 5CP8A 4Z0PA 2AEMA 5BR7A 4ZRMA 1JWBB 2BHLA 3KYCA 4GVLA 4UULA 4JQCA 3BMQA 3TL3A 4Z3KA 1DHTA 2V65A 3GAFA 2R2GA 2PKQO 2I6TA 1YBVA 3CIFA 4WGGA 4MKXA 4MVJP 4DPKA 1NPTO 4DLBA 1WPQA 3Q2IA 5CDSA 1OBFO 1ZH8A 4B3HA 4BGUA 5G0TA 4PLGA 4IPTA 3WJAA 4NJMB 3G79A 4FJ0A 1Z74A 2OORA 1P45A 1C1XA 3FTNA 1DAPA 5GZ3A 1PGNA 4ALLA 1F14A 2AHRA 1NAIA 2ZJ0A 5EL0A 3U49A 5ER6A 1GZ6A 1Y8QB 5BNIA 1V3UA 4M54A 2VHZA 1X7GA 4YAEA 2GYYA 4RPJA 3PQEA 2GN8A 1P33A 3DZKA 1A9ZA 1B2LA 3DTTA 1D7OA 4O6VA 2ZTMA 1I33A 2J5QA 2J3JA 2NV6A 3JQ7A 3BTVA 4PLZA 1TEHA 2AQHA 2WM3A 5BNFA 2Q1UA 5A3VA 2QYTA 2B36A 3EW7A 4H16A 1S7CA 3FI9A 1QYDA 1JA9A 1P9LA 1GPDG 3VH4A 3DMTA 1WDLA 2CY0A 2Q46A 4OOEA 4EUFA 1PJLA 2Q45A 2XOXA 1NM5A 1DFHA 1PR3A 2V6FA 3LVFO 4LMRA 5DF1A 1N9GB 3C3XA 2BMAA 3Q1LA 1CDOA 1SNYA 5L45A 1LSSA 1HF3A 3ON5A 3RI3A 1X0XA 1OOEA 1XWFA 4JN6B 1K6IA 3UKOA 3ZWCA 4UVDA 3RCBA 4E3ZA 4ZGWA 3W4KA 1FXSA 4JJFA 3ZV3A 1I3LA 3K8ZA 4CM8B 2NQ8A 5KJ1A 2QW8A 2XF8A 1LDEA 1ZNQO 1BXGA 4KTTE 1M67A 4YPOA 3PJEA 2P5UA 2E4AA 4XRRA 3QWIA 4TRJA 1ZJZA 5FI3A 1Z45A 4XYBA 1U7TA 1ZXBA 3WNVA 1C1DB 3MWEB 4CMGA 4B4OA 3H65A 2SCUA 3GEGA 1ENOA 3ZHBA 5AXDA 2ZJ1A 2P9EA 3C1OA 2PR2A 4CM9D 1DDOA 1GADO 1ULUA 3MEQA 3H7AA 4E5KA 3KUXA 3LT4A 4BL5A 4BO3A 1TI7A 1Y5RA 1BXZA 4NNJA 3FPLA 1B0AA 3BMNA 3RJ9A 1PEDA 4BGIA 3GUCA 2C0CA 2AW5A 1I2ZA 3AI3A 3LF1A 4PVDA 4R3WA 2ZKLA 3RSHA 4RVGA 5EIOA 3Q9UA 5IDYA 1E77A 1H6CA 3LQFA 1HE3A 3G0OA 4OAQA 3Q2KA 3H9EO 2AG5A 1NBOA 3L4BA 4W99A 5GZ6A 3JD1A 3WNQA 1I10A 2VUUA 3U4CA 3HWRA 4YCAA 4A10A 2O4UX 4L8VA 3ZCXA 3HHPA 3WQQA 4FCCA 3ULKA 5I7EA 5T67A 1XQ6A 1NX6A 3WSWA 3DBRA 3NDIA 3JQCA 1E7YA 3HFSA 3CE6A 2CNBA 3K2EA 4K28A 2WDZA 3RUCA 3V2HA 2NU6A 3KZVA 4DIFA 1EMDA 2O3SA 5JFOA 3RFVA 1HEUA 4FJ2A 2O23A 5FFFA 3GAZA 2FPGA 3I9OA 2EP7A 3D7LA 4PVCA 4LW8A 1QLJA 3E9QA 4ZQHA 3U3XA 3M6IA 3WGHA 5BQFA 3DBLA 2EJWA 4OM8A 5JAMA 1UAYA 4IGFA 2DT5A 2D3TA 1E1NA 1GUFA 1MUUA 3GN1A 3WFIA 4Q3NA 1XR3A 2NVWA 1A5ZA 4I8XA 4MO2A 2Q3EA 3W6UA 3RD5A 2AEJA 3B6ZA 3HG7A 3BZUA 3B70A 3ETDA 4H7PA 2X9GA 2EKPA 1GYPA 1LTHR 1GYQA 4U7WA 3ZU2A 1DC4A 4M49A 1EVZA 1LDNA 4IJUA 4X54A 1DIAA 5A03A 3EK2A 3F4BA 5CDTA 5JBIA 3OJOA 2NACA 4FC6A 1YB4A 3NJ8A 1ZBQA 2ZIZA 2YJZA 3UN1A 3UW3A 2W2KA 1D4FA 5CDUA 1D8AA 1T25A 3VTFA 4TKLA 2Q1TA 4RGBA 2DFVA 1RM3A 4A03A 1FDSA 3KSDO 3QA9A 3RU7A 3DC2A 2DBZA 4FC7A 4XYEA 5JYEA 4NH4A 3AU8A 2IZ0A 4I5GA 5ITVA 4IM7A 2PD6A 3DMYA 2NQTA 2VYND 2HK9A 1NPDA 1T2EA 4QXMA 5JY1A 3TDKA 3D4OA 3W8FA 4E12A 4FFMA 5HRUA 2FZEA 4CPDA 3TQHA 2DAPA 4AJLA 4CLOB 5JY6A 4RQTA 2ZK7A 4G65A 5DZSA 3NTQA 3ZGYA 2VQ3A 4XR9A 3CSDA 2YQ5A 1WAMA 4Y6SA 1XELA 4GSLA 4CQLA 4DL9A 3JQEA 3ZV4A 1M6HA 3F9IA 4E31A 3E18A 5ICMA 2NU9A 4CR6A 1AHHA 1YQDA 3UCXA 2XXJA 1DLJA 4EGFA 4CV0A 1M76A 4D79A 3H6KA 4WLNA 3ROPA 4A73A 3OSUA 4BNTA 3PHJA 2IE0A 4UUOA 5HTOA 1GEEA 1I2BA 4CMCA 2GF2A 1A9YA 3MCVA 1CF2O 3H9JA 1HDXA 3JYOA 1JN0A 2BFPA 1GY8A 3WIEA 4O59O 5HBRA 2X0IA 1ZUD1 4IY1A 3SBOA 3ZU4A 4MDHA 2OO5A 3ETEA 3IMFA 3WGTA 1KEVA 4I5EA 3SLGA 3ZWOA 2I99A 4BNFA 4BO9A 1R0SA 4Q3DA 1GZ3A 1NFRA 3DO5A 5GMOA 5J23A 4TWRA 2G1UA 2FWMX 1EFLA 1QR6A 1VL8A 1Q7BA 4KDEA 5L7YA 4DBZA 4OSPA 1KVQA 4R1TA 3F5QA 3AY7A 1HDZA 2I65A 1YL6A 3A06A 3LT0A 3NDJA 3OMLA 4J43A 3VPFA 4NK5A 4BO5A 3DONA 3GPDG 4IDDA 1PZGA 5CEFA 4PCVA 2DBRA 3AK4A 3OF2A 5IXYA 3GOHA 4EYEA 2VN8A 2UUOA 1C14A 1G0OA 3R0IA 3O26A 4XIJA 1H9BA 3MWDB 4FSHA 2YHIA 4EZBA 2PTGA 2VOJA 5ES3A 2QZ9A 2TMDA 3WWZA 3ZWWA 1DJNA 1EUZA 3G1TA 5B4TA 2R00A 4BKQA 4CLXA 1TB4A 1RYDA 3TZ6A 4BMSA 3A28A 3V1UA 3OJEA 2HDHA 5DNAA 3OFSA 4TZTA 5EPOA 1E3WA 4NMHA 2OZPA 5FWNA 1X15A 1VKOA 1LDYA 1R16A 4ONEA 2DLDA 4IMRA 1WXDA 3W1VA 2QHXA 1FDWA 3JD0A 3QVXA 4RPKA 5ILOA 4HBGA 1XLTA 2O7SA 1SBYA 4F45A 1VC2A 4I08A 4CJXA 3R3SA 1X7DA 4YT5A 3LLVA 2D2IA 1ADGA 4BO7A 3OA2A 4QFDA 3PWSA 4IQ0A 2JFGA 4N5NA 3KEOA 2A9FA 4A2CA 5JDIA 1LRLA 4YAGA 5LC1A 3I3OA 3QP9A 2HCTA 4RORA 4TVBA 4XDYA 4J4HA 2C2YA 3DTYA 2VTEA 1N7HA 3JQAA 4EI2A 3GVHA 1HL3A 3Q3CA 4LGVA 5MGBA 4WUVA 4D3FA 1XCBA 3JD3A 1DB3A 4UEOA 2CF6A 3PP8A 3LDHA 1MC5A 3UGKA 3JQ9C 1QORA 4GX5A 2C7GA 4W7HA 3ENKA 3BAZA 3VDRA 3UVEA 3ZU3A 5JE8A 4U6QA 4NU5A 1U3UA 1N8KA 2OP0A 1XU7A 2UUPA 5T8KA 4FJ1A 5MDHA 5U1PA 2VHYA 4XZ3A 3SC6A 3TSCA 4NU6A 4B7CA 1QYXA 1UZLA 3D3EA 5JAQA 3CKYA 4CM4B 5JDIC 2I76A 3L6DA 2POQX 2QYSA 4DC0A 3RBXA 4RCVA 5HS6A 4FW8A 2E37A 5AXAA 3W4IA 1QXSA 4PG4A 1B8UA 3E6AA 1U9JA 3DZIA 1DHRA 1R4NA 1C0LA 3AW9A 2CUKA 1CERA 3GZNB 3OIFA 3PHHA 4II3A 4CMIA 4IDAA 5JYDA 4ZRNA 4PLTA 4G5HA 4IZIA 2HMWA 4HFMA 1YOVB 1B14A 3H5RA 3RBVA 2WEKA 2DPHA 4CM1A 2RH8A 1QYVA 3ASVA 4UUMA 3PVZA 5KIAA 1LLCA 3NV9A 1EE2A 3CPSA 1H0KA 3ETGA 4QO7A 3ROQA 1P44A 5L3ZA 4B4UA 2I3GA 3SEFA 1EEHA 3NEPX 1GAEO 5A04A 1O0SA 1A4UA 4KQXA 4WNCA 4XB1A 4RZIA 3WJ7A 3KOUA 2PY6A 1HT0A 2B37A 3CUKA 3IJPA 4JROA 1SCUA 4R5HA 3A14A 3OEWA 1DC3A 3JQ6A 4AFNA 2CD9A 4YJDA 2I3AA 2E6UX 2GPTA 2YFHA 1U3WA 1TT5B 2Z1NA 4QUKA 3EMKA 4CQMA 3WQSB 1MA0A 3DXFA 3IS3A 4R16A 1F12A 1JKIA 1PTJA 4EBFA 4HX5A 2NADA 4ND5A 2P68A 4S3MA 3KSUA 3WICA 2BGLA 4Z3DA 4BO6A 4J4TA 2H6EA 3AI1A 2DTDA 4LSMA 3QVSA 2GZ3A 2Y93A 3GHYA 3KRTA 3M2PA 4IIUA 4U6SA 3MOGA 4Z0TA 4K6CA 2B35A 4C4OA 2AQKA 1UUFA 4A27A 4EUHA 4RO0A 2HAEA 4OQZA 3DBVO 1KBZA 5JCXA 2W2KB 1BRMA 3QVOA 4J6FA 5IZCC 1ZIDA 5LDHA 4Y6RA 2PZLA 3AFMA 5EESA 5AVOA 2PLAA 4L4SA 2Q2VA 3ZWXA 1WP4A 2QRJA 4U0JA 3V2UA 1NR1A 1U2DA 1JDJA 2X0RA 1EUCA 2NWQA 4JBHA 3RAJA 4B3IA 3QWHA 1DOHA 4ALJA 2OXIA 5G0WA 4C7JA 3CMCO 1K6XA 4RPHA 2HO5A 2I67A 3I9JA 4I9UA 3DEYX 5L53A 3K31A 3S55A 1H6BA 2B83A 1NQOA 2V7PA 4NK4A 4OHUA 1P1HA 1XHLA 3ZV6A 1GQQA 1L1FA 2B5VA 2D1YA 5AOVA 1PL7A 2FSSA 3EAGA 5ICSA 3PJGA 3QWAA 3QJ5A 3VOSA 2OHXA 1ZEJA 4D0RA 1HE5A 1P1RA 3UCFA 1JQBA 5U4QA 3KYDA 4GX2A 4NR0A 1H6AA 1BVUA 3JD4A 1PJTA 5F1KA 4AICA 4DMLA 3WGOA 4YDRA 3PFWO 4MINA 4UVGA 5L51A 3AUAA 2BGKA 3I4CA 2W98A 1PGOA 2G5CA 5TT1A 3WDSA 4Z9XA 4XWYA 4GMFA 3JQAD 4OOFA 3RC9A 4UAGA 5C37A 1ENYA 1JTVA 3TZCA 5ER9A 4N5MA 1ISGA 2PK3A 1YQXA 4D45A 4GL4A 1O94A 1EK5A 5JDCA 1HRDA 3GDGA 2NUAA 3O9ZA 4XGIA 4Q9NA 3FR7A 1E3EA 2PFGA 2YW9A 3U4IA 4G2NA 1FJHA 2ZB4A 5CDGA 5K0ZA 4CM9A 4ITUA 5TSDA 1I5RA 1E0DA 3TRIA 2NVUB 3DHYA 5B12A 3C85A 5C7IO 1SMKA 3IDSA 1YBAA 4GSKA 1M75A 1DPGA 1PSDA 4E5YA 9LDTA 3ZWNA 4J91A 3GEDA 4MVJI 2EGGA 3TOXA 3NYWA 2B5WA 3L07A 3VH3A 2ZTLA 3RVDA 4DLLA 3DOOA 4NBRA 2I5PO 4U0KA 3RASA 3ZNOA 4BNKA 5HWSA 4GKVA 1DRVA 1HDYA 1I3KA 1U28A 2X5OA 2NU7A 4JXKA 1R4MB 4DQXA 5DOZA 4OKIA 5EMHA 2BFOA 2FSVA 2X23A 3PI7A 3DQPA 3SC4A 4B7XA 4KMSA 2QG4A 1E3WB 3GA0A 4EJMA 3F5SA 1SOVA 4BNLA 2FR1A 4O0LA 1BWSA 5K6AA 4XR4A 3AOGA 4YJFB 5ADHA 2C07A 2QIOA 1C3VA 1KVRA 4DVJA 3LZ6A 2YV2A 1Q0LA 4BMNA 3JQ8B 2FPPA 2P4HX 1V35A 1GCUA 3WBFA 5CG2A 3PPIA 3INRA 1G6KA 2D8AA 5TJ9A 1EE9A 2PV7A 4DC1A 4YRAA 3CEAA 1SAYA 3B1KA 4CQMD 2W2LA 4JNKA 1WW8A 3ZWVA 4KTVE 3RWBA 2O50A 4FGSA 3OQBA 2J3KA 4ZQEA 4CM6A 2NVBA 3W8DA 1NQTA 1Q7GA 3ST7A 3ZV5A 3FNGA 3PZBA 3RBZA 4BKUA 2G82A 1MXHA 3GY0A 3PLNA 4JGBA 5G0VA 3AFNA 1EFKA 1HDRA 2PWZA 3ADPA 1AGNA 3QVTA 3KEQA 4XKJA 4M55A 4NBWA 2D5AA 1FDUA 4E2YA 3OBBA 4ZICA 1HDCA 4JX8A 4L0QA 1IHYA 2J3HA 2AE1A 1ZMOA 3JQFA 1LQTA 4IDCA 5F1PA 1YDEA 1X1TA 3W8EA 2WD8A 4K1LA 4PLFA 3W4JA 2VT2A 2Q4EA 2JCXA 1JU9A 4CLRA 4Z0HO 1TXGA 4NZ9A 2X5JO 4MP8A 5TGDA 3RU9A 4EW6A 4GX1A 3RUDA 3JSAA 4B3JA 4YJHB 1I36A 2IYOA 4WJZA 4R41A 4J9UE 2NTJA 3RQSA 1MFPA 3GPIA 4MVJF 1CWUA 1Y81A 2VYNA 3UICA 1KY4A 2AQ8A 2WE7A 4D7AA 2C7VA 7MDHA 1ZJYA 3GRKA 1FMCA 4MVJG 3UH1A 4R01A 5EINA 1Q1NA 1Z82A 1NHWA 3FHLA 2ZTVA 2P9GA 2IXAA 3AUUA 4CL3A 4CUZA 1Z75A 1KETA 4ALIA 2Y1GA 1CEQA 2JD2A 4IJKA 1VE9A 3E1KA 3VVBA 2ZQZA 3ANLA 1SB8A 1Y6JA 3E5RA 3H5AA 3MJEA 3QWBA 1C0IA 4XQCA 5IAAA 3FF4A 4ZVVA 1B8PA 2QX7A 3CTMA 4NBVA 4E21A 1KVUA 3CINA 1R0LA 1AXGA 1A71A 4OIMA 4TZKA 2ZCUA 4UVIA 4CMJA 4BMVA 1VLLA 1U8FO 4RV9A 5KJ6A 2VTDA 3AM5A 1DBVO 2GO1A 1X7HA 2AXQA 3DMTC 3RC2A 3TZQA 3AY6A 3QY9A 5JS6A 1ISMA 2X7HA 4HP8A 3WLFA 4MVJM 4LCEA 3VC7A 1IOLA 3B1FA 3NX4A 1BDBA 4UUPA 1PX0A 2OOSA 3BMOB 3G1UA 3MOIA 5A9SB 3O38A 2DC1A 1JWAB 2EHDA 1SOWA 3SJUA 1A27A 4B79A 3Q6IA 2RBEA 3KVOA 4JJGA 4BOYA 2ZATA 3WSVA 1WZEA 3JQGA 5CEJA 4WLUA 5HM8A 3GT0A 3DHNA 3KTDA 2YFQA 4Y67A 2E82A 4FR5A 3GQVA 2ZTUA 3H2SA 1Y1PA 1AXEA 2NNLD 3MJVA 4TVOA 1U2GA 2GNAA 4J2HA 2OL4A 4RVDA 5I8WA 2X8LA 2BGMA 2WD7B 3AOEA 4YEDA 4B7UA 2V6GA 2DM6A 3EDMA 4PGFA 1E5LA 5C7LO 4IDGA 5KWEA 3INTA 1HYGA 2CDAA 3PWZA 3PQDA 4IINA 5CEEA 2Q50A 1PU2A 4P4LA 5H81A 5EJ2A 2P2SA 4ZJUA 2FR8A 3L4SO 4IDFA 3IP3A 1JKFA 5A9RA 3D64A 1IL0A 1EBUA 1N1EA 5DT9A 5I7FA 3VAZA 1QV6A 2X4GA 3ZNQA 1DFGA 1PZFA 2PD4A 1NTOA 3MTJA 2ZYAA 4BGVA 3O8QB 4ID9A 3LC2O 4NIMA 5CPBA 4XQ9A 1UXIA 1GV0A 4WOKA 5K9ZA 1NQ5A 2VT3A 4E5PA 3DOJA 1F17A 5A02A 2AMFA 2VZ8A 3OJFA 4BIIA 3DZGA 1Y7TA 4FQ8A 3VPXA 2JD1A 3PIDA 5F5NA 2FOIA 4HNGA 3KETA 4EEXA 1VM6A 3VPSA 1MG0A 4HWKA 1YJQA 3OQ1A 2JL1A 2W2LD 3WG9A 1R0KA 2CDCA 1BSVA 1DO8A 4S1VA 3L4BC 4AJJA 3HN2A 4YXFA 4NFYA 2GUGA 1BW9A 3WXBA 4FIZA 4LN1A 1UR5A 1ADFA 2DPGA 5I7SA 1YB1A 3WGIA 4MJLA 1E6EA 3BMCA 4J1TA 4LCJA 4FPXA 3UCEA 2VYVD 2FY8A 5T57A 2IRWA 2WE8A 1Y8RB 3DZFA 3I6IA 1LU9A 1IPEA 4F6CA 1U8XX 4J1NA 1ZCJA 3CZRA 3S2GA 4WOJA 2PGJA 4YACA 4DA9A 4PLWA 4IZHA 4WE3A 1G0NA 1NHGA 3QQPA 4DQUA 3P2YA 1RYEA 2ZB3A 4PRKA 5IFLA 5DCYA 2Y68A 3OM9A 4FOSA 4RZHA 2O3UA 4NJOA 4TRNA 2X0JA 3TWOA 4O5OA 1CRWG 1NVGA 1UXHA 3H5NA 3OJ0A 5KVVA 2PKQP 1R12A 3GG9A 1VSUA 4BKOA 1DFIA 3MJ4A 1NAHA 2DBVO 2P9CA 2PZJA 1ZK0A 1RWBA 2HU2A 4JLWA 4KUGA 4N5LA 4EJ0A 1WDKA 1YXMA 1LLQA 2Y67A 1I30A 2YHUA 4I5DA 3JTMA 1GU7A 3F1LA 4XQEA 2VNSA 1U7HA 5JMWA 3I1JA 2E49A 3C1AA 2EG9A 5BT9A 1PGQA 3ONEA 2Q49A 8ADHA 4D41A 4YAKA 3L9XA 3VPGA 5TIIA 1IYZA 1DIGA 3U9LA 3LU1A 4J2OA 4ZQFA 2J3IA 2Z5LA 1GUZA 1E7RA 2G0TA 4R9RA 1M66A 1JVBA 3RUAA 3UFXA 3D0OA 4XJTA 4L73A 3KYCB 4IXWA 3OICA 5TLSA 3BMQB 1T1SA 4RF5A 3AUSA 3M1AA 4RVUA 1B7GO 4ZQGA 1C0PA 1N5DA 4Q3BA 4E2ZA 4PG6A 1YQGA 4DIOA 5F3RA 4DGSA 1TLTA 3FNFA 1LI4A 1O9BA 3MJSA 3QVWA 4AJ4A 3WB9A 4R1NA 2X86A 1T1RA 5AYVA 1WMBA 4P8RA 1EDZA 4LRTB 3DZJA 3EC7A 4PZDA 5G4KA 3NTOA 2WWRA 1YS4A 3NAQA 1H6DA 4IS3A 4DUPA 1C1XB 2HKIA 4R51A 3X2EA 4EEZA 1KS9A 4I5FA 4OH1A 1U3VA 1EDOA 4R1UA 1T2AA 4P4GA 4NI5A 3GMDA 1YB5A 3KO8A 3M2TA 2EIHA 2Y05A 2BKAA 4R3NA 1PGPA 3C1TA 3ZNNA 3KLMX 3OP4A 4FFLA 4E0BA 5G0UA 1AUPA 1ZSYA 2B0JA 3ITDA 3JQ7B 3TOZA 4N54A 3KHUA 3ZDFA 1GEGA 5ENVA 3H3JA 3N74A 4YTEA 2PZMA 1CQJA 1LC3A 3RKRA 2OP1A 4HFNA 2GZ2A 1P1KA 4YJGA 4XX0A 1LA2A 5A06A 2NM0A 3QW2A 1SPXA 1YWGO 1EVIA 2X5KO 3L6OO 3V8BA 3WGGA 2GN4A 3D1LA 1T4BA 1IZ9A 1XQ1A 3BTSA 4WCFA 2HRBA 4GWKA 4E5NA 2CVQA 2O4CA 1RM4A 2D0IA 4E2XA 2IXBA 1AHIA 2X22A 2V6BA 4RF2A 2WTBA 3TL2A 5JAZA 2X9VA 1LRJA 4YT2A 1UXJA 2NU8A 1D1TA 2UV8A 3ANMA 4OYRA 2NSDA 4AJIA 3PTZA 4AL4A 1PJ3A 4PZCA 1FDTA 2JCYA 4PFJA 3WIDA 4EDFA 3L0DA 1P74A 1BXGB 2GERA 2NLOA 1G1AA 3FWZA 4LSWA 3Q11A 1C0KA 2FHSA 2RH4A 5JO0A 3D3WA 5DP1A 5LCXA 2FZWA 2R00C 3VZPA 1SZJG 4DYVA 4JP3A 5CPFA 2Y99A 4E13A 3PRJA 3BHMA 2IDZA 2D59A 4GGOA 2JFFA 1MP0A 1JVSA 3ABIA 4MVJD 1YONA 1RM0A 3K92A 3LLSA 1CQIA 2I66A 5G4LA 2EKLA 3E5MA 4GVXA 1E1LA 2DQ4A 4HADA 3UAGA 8LDHA 2C82A 2Y0EA 1Z73A 2HLPA 4OJNA 4GBJA 4Z9FA 4H3VA 2OBNA 2VNAA 4W7IA 1T2FA 4GLLA 1SB9A 1J4AA 3OECA 4MKZA 3UOGA 3IOYA 4WECA 2CDBA 3TPCA 3L9WA 4PIVA 3QHAA 3GNSA 3BMNB 1M6WA 5L7TA 3MTGA 1NQAO 4FDAA 3WGYA 4NJMA 3EUWA 3E03A 5IDWA 4K6FA 5JC1A 3H9GA 4YRBA 2Z95A 4GWGA 1ORRA 1HZJA 1FF9A 5DDIP 3TZKA 3WGQA 2WYWA 4CMEA 1GCOA 1D3AA 1EK6A 1H9AA 5JAIA 5BNTA 1Y8QA 1K0UA 2JAPA 1F8FA 1BXKA 4A0SA 1KEWA 5AXBA 1SEPA 5A1TA 1ONOA 2XAAA 4II2A 5DN9A 1IE3A 2BI7A 5U9CA 4Q3EA 1GV1A 4BV9A 1UP4A 4ALMA 3DBRB 4INAA 4UVEA 2YZ7A 3HQ4O 3PDUA 2PGLA 5KVSA 2CSUA 3WYCA 2QQ5A 5T8KC 3ZZNA 3WMWA 5FYDA 4DPLA 1LNQA 5H82A 3WMXA 1V3VA 4DLAA 3AU9A 2VRBA 1YDWA 4M87A 1XKQA 3EVNA 3H4VA 1PJQA 4E5MA 3MZ0A 1N1GA 1UZMA 4F6LA 2QRKA 4MIOA 4B8WA 2YV1A 3JQDA 1VKNA 3DBLB 3GGPA 2XXBA 1B15A 1N9GA 3ONFA 4LVCA 2C59A 3GF4A 4ALNA 1F0YA 3R1IA 4YB8A 3LC7O 3QRWA 5EERA 4CM5A 1Q0HA 4UEKA 1DC6A 4BNJA 3W6ZA 1OFGA 4J1QA 3BMCB 2PH3A 4YBZA 4ZN6A 1RM5A 4RLSA 3ROMA 1IUKA 1O95A 4FN4A 4MVJH 3V1YA 4CM8A 1LRKA 5AXCA 5THQA 4IIVA 4BNWA 1I01A 4R1SA 2JHGA 4XA8A 4PG8A 4D0SA 1X13A 4OKNA 4NG5A 1HE2A 3LF2A 2ZB8A 3K5PA 1YVEI 1HYEA 4R5MA 1E92A 4I1IA 4XQGA 1I2CA 3HE3A 1Z6ZA 3G49A 3U4DA 3ENNA 1QP8A 3JQBA 4PLPA 1C1DA 1ML3A 2A35A 2EW8A 2ZYDA 1UAGA 3NGLA 4FOOA 5B4VA 3IKTA 4H15A 4JCOA 1E7SA 2BI8A 2CVOA 4BNVA 4QT0A 3F3SA 1PJBA 4P4NA 3D4PA 7ADHA 1LDGA 2O3TA 4CL8A 1U5AA 2C20A 3A9WA 4CM3A 1JKJA 2HUNA 1GTMA 4M1QA 5GZ1A 1CETA 1PIWA 1ZK3A 1ZXLA 5F21A 4LISA 1ADBA 1QRRA 3FTPA 3KM0A 3NRCA 4XRGA 1O8CA 2X6TA 3RKUA 3V1TC 5BSFA 2DFDA 4CQLB 1V6AA 1X0VA 4QSMA 3PJFA 5L4NA 1DIBA 2X1HA 3U09A 1PQWA 1Q2XA 3WX0A 5KNLA 1WMAA 1K89A 1NVTA 3QE3A 1DC5A 1ZMTA 3ZW8A 3GNTA 2W8ZA 1E3SA 4HXYA 4YAJA 2JCVA 5T64A 1T2DA 4OMUA 4NDNE 2YDXA 1YGYA 3JCZA 5HA5A 1ZVMA 5KOIA 2JFHA 5THKA 3ORFA 1OMOA 2Y1OA 3V5NA 1VPDA 1QSGA 3IAHA 4RPLA 1E3JA 2HK7A 3I5MA 5ITWA 4IJVA 5A5FA 5JXWA 1W4ZA 1T26A 4WNIA 5COAA 4YVFA 2BH9A 3WGZA 2DBQA 3PGJA 1TVEA 1GD1O 2HMTA 4JBGA 3DZHA 3RUEA 3QWFA 4CMHA 3FWNA 3EHEA 5KJFA 2JHFA 1HDOA 1H93A 3VZRA 2J8ZA 4A7PA 2RHRA 2EGHA 1N2SA 4EJ6A 1RKXA 1HWYA 3AM3A 1DJQA 4IMPA 4D43A 1XU9A 5CG1A 1ISIA 1HTBA 3GVPA 4RDHA 3UHAA 2PZKA 1KVTA 2RAFA 4HFRA 4BHTA 4IBOA 1MFZA 1LBEA 4M89A 2AG8A 4TSKA 4D42A 1MXFA 4DBVO 1BVRA 1ZO8A 3AJRA 4FFNA 4WLVA 2YHIB 1A7AA 2F1KA 2O2SA 1E3LA 3PJDA 1QG6A 4W9NA 2I9PA 1LDBA 2RCYA 1U5CA 3HN7A 5JDCC 1DXYA 4FB5A 4BNZA 3BTOA 2BF7A 3G3EA 5DOVA 2RHCA 1I3NA 5A9TA 5T6BA 4Q3AA 4AJ1A 3PDJA 1Y9EA 1PQUA 2B69A 3H3FA 4DXHA 1ISFA 3RC1A 4BGEA 4D3SA 1EQUA 1D1SA 4J1SA 1AN9A 1E7MA 1H2HA 1U1IA 4AJKA 4MOWA 4DIBA 3IQDB 4BQRA 2W4QA 4PRLA 4CODB 5FEUA 3WS7A 4UUNA 3C8MA 4XEHA 4PLYA 2LDBA 5DBFA 4CLOA 1HETA 2WYVA 5A3JA 1NWHA 2Q4BA 3D3WB 1LQUA 5G2OA 2X9NA 1OZAA 4CR7A 1GQYA 4I9NA 5TRTA 2EV9A 2DTXA 3JQAB 4GPD1 1NP3A 3JD2A 4BNGA 2IZZA 4YAIA 2HQ1A 3S8MA 1E1KA 5DBGA 1RPNA 3NJ4A 2UDPA 1Q7CA 2CFCA 2VYVA 1PWZA 3GC6A 4J4BA 3K2BA 3MJTA 2Y66A 5K6AC 1XEAA 1BTOA 2DTEA 4YWJA 5I9LA 4BNHA 4KOAA 3T4EA 4GX0A 2P5YA 2C29D 1WWKA 4B4VA 4ND2A 1PL8A 1VRWA 4CMBA 1PS9A 3GFGA 1QV7A 1RJWA 3GLQA 4MP6A 4NQZA 4QTZA 1E5QA 2X0NA 4OXNA 1B26A 6ADHA 3O03A 2DVMA 2P91A 3RC7A 1DAOA 1MLDA 2H1SA 2G76A 4YRDA 5CAEA 4ALKA 1E6UA 1P0CA 4FD3A 1KC1A 3VZSA 4GKBA 1ZK2A 2X58A 5I9MA 4J3FA 1ADCA 1IHXA 3AI2A 3E9NA 4RF3A 5HS4A 3G17A 5JSFA 1R4NB 3GGGA 4PG5A 2Q2WA 2VWPA 3S2FA 2O3RA 3WWYA 4CMIB 1K5HA 4FFRA 3ICPA 4TKMA 4QECA 2OFPA 4KQWA 1VL0A 2O3JA 4RVFA 4E2WA 5L40A 3NGXA 3DB2A 1VJTA 2H5LA 1EBFA 2A94A 3LSYA 5B1YA 2NTVA 3JQFC 4WCDA 3HJAA 3GUYA 1EZ4A 4HFJA 3U5TA 2VWQA 3B1JA 3IUPA 4J7CA 4E30A 4YQZA 2PD3A 1GDHA 2GGSA 2VUSA 3ADOA 4IGEA 4CLDA 3SJ7A 1WDMA 1W6UA 3GHHA 3JYQA 3R6DA 3S2IA 3GVIA 4MIEA 3BHJA 5IDXA 4ND1A 4OGWA 4JP2A 4XGKA 1LSJA 1NFFA 4K9DA 3HSKA 5F5LA 1XIVA 3FCOA 3TJRA 2BD0A 3GK3A 4D3DA 1X1EA 5B37A 4CQMB 1I8TA 3VTZA 4QFCA 3IC5A 2Q2QA 5LDGA 4J0FA 4YR9A 2FN7A 1R15A 2VZ9A 3ZWBA 5IZ4A 1ARZA 1BHSA 1PWXA 1LEHA 4ZU3A 5TX7A 4BO2A 3I23A 4P22A 2Q1WA 3ZH2A 2WMDA 3TZHA 4W82A 1QLHA 1NNUA 4TRRA 2XPCA 3PEFA 1JLLA 2VUTA 1P77A 1HKUA 1IPFA 2B4TO 1GFSA 4OXKA 4Z6KA 4WEOA 1NFQA 5EQFA 5C7OO 2VZ0A 3EY4A 1HSOA 1E6WA 3OH8A 2IZ1A 1CYDA 3ANNA 1PJCA 1DIRA 5L7WA 2GZ1A 4E33A 4DMMA 1VL6A 3I9LA 2HMSA 3DDNA 2GLXA 1T4DA 1FK8A 3AWDA 1ENPA 4BUCA 2FP4A 1UH5A 4JK3A 4AJEA 4URFA 4CMKA 3OETA 4R9SA 3H9UA 3CZMA 4NBUA 3GVCA 4YA6A 3DWFA 1HXHA 5DP2A 1K6JA 4CM4A 5TQVA 5A5EA 4OO3A 1F06A 5C3MA 5JMPA 1XA0A 3KB6A 3PHIA 3TNLA 3K6JA 3HDYA 1V3TA 4HY3A 1KEUA 1X14A 1AE1A 1ZW1A 3AOEC 1K3TA 5IXSA 3JV7A 1UJMA 4WKGA 3OIGA 2JAHA 1ULSA 3ITKA 3KYDB 5TF4A 3SX2A 2D4AA 3D5QA 1I24A 4ROSA 1N7GA 4KUEA 4TROA 5IN4A 3BA1A 3GZNA 4J7UA 2PNFA 3ZWMA 2LDXA 5EQDA 5BSHA 3DAFA 3GH3A 4XIYA 1YOVA 2IODA 4ZD6A 2YV3A 1HLDA 2C2XA 3DBHA 3L6EA 3PGXA 5KKCA 3IJRA 1YO6A 1SO8A 3KV3O 2ZQYA 3GGOA 4PLVA 2EP5A 5JNLA 3COSA 5TT0A 1HLPA 4Q3CA 2F00A 3FSRA 1VSVA 3RJ5A 1K2WA 2IEBA 5CHEA 5KJCA 4MVJA 2YDYA 2GCGA 1T24A 1LLUA 5DCUA 3PLRA 3QSGA 2ZYGA 3ZN2A 2HK8A 1HYHA 3RUFA 4R4JA 3K9QO 4ILKA 1TT5A 5JW6A 4KDFA 1R37A 4RJTA 1ZSVA 4RDIA 2Q1SA 1S6YA 1VI2A 4UVHA 3A1NA 1ZKMA 5CFZA 1Q0QA 2VHVA 4YYZA 4WASA 4IXTA 4IQGA 5JPIA 3E82A 2J6IA 2VWGA 3NUGA 1UDAA 3DL2A 3K96A 1UDCA 5TS3A 3ZWAA 1UXGA 4NFHA 2R6JA 3WOHA 1GYRA 1ZEMA 5EN4A 2PKRA 3AUTA 5C5IA 3F1KA 3HB4X 3I9KA 4MIYA 2Y1EA 3GVXA 1XYGA 1ENZA 2PH5A 4MPDA 4BNXA 3I52A 5IF3A 4BNUA 1P0FA 1PS0A 4OQYA 4XDZA 3FPCA 1JAYA 1XSEA 2IYPA 2OGUA 2UYYA 3H2ZA 1XDWA 2BELA 2V6MA 3T7CA 1U4OA 2ET6A 3EVTA 1E7QA 4J0EA 4HNHA 4BO1A 3ZNPA 4EUEA 1DRUA 1U4SA 3TFOA 3DFZA 4W4TA 1P1IA 2C54A 3DOCA 2C5AA 1M2WA 3ASUA 4BS9A 4J9VA 4BNIA 4CUKA 2D5CA 1A72A 1EQ2A 3F6YA 3U4HA 1HSZA 3PYLA 1E3IA 2Y1FA 1V0JA 3C7AA 5L9AA 1WLYA 4JIGA 4WPGA 3HADA 4RLHA 1J49A 2QRLA 1UDBA 2GSDA 1HZZA 4BKRA 4BQPA 4GLOA 5FF9A 4BV8A 3Q9NA 1XGKA 3CMMA 3MJCA 1Z7BA 3AM4A 1KIFA 1QMGA 4TMFA 1PJ4A 3C7CB 3L77A 2GDZA 5IG2A 1J0XO 2Y0CA 1PR9A 3RFXA 2JD0A 3ZI0A 4KWHA 1NASA 4YQYA 3PIIA 4JJIA 4Y9DA 1NR7A 3VZQA 4FS3A 2ZCVA 4UEJA 1WZIA 3TFQA 5L4LA 4N7RA 4TRMA 3LT2A 3NT4A 2UVDA 3KYBA 1IZ0A 3GEMA 5KVCA 4FFPA 3C7DB 4CLRB 4DRYA 1P1FA 1H5QA 4FBGA 4DREA 1DSSG 2DKNA 4XYLA 2DU8A 1BMDA 4XD2A 4IDEA 3D5TA 3GDOA 5GY7A 3PXXA 4CLHA 1QYWA 1LX6A 1SEVA 3F47A 1DEHA 2QZZA 3DAGA 2VHWA 5F1OA 3B20A 1A4IA 4A5OA 1I3MA 1LUAA 4GH5A 3I4FA 4HUJA 1MGOA 3PYXA 3BHIA 1L7EA 2NVUA 4O1MA 3ZHXA 4U5QA 4G81A 1HE4A 4OSOA 4ND4A 4GI2A 2FPIA 3F46A 1OC2A 4BVAA 2GN6A 3VH2A 1V9LA 3PYMA 2A4KA 5DBIA 3BTUA 1E1MA 2GRAA 2OUIA 3HDQA 3WTCA 3LC1O 4L9RA 4QQRA 3NTRA 2YY7A 1H94A 4AJHA 3HNPA 2AQIA 4J49A 4RVSA 4A26A 3PZRA 3CXRA 2WJPA 4L75A 4NPCA 3EZLA 5JCJA 5DCWA 5A4DA 1PL6A 4Y8VA 1R4MA 3FBTA 3WR5A 4B4WA 3UXYA 4EITA 2EW2A 3WBBA 2DUWA 4KWIA 1YBMA 3HDJA 2HMVA 2YYYA 4MP3A 4XGNA 3JQ9A 1B3RA 2YQ4A 4RL6A 3X2FA 2O3QA 4YJFA 1P1JA 3IIEA 2A92A 4WCFC 4F46A 2HJRA 4WLOA 4Y6PA 3OIDA 2Z1MA 3N7UA 1ONPA 1GUYA 5I8ZA 4ZQBA 3KLPX 3JQ8A 4IJWA 3JQGB 3RIHA 2HMUA 1PZHA 1YKFA 3QIVA 1ZSNA 3M1LA 4E6PA 3GG2A 3NT2A 1YH3A 4E4YA 3HUDA 1UXKA 4CR8A 1FDVA 4BNMA 4C7KA 4JBIA 4BB5A 3PK0A 2YUTA 3A4VA 5DULA 4DPMA 2OBYA 3JYNA 1ZK1A 1JAXA 4UREA 4GGPA 3BIOA 1O5IA 1BG6A 1ID1A 4CUJA 1DLIA 2ZB7A 3ZHZA 4R69A 4DQVA 4YT4A 3U62A 4K26A 4L74A 3RFTA 2Y0DA 4RPGA 2CF5A 2H9IA 4L4RA 3WYBA 3NDRA 4QEDA 1U3TA 1CJCA 3RUIA 1VJ1A 1SC6A 2J5KA 4OXYA 1ZK4A 3O4RA 4ND3A 1MV8A 1R66A 1GR0A 3ZW9A 3WLEA 1PZEA 4R68A 5KCZA 4L4XA 1LJ8A 3T7EA 3GNQA 4RF4A 4DTIA 4D44A 1OI7A 1GL3A 4OL9A 1HDGO 1PJSA 3DAPA 3ROKA 4YT8A 1UP6A 1DRWA 3OA0A 1KOLA 4B8ZA 4ESOA 2EKQA 5KKAA 1KYQA 3V2GA 4YJHA 1P3DA 3TN7A 4WK6A 5G0SA 4TQGA 2FRDA 4QX6A 4CV3A 4IDBA 5B4UA 3N58A 1YJ8A 2HRZA 3FBGA 3GRPA 5ILGA 3EYWA 4CMAA 2Y1CA 3VKVA 3RROA 3INGA 2BFMA 1O89A 5ENDA 3ZWPA 2UAGA 2VRCA 1NVMB 4J7XA 4CMEC 1I32A 3DBHB 3HB5X 3PHGA 3Q0EA 1BW9B 4PG7A 3VPHA 1PGJA 1T2CA 2CMDA 2EEZA 2JJYA 4P38A 4AJPA 1J6UA 1LSOA 2J5RA 1TA4A 2VWHA 3LYLA 3H9QA 1Z7EA 1P31A 4J16A 4AJ2A 1NXQA 5FI5A 1R6DA 5IZCA 1WNTA 3I83A 2GR9A 3QLJA 2CZCA 1KEPA 1IB6A 2AA3A 3HFGA 4O63O 3E9MA 3JYLA 3OJLA 3CH6A 1YL5A 4GQAA 3VVCA 1BDMA 2EXXA 2EERA 3PQFA 1KERA 3R3JA 4LMPA 4I9HA 4BO4A 3BMOA 1F8GA 3SXPA 5A9SA 5KVQA 1Y5MA 5TJHA 3PWKA 1NYTA 1ZZEA 1LSUA 1GQ2A 5JO9A 2B4QA 2VCYA 3P7MA 1UZNA 3P5SA 3T4XA 3VHRA 2E48A 1PS8A 2VOEA 1KVSA 4Q39A 4CM7A 1LXCA 1MG5A 1IULA 5BSGA 2Y1DA 1OAAA 3VKUA 4PZEA 2FMUA 4W6ZA 3IKVA 4WLEA 5IJZA 4IS2A 2WD7A 1H2BA 4WLFA 1EVYA 1BGVA 1OC4A 5L95A 5H83A 1B3BA 3EZYA 5TNXA 3ZHYA 3C24A 2VHXA 4CV2A 1QKIA 4M8SA 3EGOA 3JQBC 4MKRA 3TF5A 3OEYA 1N92A 3BYZA 4AJOA 3DR3A 4NFSA 1LC0A 4BO0A 5JCJD 1LDMA 4XB2A 1B16A 1KC3A 1NWCA 5KJEA 4LRSB 4XJSA 1JW9B 5L4SA 2PA3A 3IP1A 3O8QA 2P4QA 4XYMA 3OHSX 1ISJA 1ZFNA 5IN5A 4Z9YA 1E7WA 9LDBA 4GAEA 1TT7A 3BXXA 3P19A 4CLEA 5G4KB 4RQUA 2B4RO 4DWVA 4PLCA 3HZZA 4KZPA 1DIHA 6LDHA 1EVJA 4KUHA 2Q99A 2O2YA 3KSZO 2WSBA 5A05A 5JC8A 2DUUA 1YL7A 1KY5A 3WYEA 1O6ZA 4E32A 2WYUA 4BNNA 4IQ8A 2GN9A 4Y98A 2O7QA 3GDFA 4HV4A 3K73O 3WTBA 1L7DA 2GASA 2HSDA 3RUHA 1VJ0A 3STHA 4FFOA 1XG5A 2EJVA 4U8GA 5TC4A 3IL2A 4AVYA 4LVUA 2EF1A 1Y9AA 2ILTA 5AQ1A 4QO8A 3OQ6A 4GMGA 3QV1A 1CIVA 3AY3A 5I9NA 2C5EA 5COQA 3VDQA 1QYCA 1EUDA 1MB4A 4L76A 3D4NA 3FR8A 4BB6A 4BNYA 4PN3A 3KXDA 1YRLA 2G17A 4LK3A 4XCVA 2BLLA 1Y8RA 3U0BA 3S2EA 4IUYA 3UUWA 3S1LA
chains in the Genus database with same CATH superfamily
3DHEA 1PHRA 3KXPA 3FNHA 3FVVA 3PGLA 3HCAA 3KBOA 1FRNA 3I9MA 4NMMA 4YJGB 3VNQA 3WQRA 3E81A 3NCTA 2J08A 2EWMA 4H1VA 1ODJA 3PC2A 4PHGA 5K3FA 1D2AA 3V4OA 4CV1A 5LLDA 5EGSA 1ONNA 1U90A 5FLEX 3UY4A 4E5DA 2AE2A 2TMGA 2HJSA 4MVJE 3IUSA 4AG3A 1XNJA 2OC4A 4N7MA 4DYDA 1MDFA 1IONA 1L8LA 1B8VA 1FDOA 3CUYA 2XHZA 2WM2A 5HTKA 3AVVA 2JKVA 3ADCA 2IIQA 1K7FB 1N6KA 1JG3A 3E48A 4XXHA 1V9CA 2VBFA 3SE0A 3NIFB 3U13A 4YALA 2ZR8A 3K4HA 2FCRA 2HBQA 1M6EX 3H75A 1V2GA 3DL4A 4Q6BA 4OHZA 2VRCD 5AW1A 3TTUA 3ZWYA 5LQAA 3KZOA 4ITVA 3LRTA 3LP6A 3MAGA 3D8BA 2C3PA 4BFLA 1HG1A 3FROA 3B9QA 4N18A 3V1KA 4MUHA 4PYOA 4UXIA 2YMQA 2NTNA 3NT5A 1EWVA 4KI0A 5BSEA 1XDUA 4D9EA 2CVZA 4JT9A 3HKDB 4ZHSA 5F9HA 1RRMA 1NW5A 1P0PA 2C5FA 3P9YA 4CQJA 2RG1A 2W5UA 2R25B 1PYDA 4PIPA 2QI9C 3RVQA 3U40A 3UF0A 2C3UA 2V54A 4Q1FA 3IAS6 3GFBA 4BO8A 1UM9B 2Q6OA 3B60A 2GD1O 2C61A 2Q1YA 3D4LA 4AJNA 5CP8A 1JQEA 4Z0PA 4Z49A 4M0EA 2B7BA 4ZRMA 3KYCA 1JMYA 1EKXA 4GVLA 4JQCA 4NTZA 3TXXA 4YAUA 2NGRA 5E9WA 1A2QA 4LYGA 3OF3A 1WCXA 1SHLA 1YVUA 3GAFA 1WUJS 1G3UA 5EWMB 3A4MA 4US1R 5FQOA 5CCXA 4RH3A 2CV2A 3LAWA 2I03A 1QWSA 4MVJP 1SUIA 3R24A 3Q2IA 3V8QA 4DLBA 4DPKA 5K2OA 4Q4AB 4B3HA 4Q4DA 2PS9A 5CTAA 3O93A 4PLGA 2E89A 2E7ZA 5C8YF 1U04A 4GKAA 3VISA 5IC4A 5K01A 1UPXA 4N41A 4FJ0A 1NI5A 1L5HA 1Z74A 2OORA 4CNBA 1I7DA 3LGSA 3FMOB 5AVRA 1BWRA 4YX9A 3UV6A 2AHRA 4RTPA 3B6EA 2GHRA 5AHKA 1NAIA 5EL0A 4N0QA 2IY8A 4ZVNA 3TR5A 3A6DA 5ER6A 2V9PA 3W6OA 4QDTA 1X92A 2VHZA 2BDUA 3IXMA 4YAEA 2GYYA 3SZUA 5C4GB 3T1NA 2DF8A 3TM5A 3A4IA 3W5HA 3EXEA 1A9ZA 1B2LA 3U26A 5KU1A 1K3UB 4QA9A 2YS6A 2J3JA 3L6UA 5CJJA 4RD0A 5J58A 3BTVA 5HMMA 1SZPA 3WL6A 2IEIA 3QZUA 3MPUA 5GONB 4BVAA 6GPBA 5CT5A 5A3VA 1SRQA 2ERXA 2G72A 2QYTA 3S0JA 4WBNB 1S7CA 5BSTA 2JDIA 2V7QD 3DNFA 1G8JA 3EVAA 3IP7A 3M6AA 1CUWA 1MGPA 1NUAA 1RLUA 1SQFA 4NBNA 4RS3A 3U9TA 5CDFA 3KEGA 3PF8A 4HXFB 4PAGA 1YVPA 2RI0A 5JG7A 3ZJTA 1WDLA 3KU1A 4Q48A 2CY0A 2G4CA 2Q46A 2PRIA 3C3CA 4HDMA 1OKKA 2Q45A 1US8A 2V6FA 4LMRA 3MTAA 2DQYA 2W83A 1XNQB 3NYRA 1U1CA 1HRKA 2WWFA 5L45A 1SNYA 4N1AA 3FMGA 4KDCA 3ON5A 3TLMA 2HZBA 2R4QA 4YCJA 1THTA 1K6IA 2XJ9A 3K0CC 2C9ZA 2ISSD 3OCJA 4GM1A 3L79A 4ETWA 3TKLA 1SD1A 3N8KA 5AVKA 2ES4A 1MTZA 4TXHA 1ZJ4A 1KZGB 4HQKA 4JJFA 3WMGA 1UQUA 3ZV3A 5FR1A 3C2QA 2AW3A 1OLSA 1ATZA 3PENA 2QW8A 4C88A 5JVDA 2XF8A 4FT2A 4KTTE 5D00A 2NYUA 1MR3F 2NYVA 3FUWA 3QNWA 4BCCA 4W5QA 2P5UA 3IPRA 3NHLA 2JVKA 1WMDA 4EY3A 2CFOA 4MQ4A 3EPKA 1ZJZA 3TLCA 3F5FA 2PUBA 3D59A 1Z4LA 1DCFA 2F64A 4E15A 1GOTA 3VV3A 3DE2X 3MWEB 3CLUC 4H0FA 3OKAA 3AR5A 1T8SA 1XYYA 3H65A 4EO7A 3I6YA 4ZI7A 3P26A 3C87A 1ZIXA 2SCUA 2ZWMA 5TPZA 2QY9A 1XP8A 3VR5D 3T38A 2WVJA 2P9EA 3A9TA 1DDOA 1Z0AA 1ULUA 3VNAA 2O14A 3H7AA 4I1VA 5EJ6A 4E5KA 3KUXA 2PX3A 4BL5A 2C95A 1TI7A 3HXTA 1JFFA 4LYFA 3SVLA 1BXZA 4NNJA 1QIEA 1OXKB 2GPWA 1M2FA 3BMNA 4ZEXA 1H2YA 1WY5A 1BX1A 3RJ9A 3GUCA 3TD6A 3IMGA 1VG8A 2KSQA 3EXIA 4G9BA 1QFYA 4RXUA 2IS6A 4Y1GA 2B1RA 1NUHA 1UIMA 1X2EA 1E77A 2OM2A 3OT5A 4H08A 3FOCA 1ZN2A 1YRWA 1Z26A 1AZSC 2J3DA 5NLLA 1ESEA 2IELA 4KQ9A 4DLNA 2WJWA 5LDDC 2W2XA 2AZ4A 3WNQA 1KJYA 4B76A 2WT8A 1VKHA 3U4CA 1SUEA 3UJ8A 4PAWA 1TD9A 4HN9A 4BPBA 4YCAA 3LFHA 1J8YF 4A10A 2O4UX 4L8VA 4CNQA 4JV5B 1ZP6A 2OGTA 3PE6A 4MGIR 4CXMA 1ZGAA 4F2HA 5I7EA 1XQ6A 1JXOA 1NX6A 3HYLA 3DH0A 4G1FA 3U3JA 3LZCA 4G8DA 5D3MA 4QYMA 3BGDA 3K35A 1R9NA 3JQCA 1K88A 3PTAA 1G6HA 3FB1A 3UGQA 4IVNA 2WDZA 4NOLA 1UFOA 3V2HA 3CVYA 2GPJA 4Q7KA 3ZDAA 1NYQA 4LSGA 4LXXA 2EX0A 1EMDA 3O83A 5JFOA 5JNRA 4EHDA 1AQIA 1AK9A 2NZVG 2WJ4A 3NFRA 2VSYA 1SVUA 3GLFE 3VR3A 3L8FA 3R6WA 2R7KA 4C30A 1SC1A 4FNAA 2EARA 4K9SA 4IH1A 1TYBE 2XD4A 4QPDA 4BJ1A 1RZRD 1YRHA 5E1MA 2IGTA 1R74A 3WNDA 1SUPA 1VCMA 2P77A 3DLAA 1M1YA 2Y9PB 2DWOA 3H1TA 5JAMA 5K8JB 3R9WA 4P5DA 1TF2A 1JDZA 1SUDA 1EH5A 1WSDA 3O5AA 4JWTA 1TFUA 1GUFA 1MUUA 1O6CA 5JSKA 5CXUA 2NVWA 2W6ZA 2YASA 4I8XA 4MMYB 1YS2X 3W2TA 4Q1VA 3KT3A 2AEJA 3TZBA 4YI3A 1W2GA 3HG7A 3BZUA 3B70A 4C4PA 3KX2A 1A2OA 2Y6VA 2BKXA 2EKPA 1GYPA 4V2UA 1NMZA 4BX9A 1EDDA 4JJ7A 3ZU2A 1OZ0A 1DC4A 3RTCA 1GQFA 3NBZC 3W5SA 3FHTA 4GLBA 1JHPA 1JALA 2C8JA 3VR5H 5BWNA 3PDIA 2QRZA 2OAP1 5D3KA 1PFVA 1Z25A 4FC6A 4S2UA 4HGYA 5KSPA 3UN1A 2YJZA 3AB7A 3RIGA 5HRCA 2BEKA 1D4FA 3FETA 1K9VF 2RHOA 4X20B 5E6RA 1YCFA 2X8JB 1T4CB 1ONSA 1VIDA 1CU1A 2Q1TA 4LHXA 3UMYA 4HX2A 3TAUA 4KQGA 1RJ9B 1RM3A 1A2BA 4A03A 4KIGA 3ZZTA 3RU7A 5AUPB 2CSXA 2IPXA 4DSOA 2J46A 1Y1TA 3AU8A 2IZ0A 5JSZA 1C50A 3P2KA 2V8BA 3EGIA 5CLJA 2GCOB 4XWWA 2V4ZA 3KFXA 3FZGA 3IB3A 3R9XB 1R64A 1NPDA 2HK9A 5HKLA 1SC3A 3F2IA 1OXUA 5A71A 4P5PA 3TDKA 2O8CB 2Y4NA 4F56A 3D4OA 5EJMA 1Z07A 4FFMA 3RC8A 2OCXA 4AJLA 1NXWA 3A6HA 3JATB 4JLPA 2BLNA 4G67A 1Y1KE 4UHEA 3GRRA 3TVTA 3ZGYA 5KNDH 3BEDA 2H2HA 3NPMA 2PWPA 1VJCA 5JANA 3CSDA 5F9MA 5C34B 4PS0A 5LP1A 5CFMA 1X86B 2D2FA 4GSLA 3F3YA 1QP0A 1OROA 1JI3A 1PNVA 1GLNA 4JLJA 4YNBA 2X14A 4F4HA 3F9IA 3E18A 1LNZA 4CR6A 3A70A 3HEBA 5KHLB 3L92A 4GMXA 3ESQA 4RH1A 3WNCA 5IRCD 4D79A 2ZDHA 5JNUA 3A3PA 5J4VA 2H2WA 5D01A 3OCYA 3SZMA 4KX3A 4A73A 2AIRA 1PDOA 2IYTA 4GO1A 4HAVA 3IBYA 4O08A 4UUOA 1GEEA 1W88B 2AZMA 1ZUNA 4QODA 3Q88A 1CF2O 4O4JF 3H9JA 1HDXA 1E98A 3R5TA 5LNK6 1GY8A 3NH9A 2ZE8A 4O59O 4JFAA 3ZCVA 3D4BA 2BPOA 3ECCA 4RYLA 3VU8A 3ZU4A 2CWDA 1M0TA 4OLHA 4RMHA 2ZPAA 3FNRA 4R81A 3PXBA 3LCVB 5LP6B 4MTLA 1SG0A 5CA1A 2D8MA 4FUQA 3RO7A 2LIVA 13PKA 1YR3A 3T5AA 2CV1A 5TEWA 1V96A 2CCJA 2EZ8A 3EIHA 2HCJB 4BBZA 3AR6A 3RSQA 1XX6A 1LBSA 3HKBA 1UK6A 2JLXA 1PFUA 5EJGA 3GD7A 4MWCA 4L8YA 5CRIA 1KVQA 5IASA 5H9WA 3ASZA 3HS3A 4NVRA 3RVNA 2XWPA 3F5QA 4OHMA 4WESB 3VKWA 1N6OA 4J0HA 3VPFA 3A06A 2ZJFA 3OMLA 1NVBA 4BO5A 1FZTA 4WN3A 5GINE 3GPDG 2G9ZA 1AGRA 3CF2A 4UTXA 1P39A 1X1DA 1Z08A 3A1FA 1NNI1 3PPWA 4CGZA 1KXJA 1R9GA 4G5RA 3HRKA 2GLUA 2QTRA 3JWJA 4YBRA 3V4FA 1RVV1 5IXYA 4I14A 2A5DA 3OQPA 5AUOB 3A9UA 1B6TA 2PZ8A 3O26A 4H7FA 1XK6A 3MWDB 1A0OA 1D2CA 4M76B 4PZZA 2W4IA 3H0CA 2R6R1 3AB3A 3UV7A 4DQKA 1QX4A 2VQFB 3DDCA 3L7YA 3CLRD 3HO1A 2VOJA 3F0TA 1AS3A 3FFBA 3SIXA 2TMDA 3WADA 4E6EA 4BVKA 1DJNA 4C0WA 2E5LB 1H2WA 2R00A 4GYWA 1PEYA 2Y77A 3SS7X 4BKQA 5IKMA 1OLXA 1EESA 4MW4A 1TB4A 1HOTA 3T94A 4BMSA 1HR0B 5DNVA 4LJYA 2ZI7A 3EG9B 5J5CA 5T4EA 2HDHA 2H8GA 2ZUTA 3KJIA 3OM0A 5DM60 1E3WA 1EFDN 1OV4A 3ESBA 1DDGA 2ZJ8A 1FVFA 4MEBA 2ID8A 2ZE6A 4M7OA 4O2RA 4ONEA 3BK2A 4IMRA 3W1VA 2QHXA 1PRYA 2M9MA 4XWAA 1ZIPA 3F8TA 1AT1A 1OZFA 4HBGA 5AK5A 4OHBA 1XLTA 1SBYA 2JF0A 4HNQA 3THWA 3V32A 4RJLA 4BWGA 2H7VA 1WTCA 1DKOA 2OLJA 4NCIA 4EW1A 3SR0A 1CPYA 2D2IA 1ADGA 3GLRA 2X7JA 5FOVA 5C9ZA 3I09A 1E2DA 4ATNA 3PWSA 4WADA 1T0UA 4H6WA 3DE6X 4RHYA 5EYPB 3RWOA 4A2CA 4BLOA 3TTSA 1KK0A 4YAGA 2GK7A 3MS2A 4D4GA 3GLTA 2GNOA 3FDJA 4J4HA 4UU8A 4ZO8A 3SHTA 4IF4A 2VTEA 3GLVA 1HH4A 3OOSA 3GVHA 3EF1A 1Z4IA 2CJXA 4K8RB 1SC4A 3DNMA 2PJRA 3AIKA 2R4UA 3LPMA 3F4KA 3JZIA 4QOHA 4UEOA 2AYZA 2X19A 1LLFA 2B6HA 3P9QA 4BRWA 2BHSA 1MC5A 3LDHA 1TLLA 3JQ9C 4PN7A 5EHNA 2MYTA 2C7GA 4TUYF 1BJRE 3BWMA 3ENKA 3NBYC 3ZQUA 2OV1A 1G9SA 3T3HA 1X1RA 1S9HA 3IHWA 4MR8A 3UM9A 3UVEA 4TTTS 3GLGE 5EUMA 5DGDA 3BDAA 2ZS7A 3KUCA 3K32A 2ZUDA 3VX3A 1N8KA 3GROA 5HG0A 4HNRA 3TO5A 4FJ1A 4JB0A 3PICA 3RF7A 3TDMA 4R1QA 2BH2A 1AN0A 2VYFA 4AMYA 3U37A 2VHYA 2H92A 3JZFA 1QHIA 2WVHA 4BFWA 2N47A 3NOOA 1VB3A 3NG1A 1UZLA 4CDMA 1D8TA 2WPDA 3PNOA 4DCTA 2QYSA 4DC0A 3EDYA 5C4MA 5JRZA 3RBXA 5ERGB 2GD2A 4B1FA 2CXPA 2E37A 2XMDA 3T3IA 4I8DA 1V5EA 2G9RA 4HWGA 1N2XA 1U9JA 4M1KA 4Y2VA 4X8HA 1ZD8A 2XKBA 1WW2A 4XLTA 4EFLA 1Y33E 3IYLW 2OSVA 3KT6A 4A8HA 1XRJA 2PX5A 3C98A 3OIFA 3GZNB 4II3A 3TNYA 1C3OB 1U2PA 2VPYA 2QNIA 1XL1A 2BONA 3F7TA 2X2PA 1ORTA 2GJAA 3DXYA 3THRA 3W7VA 5IHXA 2Q5HA 2QAGB 3SCZA 2DPHA 4Y6SA 3K9BA 4MA0A 2WAXA 2QGNA 5IMBA 5KIAA 2EZ4A 3L8EA 3PQ3A 4CVNA 5LPNA 2GX6A 1H0KA 5CIYA 3STTA 1V8FA 3ETGA 3R7WB 1KMNA 1WBDA 1P44A 3ZLBA 1EEHA 4IDPA 3IEXA 3WP0A 5A04A 3HNRA 5DNUA 5JJLA 4XB1A 5KYUA 1QS0A 3B5EA 4N9WA 1TJNA 4DV4B 3OLXA 4EK9A 5AM0A 2PY6A 2XCIA 4FGKA 3DTVD 3IJPA 4JROA 4YUYA 1NOKA 5JYBA 3PBKA 5FTWA 3RRZA 1AG9A 1DC3A 3HEAA 2RGEA 1NBAA 4P81A 3SFVA 2CD9A 2NP6A 4G1VA 4YJDA 3WRVA 4WXPA 2A1IA 3RRYA 1U3WA 5JAOA 3RSSA 4A4DA 4ZV9A 3HZRA 4QUKA 2RGAA 2QI9F 3N8NA 5JHGB 1MA0A 1R5NA 2CMGA 4WI1A 1F12A 2XUOA 1V43A 3P0RA 4HX5A 1XA3A 2QT1A 3M6LA 4M9QA 5CB4F 1HNWB 2P68A 3PQCA 3QBVA 3IQEA 4QXPA 2H1OA 1JT9A 1L9XA 3WICA 4BO6A 4AYXA 3BCUA 4EZIA 4H17A 2F1OA 4RTQA 4R9SA 3AI1A 2DTDA 1GZVA 3QFFA 2GZ3A 3GHYA 1YS1X 5CVUA 3CRW1 2IP2A 2GVDC 3M2PA 5G1PA 3HB1A 4B3SB 1CR4A 3KQHA 1SZCA 4Y1RA 4TYYA 1H22A 2HF8A 4A2PA 1ZOIA 2W2VA 1P6QA 1L9KA 4YFVA 1C9MA 1T5DX 2QUBA 1UUFA 3DLHA 4EUHA 4RO0A 4HZGA 2HAEA 4OQZA 4P35A 1VMEA 2W2KB 4B7UA 1BRMA 2Q28A 4FOLA 1QVZA 1W30A 2BVNA 1V6CA 4J6FA 4O2AA 4EFMA 2GTPA 1W76A 1GZUA 4JJAA 5KYGA 3RYCB 4UBKA 3A3OA 5FPSA 5I51A 1EVQA 4L4SA 3VPBA 3VJLA 3OSZA 4X61A 4PQRA 1M6NA 3F6BX 1HDIA 1QH1A 2FJPA 3CLTC 4REMA 1E6LA 4IDHA 3OC0A 3P2IA 4QJ5A 4BTLA 4D99A 3CXUA 5JBNA 1Y6GA 3D7MA 1C9NA 4C5AA 3PQ5A 3CZAA 1XRSB 3LWZA 1YJXA 2IEGA 3EXAA 4CIDA 3TQRA 1VHQA 5HKBA 3DEYX 2QYOA 4D9BA 2H85A 2WINI 3S55A 5LLTA 3D8UA 1H6BA 1I80A 2B83A 2F8MA 3BULA 2PKEA 1VLVA 5ALOA 1XHLA 3A2LA 1G20B 3ZV6A 3HO6A 4KU4A 1HEYA 3ILVA 1MZPA 1SVOA 3AUKA 1E5TA 4KC0A 2HFJA 2CLIB 2D1YA 1GLVA 1ZNZA 4HZIA 4JUCA 5AH0A 1PL7A 3EAGA 4DG5A 1D0SA 1TA0A 3STVA 3QWAA 3ZDBA 1ST2A 2G70A 4UPDA 2AYYA 1ZEJA 4AY3A 4A0GA 1SHJA 4D0RA 3R75A 1XZCA 4LFAB 4DR4B 1FNBA 2C88A 5A7GA 1E64A 1SOMA 3VR0A 2XMGA 4CN9A 4TLBA 4ND7A 4C4YA 1E0JA 1CG6A 2ANCA 3C3AA 4ISBA 4NR0A 1PJTA 3DMGA 4AICA 4EHNA 4JD5A 4YJ2A 2X6QA 4UVGA 3NM4A 1ZN7A 2DG2A 4M60A 1CR0A 2JG3A 1I13A 1ZL2A 3NHUA 3VU9A 1JYEA 4R2LA 5TT1A 2CHFA 3A05A 4JKYA 1QP4A 4K2HA 2VXOA 5FA5A 4OOFA 2UVPB 2IVFA 2RE8A 4N6NA 5CB0A 4UAGA 2V3CC 4N5MA 1ISGA 4R2MA 2GOYA 4GL4A 5SY4A 1EK5A 5TQ0A 3H86A 1G17A 4H6PA 3GDGA 4LIPD 1X3SA 2QVGA 1K5PA 3O9ZA 1Z2DA 4TQAA 4U7HA 1WU8A 1YCHA 1USWA 3U4IA 4KJXA 3HJCA 3VR5A 4N01A 5F12A 4BOYA 4CKBA 1GPYA 4EA7A 1DTSA 2QMUA 1LNSA 3I72A 3IBCA 3TBFA 5B1IA 2AXNA 3GLHA 3IP5A 3TYXA 1F1BA 1I5RA 1SU7A 3WYAA 2CLOB 1UJ2A 1NSYA 4INZA 2IXDA 1KI6B 3C85A 2CB0A 2BEWA 1ODTC 4M7RA 3RS9A 2R6DA 1M75A 3BQNB 3DMFA 3DPSA 4U63A 1RHJA 4PZ9A 3TSAA 3T3PB 4BQOA 1D5WA 4C1BA 1BCSB 1JV2B 4MVJI 4QG7A 3QEAZ 4D26A 1L0BA 4CT4B 1H1TA 2DFPA 1R8JA 4HWPA 1XEWY 2FUG1 3KKPA 10MHA 1I4TD 1NQUA 2ZIGA 3CF0A 2X3FA 3GPBA 3LGAA 4MR9A 1HDYA 2CT8A 4EZEA 2X5OA 2NU7A 4JXKA 1MU0A 5KNDA 1T0HB 2X23A 5A6SA 3SC4A 1FJ2A 5TE9A 1E9CA 4ECAA 3GCZA 2CL7X 4ZDJA 3KXKA 3F5MA 1L5RA 2O5RA 4MS3A 1XKTA 3ANSA 3WWOA 4JI4B 3BX1A 2VF8A 3H9BA 3A3YA 4G2TA 4MS1A 1CNFA 1RPTA 5C5EA 4KHZA 5E7MA 3RSGA 4REOA 3AOGA 1R8QA 4P93A 4I55B 2C07A 2XNDD 4FK8A 5CJPA 3WQHA 4B44A 3AJEA 1YR9A 4BN4A 5FDFA 2B1QA 3CUEF 1GPLA 3K5WA 2XHEA 4HDSB 1T8YA 3ZWKA 1MD9A 3GW8A 4IGKA 4B6RA 2P4HX 1V35A 2Z8YM 2GM5A 2DSTA 3H2JA 4YMTA 1NW8A 1G6KA 5TJ9A 1L4EA 2QTBA 1G8AA 3FY4A 4XH9B 4IEFB 1G5QA 2EG5A 5FJIA 4YRAA 5F7ZA 1SAYA 3TECE 4B6EA 5ERXA 4DANA 3N2IA 3D8SA 4H7HA 1F7VA 4FGSA 5JS8A 3W3AH 4YRKA 3B36A 4V0SA 1IBRA 5T4BA 1Q7GA 3CRQA 3QOYA 4L0MA 4RY8A 4HH0A 5I7AA 1JDBC 4ZEWA 4HI0E 3SOZA 1L4YA 1RBYA 1XRPA 2OCBA 3GY0A 4YS6A 3AFNA 1S4QA 3PXGA 1HDRA 1ZOSA 3C7KA 4YP6A 1U5BA 2F2TA 2O7NA 1VHTA 2RFLA 3DVAB 3E2MA 3KEQA 3OBBA 4M55A 3KLOA 2CLDX 4NBWA 4E2YA 4ETMA 1RQNA 4AULA 1G59A 4L0QA 4DIUA 2AE1A 1ZMOA 1KO7A 4EMSA 2IYSA 3KQMA 1WXQA 4N65A 5E4TA 3LA8A 5IDVA 1X1TA 2CV0A 4PLFA 3Q7QA 4GI1A 3KJZA 4FYXA 1FYWA 1QONA 4WH0A 3R9KA 4EL5A 3IILA 4UTOA 3K0FA 2P9FA 1COZA 3A1UA 4GX1A 4N5HX 2QPTA 3UXMA 3WLSA 4F3TA 4ZVKA 1XTBA 4LQCA 1E2LA 1I36A 4GBMA 3G5AA 4G0NA 4WJZA 3CVUA 4R41A 3PLAE 4J9UE 5DM0A 1XTVA 4HJXA 1SVLA 4AN1A 1VLJA 2W9XA 3QW4B 4FYYA 3LBHA 3ZQKA 5C51B 2OORC 2E4ZA 1IQ0A 3IPXA 1KY4A 2VKQA 3HDGA 2VXCA 1KBQA 3GP3A 3TEFA 4LG1A 2XT9A 7MDHA 4NFLA 1E59A 2OGZA 4NPHA 1A5TA 4JUAA 4RFLA 4EOGA 1B0PA 2A0UA 3FHLA 3GEIA 3NEYA 4ED9A 2ZTVA 2JC3A 3DEKA 2IXAA 2BFDB 4CL3A 4IQ4A 4KO1S 1RMTA 4RANA 4NG4A 2Y1GA 4R2JA 3DAHA 1SULA 4D56A 5KS2A 1CR2A 3LV8A 1CDDA 3PR1A 4HRVA 4AY5A 1MQAA 1IZYA 1Z6GA 4MAMA 1TKRA 2F3SA 5ALVA 1CUJA 4PSAA 3KBBA 3ADDA 3BH0A 2QRQA 4Y6GB 2RBKA 1KVUA 1OB5A 3KUDA 5JROA 2QUHA 1C8VB 1WHSB 4OIMA 2PTHA 2XOEA 3U7RA 4MA5A 1L1EA 3ACBA 3RC2A 1F2TB 2AXQA 5KHOC 3HCBA 1ZL0A 3AY6A 3HUEA 5EWLB 3TZQA 3EUEA 4L28A 3W5JA 2ZRCA 2X7HA 4F5DA 2YJ6A 1NIJA 1OYVA 3REFA 1YS6A 3HB9A 3EEBA 1PFQA 1BDBA 3THYA 4ZZIA 2FYTA 2OOSA 1XVAA 3G1UA 5A9SB 4UBMA 2DC1A 3T6KA 2EGUA 3KB1A 3LT5A 1B6SA 2YN2A 3PD7A 1A27A 3HP1A 4PQEA 1Y82A 3Q6IA 4UASA 4B79A 5IKXA 4IUDS 4JJGA 1DCTA 2O8VA 2ZATA 3NI2A 5DM4A 3TD9A 5IULC 1E18A 2QW0X 3JQGA 1EM8B 5HM8A 5KPJA 4ENTA 3DHNA 1UJNA 3G2NA 3KTDA 2JH9A 4Y67A 4I19A 2RGYA 3ROZA 2J9RA 2N3ZA 1G21E 2AJDA 3U80A 2ZTUA 3RYTC 1AXEA 5C53B 1GDDA 2NNLD 2BGUA 3X1XA 5IYZA 1CK4A 1NKSA 2OL4A 2RGWA 3OOJA 5K1ZA 3SY8A 4BEVA 2GF0A 3DULA 2WUVA 3AOEA 1E58A 4FU0A 4K3VA 1TADA 4LC1A 3FSEA 2ZIFA 3RDPA 2SKCA 3ZEIA 3ENVA 4CCAA 3RT1A 1PUXA 1I6KA 1NJ5A 1E5LA 5C7LO 4IDGA 2NYAA 1KOFA 1RIFA 2CDAA 3BD9A 1QR2A 2E0IA 2PXXA 2R4TA 3A7DA 4IINA 4ZT2A 5CIQA 1PU2A 4C29A 5EJ2A 3KEMA 2IYQA 1HOXA 1YUBA 2OMKA 3LQYA 3L4SO 5F1YA 3K71B 2RARA 1YZHA 4JKIA 5FFMA 4OJQA 3Q3GE 1UJ4A 1ACMA 3I9V1 3D64A 3O7MA 4ZJYA 3I62A 1EBUA 1VBFA 1TZBA 3VAZA 5LMCA 1XVTA 2X4GA 3BWVA 4REQA 3ZNQA 3WGUA 2O8DB 4KMMA 5JTUA 1A2KC 4MQ6A 4N3AA 2ZYAA 3THSA 2FN8A 2GVZC 3FYSA 5ARDA 4ID9A 1J2EA 4BGVA 4W5TA 5KDLA 5TQ2A 1Q1QA 4OA5A 4HLQB 4F9EA 4LVOA 4WOKA 5K9ZA 1NQ5A 2DHEA 2PN1A 2VT3A 4KODA 3ZV7A 4E5PA 2W7TA 1F17A 2YXPX 2AWOA 4MV0A 2AMFA 4HYTA 4QUHA 4C0JA 2C9MA 2VZ8A 3O6VA 4RTLA 2QQ0A 3C70A 4DN6A 1AS0A 4FQ8A 3CONA 4NY1A 2WIJA 4QNMA 3UO8B 4BEBA 5LYJB 3KR9A 3QNUA 5F5NA 1BDJA 1X80B 5B2FA 4AB1A 3EOBI 4H35A 3RVBA 4JBLA 3VPSA 4DDHA 2QR2A 4HWKA 3KPWA 5K0NA 3OQ1A 4K9RA 2JL1A 2W2LD 2EKBA 1PZXA 1BHQ1 1R0KA 2V7GA 3L5KA 3LCUA 1BWPA 3HN2A 3LCRA 3Q40A 4FDUA 4MVYA 4NFYA 3T9DA 4U2EA 5C1OA 1Z2NX 1X7XB 3QKRA 4POAA 3TNJA 1KDYA 3UJ7A 2PRJA 4QVGA 5KX5F 2DPGA 4HB4A 3KWMA 2NV2B 4N3CA 1ZIYA 4L8WB 3U3OA 2VYCA 1MRZA 5A1JA 1USKA 4MKGA 4C6TA 3LXXA 4BJ6A 3UCEA 3JXEA 4GPAA 3T7DA 2FMIA 4TV9B 1QQAA 1Y8RB 3DZFA 1E61A 1IPEA 3QXXA 5FUWA 3ZE2B 4DA9A 3M1YA 4I50F 3D8NA 1DX4A 2XD9A 3QQPA 3GYBA 2R6ZA 4KITB 2VBIA 2K7ZA 5DCYA 4CKEB 1EFVA 5H7XA 4RZHA 2O3UA 3TWOA 4WFIA 1E8NA 2PLNA 3HEMA 3GRUA 4BDSA 3WVNA 1UEIA 4GT1A 1Z0ZA 2ZWAA 1UXHA 4LHSA 2QXUA 3LPDA 3QY0A 4HS4A 3IKLA 2V1XA 4JQSA 2HL6A 2CGEA 1R12A 1M83A 3GG9A 3T7TA 3BOSA 4BKOA 5C8ZA 2XUZA 3AUXA 3AWIA 1NAHA 3MJ4A 4O2BB 1E4EA 4AS1A 2DBVO 2P9CA 4QGGA 2HU2A 1RWBA 3QM1A 4JLWA 2R8RA 4KUGA 2BWJA 5LMZA 1WDKA 2QIPA 3F5DA 3HJRA 3R3YA 1BN7A 1W47A 3BN3A 3NTLA 5J2UA 3S44A 3DT8A 3LM8A 4RULA 2GD0A 3NHFA 4A8PA 3A9SA 2IWHA 1F8UA 1SCDA 3PWTA 3TTYA 3QUTA 2XVYA 2G4VA 3JTMA 1BYUA 1S2DA 4OHRA 4ZHQB 3FJ1A 2C58A 5BT9A 5IJ9B 4RVOA 5A4AA 1LV7A 4QBIA 4MWTA 1PYGA 4Z7JA 8ADHA 1T29A 3TAXA 4YAKA 4M9ZA 5TIIA 1JI0A 5FKJA 4IWXA 3U9LA 2DFNA 3PUYA 1CZUA 4HN2A 1TYZA 2DP4E 3UAVA 3W9SA 1K0FA 2RHGB 1NV9A 3M5CA 4ZQFA 3QFHA 4PYRA 3JQRA 3QLVA 4R9RA 4ZFNA 1N6LA 2H1FA 4D1YA 5IARA 1ORVA 1QK5A 1WEKA 3EXHA 3UW1A 1UOEA 3CZ5A 3FFAA 3ILYA 4XJTA 4AY6A 3T3NA 1QVAA 3OICA 1L4NA 3BMQB 3V1MA 1T1SA 2G25A 3AUSA 4IJMA 2YWJA 3EG5A 3H18A 4G8JA 4JUDX 4RVUA 3H2YA 4ZQGA 1EFAA 4Q3BA 4JMLA 4OY3A 2GAFA 5ETJA 3KQLA 4NOJA 5DASA 1U0OC 4ZIRA 1RZVA 1YQQA 2GAJA 1LI4A 1O9BA 3OEED 3QVWA 4I4IA 4MV4A 3WB9A 4FNMA 2X86A 1T1RA 2DGDA 2VTBA 3C5EA 3K1AB 5AYVA 2ZT6A 4F2WA 4R0MA 1EDZA 2K6GA 2WHRA 1V1MB 4PZDA 1WULS 1PCXA 1XMJA 3NAQA 2Z3VA 3EFBA 1C1XB 1ZDMA 4QEZA 4EEZA 4I5FA 2CYBA 3TJZA 3R41A 3S1SA 3THOA 2WWWA 4R1UA 3GLKA 4YHBA 2ZJ2A 2A9VA 3PC8A 2HPAA 3NC4A 5BUSA 2B21A 2JCGA 2VH2A 3BERA 2BKAA 1WG8A 3IGFA 1JIQA 3C1TA 4C5BA 3ZNNA 2GVNA 2QX8A 3RARA 1YZKA 5E3JA 5F7JA 5AI9A 2XUJA 4NZOA 2GJKA 3Q7RA 1C2TA 4U2BA 4BQQA 3ITDA 4FT4A 2I22A 2Y1XA 5C1IA 2IYAA 1TMOA 3MUEA 4QPPA 3O8CA 1JECA 4KXNA 1CE8B 3MAJA 4DUGD 2WF5A 1M33A 1F9EA 3FNBA 2DFTA 3MYYA 2QN3A 4YLEA 5ENVA 4BATA 1J1ZA 1QRDA 3B3JA 4EQZA 2GAAA 2PZMA 1LC3A 2FWBA 4YN3A 4XVCA 3RKRA 2PE5A 1J7JA 2HA3A 4CGYA 1BRTA 2O2DA 2OP1A 1UJCA 2WSYB 3EBOA 1FU7A 3FMFA 1DCMA 2Z5GA 3GD5A 4YJGA 4IX1A 5KWJA 3I32A 4U2FA 4X71A 3MC1A 3L6OO 4ZAFA 3V8BA 4MUFA 4DGQA 2C83A 2GN4A 3C97A 4JT2A 1DOZA 1TPYA 4KBFA 5K3CA 4LFCB 3Q8MA 2H1CA 1XUOA 4MLCA 1XNHA 2HRBA 4JEUA 5LA6B 1BDHA 5HJ5A 2IUTA 1WXWA 1BE1A 1XTQA 2O2EA 4JR1A 4R2IA 3SZLA 3UG7A 1RJDA 4TKUA 3WLMA 4E2XA 1JSLA 1TJ4A 5CA0B 2EZTA 3BE5A 3FIUA 5EUQB 3ZDEA 4TTIA 2X9VA 4HEA6 2IIPA 4N3BA 3I5UA 3ANMA 1FDRA 1VG1A 4OYRA 1KJ9A 3NHBA 2JAOA 3PTZA 2GBLA 4PZCA 4AL4A 4BVBA 3ZX4A 5I7HA 2BBTA 5KC9A 1MEEA 1CUVA 1B00A 2CUZA 1P74A 1CQPA 2A5FA 1YQTA 1G1AA 2X9QA 4IXNA 4DJFC 2CHEA 2AZXA 4RACA 4LSWA 2C4UA 1C0KA 3Q11A 1ZCBA 3BZBA 4MDFA 4AECA 1OA0A 3D3WA 3L7CA 3EFHA 1N8TA 2DUMA 2XI4A 1IQPA 2R00C 4OVKA 1SZJG 1FXWA 3HKDA 2ZJAA 1M0SA 3W3AA 5AKEA 4ZV4A 3PNPA 1F5NA 2IXGA 3PRJA 4YRRA 3O8LA 2JJ1D 4ZI5A 4P08A 1JSCA 2D59A 2QP3A 3OKCA 1LTKA 4MVJD 1UM9A 2YRXA 1VJDA 3WKAA 1PE0A 4O8ZA 4JVOA 3TRJA 4ADSG 4DM4A 1RXVA 2DQ4A 4HADA 3M4XA 4JLDA 8LDHA 2Y0EA 1YR6A 2GPSA 1RKVA 2Q5EA 1JYSA 5D87A 4F4DA 2VNJA 4H3VA 1XLTC 4DMHA 4YMUA 5EWMA 2OK8A 3MTDA 4W7IA 1J4AA 2RB4A 3OECA 1W46A 4WECA 3TPCA 4CCWA 4Q4AA 2CFIA 3GNSA 3U17A 1AH2A 2F3PA 2D5LA 3AHCA 3RTBA 4ERXA 1JX6A 1M6WA 1SELA 4RGYA 5L7TA 2AKEA 4FDAA 4PNZA 2GBCA 4P31A 3L7JA 1LPAB 4KXMA 3Q5DA 4NX2A 3ZHOA 3H9GA 5HZHA 4YRPA 2P3SA 3KL4A 3SICE 1EZZA 1ORRA 4GWGA 3UAZA 5JMTA 5KYTA 4I1PA 1FF9A 1C7RA 2I55A 2WYWA 3CRRA 4IH4A 5I4KA 2R87A 1H9AA 1D3AA 1J70A 3E5NA 3DC7A 1A9OA 1BEUB 2WVGA 4CL0A 3AEXA 4A0SA 4M98A 1KEWA 3L6CA 5FP0A 4R8VA 4QXRA 3H17A 1Q95A 3IPCA 3ZBPA 4IX9A 5U9CA 4PEVA 4HVAA 3Q15C 3TSOA 3V80A 4JB8A 4LX8A 4DF3A 1YBFA 3FYDA 2LW7A 3M9LA 5IT5A 3HQ4O 3PDUA 4I4CA 3HXLA 2QNRA 1LPMA 3D6AA 1N6RA 3ZZNA 3H84A 4CF4A 4DPLA 3HUTA 5IZCA 2IH5A 4WBNA 2RSLA 3N8GA 3PB3A 1NU6A 1PV2A 2RI6A 4Z1OA 2G0AA 3QYAA 3AU9A 3J81k 3KSMA 2VRBA 3P8ZA 4MWSA 4BEJA 2A3RA 2A84A 3EVNA 1P2TA 2BGNA 1PJQA 3KKZA 4M7PA 5EC8A 5J9FA 3QOWA 2AKAB 2RI1A 4LRQA 1L6RA 2TYSB 3MVEA 4L95C 1Q0SA 2A0XA 3DOHA 4F6LA 4MIOA 4B8WA 2LBPA 2AX4A 3MK31 1CRZA 1V4NA 2EDCA 2XXBA 1L1RA 3G2KA 3NHWA 4RFSB 4DNOA 2RKWA 5AJHA 3FAZA 4MCHA 3ONFA 3NCHA 2XUGA 1FMTA 4RKEA 2C59A 4D74A 1RABA 2EC5A 3GRYA 3QRWA 4E09A 5EERA 4X5OA 5CCDA 3O7WA 2QTFA 4LY9A 4ZZ0A 4XGQA 2CVPA 2QTHA 3T1TA 3W0LB 4MWDA 3BMCB 4Z4GA 2PH3A 1OR8A 4ZN6A 2Z6UA 4ZOAA 1M34B 2W6PA 4OHOA 3KSRA 2I4OA 1O4VA 2LCQA 4CKCB 1OI4A 1O95A 2FF5A 1U9IA 3IERA 1WRBA 2AG6A 2NUBA 4FN4A 4MVJH 2HREA 3GFRA 3HZOA 4XWKA 1OF1A 1UOQA 2NXEA 3N5CA 5AXCA 5F4BA 1U0EA 4MW1A 3RSLA 1FRQA 5DLDA 1HE2A 4LF9B 3LF2A 2ZB8A 2J85A 1OX6A 3D54D 1E2IA 2Y8EA 1IDOA 5AM1A 5DYTA 4KFTA 3VTKA 3RVJA 4ER0A 1I2CA 4R71A 4EG4A 3BWYA 3IMCA 1H2FA 1MEJA 4UEWA 4DBLC 3MWEA 3NGLA 2JLWA 1V7CA 4AI6A 4H15A 1NULA 4GP9A 4JCOA 4HVTA 4QJBA 2CXUA 4U5XA 1FNNA 2B8EA 2CVOA 2IYVA 5CD9A 1GDTA 3F3SA 4BAGA 3RFUA 4B4KA 2O59A 1ULHA 1LDGA 2O3TA 3UJPA 4NE2A 2YZGA 3H1PA 1VL2A 4UBJA 1QPBA 2JGEA 2Q21A 4CM3A 2HTEA 1JDTA 2Q9CA 2HUNA 4L4UA 4WFJA 3FWHA 3GJ3A 5DFAA 5GZ1A 2VSNA 5EKUA 4JLOA 1JMKC 3TJMA 4RKRA 3QNMA 2D0OB 3QENA 2ID9A 4PAOA 5BSFA 1SWVA 4UZFA 2H0AA 3H1AA 1A82A 1X0VA 1TIBA 2EKDA 3LD9A 3LX4A 3PJFA 1DIBA 4K05A 2WM9B 4IICA 4NDZA 4KQJA 1DKPA 2M1XA 1ZLXA 2XVXA 3NNNA 3NOXA 1L7QA 4P7FA 3T7JA 1XE3A 1E1RD 2QRPA 1ZJJA 2EDAA 4LOJA 3R7BA 1SXPA 3BKWA