4R68A

Lactate dehydrogenase in complex with inhibitor compound 31
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
331
structure length
331
Chain Sequence
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimization of 5-(2,6-dichlorophenyl)-3-hydroxy-2-mercaptocyclohex-2-enones as potent inhibitors of human lactate dehydrogenase.
pubmed doi rcsb
molecule keywords L-lactate dehydrogenase A chain
molecule tags Oxidoreductase
source organism Homo sapiens
total genus 115
structure length 331
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4r68A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4r68A02
2G5CA 3ZNPA 3IJPA 3DWFA 3UCEA 3NRCA 3D1LA 4XJTA 2YYYA 4CMBA 1JDJA 1XR3A 3U3XA 3U9LA 3HJAA 1JKJA 4IJUA 2X0RA 3GVIA 3MJEA 1K6XA 2IXAA 4TRMA 5ICSA 3JQ6A 2EERA 1C14A 3PPIA 3MTJA 4ROSA 3TFOA 3WSWA 1WVGA 3GEDA 4B7UA 5LDGA 2WM3A 4CM9A 3UCFA 3S2FA 1VSVA 4GX5A 1EVJA 3A9WA 2GN9A 1PWXA 4RPGA 1Z7BA 2CVOA 4XWYA 5EESA 4R41A 2PZMA 4AJPA 1ZW1A 1R0KA 3JYNA 4B3HA 3R1IA 4W9NA 3ZV3A 4JP2A 2PKQO 3OJOA 5GMOA 4L73A 1CEQA 5LCXA 2X9GA 3AI3A 2J5KA 3WNQA 4M1QA 2EKPA 4I08A 1RM0A 4E3ZA 4NBRA 4D3FA 2O50A 1TT5B 5A03A 5TSDA 5L53A 3LT1A 1JTVA 4UUNA 2PTGA 4LMPA 1I3KA 2O3RA 4B4UA 1BRMA 4WOJA 2Q99A 1PGOA 4FJ0A 1M2WA 4YDRA 4NBVA 2PA3A 3FR8A 4BB6A 2FZEA 3BTOA 1PTJA 1DO8A 2PH3A 5CDTA 1JAYA 1GCUA 4DLBA 4AJ2A 1ZK2A 1HDYA 1M76A 3PP8A 1YB4A 3ICPA 2H9IA 2VOEA 3HB4X 5CPBA 1IB6A 1E1LA 4O59O 4HFNA 2VTDA 4N5MA 3WOHA 1FDWA 3P2YA 4RVHA 1Z7EA 3OJLA 3ON5A 3O38A 1CIVA 4KWHA 2CVQA 1SOVA 2G82A 1EDOA 5KKAA 1K89A 4EYEA 2ZB4A 1CF2O 3CINA 5DDIP 4AJNA 4CLOB 1TT5A 3RKUA 4FS3A 1EUCA 2I9PA 1PZHA 4BHTA 4BV8A 3L4SO 2Q49A 4E12A 3DHNA 2X6TA 2OBYA 3OH8A 4PGFA 1A9ZA 3ADOA 3NTRA 4BO3A 1NFQA 3OIFA 4OM8A 5KOIA 3VVBA 3V2HA 3BXXA 2W4QA 4WOKA 3GHHA 4MVJA 5IF3A 1ADBA 1R12A 4DGSA 3WIDA 1O8CA 4EEXA 5B37A 1HEUA 2LDXA 4QT0A 2GNAA 5I7FA 4GGOA 1NTOA 4E0BA 1ADFA 5ICMA 2FSVA 4ZN6A 3PHJA 3DHYA 4DLLA 1I2BA 3HSKA 2AEJA 3ZCXA 1B7GO 3H9EO 3OIGA 4F3YA 2VWPA 2B35A 2P9CA 3HN7A 2B4TO 2C54A 1H6AA 4JNKA 3S8MA 3HDHA 4E2WA 4PG8A 4A2CA 4RLSA 3ADPA 3TZQA 2G17A 1Z74A 2A94A 1V3VA 4CLOA 2C7GA 4Z0TA 3AK4A 3ZI0A 1ZVMA 3VDQA 3QY9A 3RASA 2Q46A 3QRWA 1YBMA 3NX4A 1HYEA 2POQX 2V65A 3JD3A 3PWSA 4K26A 1ZXLA 4RQTA 5G0TA 5FI3A 4B7CA 4G5HA 2JKVA 3JQ8B 3VTZA 1LA2A 3RFTA 4HXYA 1CWUA 1I8TA 5KJ1A 1X7GA 4AJKA 3KB6A 4RORA 1ZK1A 1ARZA 2HRZA 1ZK3A 1DRUA 3U5TA 4Y9DA 1I3NA 3L4BC 4RDHA 1B8VA 3JQDA 3ORFA 3AFMA 3KBOA 3ETEA 4EGFA 1NWHA 4BGUA 3PHLA 2GN8A 1E7QA 1VM6A 1UP4A 1XCBA 3DAFA 3K31A 3LC7O 4I1IA 4L75A 3W8DA 4A7PA 4E2XA 1PJ3A 3CIFA 4DREA 1DOHA 2FY8A 4BMSA 4BKUA 3BMCB 3ONEA 1NNUA 4II2A 3CUKA 4JGBA 3HDJA 4RVSA 5JSFA 1ADCA 1O94A 3H4VA 4PLWA 4BNIA 3ETGA 4LGVA 2P2SA 1UDBA 4IMPA 3OECA 1E3SA 4YRAA 3UXYA 1GZ6A 2H63A 1AXEA 3GGPA 4CMGA 3KSZO 3U4DA 3EY4A 1PS0A 1VKNA 1F14A 1QYWA 3JQ8A 4FD3A 2G1UA 2IE0A 3SJUA 1D1TA 5A04A 3OF2A 4R5HA 3A06A 2VRCD 4O6VA 2PV7A 1QYDA 1ZH8A 4ALLA 5IZ4A 3ITKA 2JCXA 3RBXA 3VPXA 1KVQA 1HDZA 2Y0CA 2WYVA 3Q1LA 4XQGA 3GVPA 2HK8A 4J1QA 3MZ0A 3UOGA 1NR1A 3OETA 2HK7A 3VKVA 1XYGA 2Q1WA 5L7TA 4NBUA 3DAPA 3D3WB 3BMCA 4DPLA 4HKTA 2VN8A 4ESOA 1MV8A 1HDOA 1HF3A 4D0SA 2VHYA 4CR8A 4XA8A 3IL2A 1FK8A 1ZSNA 3ZDFA 1SNYA 2O3JA 3P19A 1XHLA 1KY4A 1ZSYA 1PQPA 2Q2WA 2B5WA 3WGYA 4CMCA 4NR0A 3ZV5A 1ENZA 5TNXA 4TVOA 4RVUA 3FBGA 3CE6A 3O03A 3V8BA 2PD6A 3DBRB 3GFGA 4H3VA 4J4HA 1U1IA 2BMAA 3BTSA 4EW6A 2DM6A 3QQPA 4J91A 5L95A 4I5EA 2FSSA 1LEHA 1ZK0A 4AJ4A 1XEAA 5DOZA 2BGKA 4ILKA 2EJVA 1O9BA 1UJMA 1TT7A 2VWHA 2D1YA 3L4BA 4BNTA 4XYEA 5EQDA 1GZ4A 3HN2A 4BUCA 2DPGA 3D3WA 4R16A 5C3MA 1NM5A 3GC6A 2EJWA 4Z9YA 5C7LO 5L7YA 3WTCA 3SC4A 1P0CA 2VOJA 3NYWA 2C0CA 1XWFA 3IJRA 4MINA 3ANLA 1YQGA 2RH8A 4GI2A 4FN4A 4MIYA 3BZUA 2RCYA 4U0KA 1O95A 4HFMA 4Q3BA 3DBRA 3DC2A 5CDYA 4YAGA 3CMCO 1BG6A 1Q0HA 1WLYA 3SLKA 1U8XX 4LW8A 2Y0DA 4MVJG 3V5NA 4BO5A 4CM4B 3NUGA 3KYCB 1WAMA 3D3EA 4UVDA 2PGJA 2HSDA 3ABIA 4YT5A 3F5SA 3JD4A 4R54A 2WD7B 4JQCA 2PGLA 3GPDG 3EZYA 1JU9A 4YBZA 1PJSA 1X15A 3JYOA 4MVJI 1NYTA 3WYCA 3E9NA 3NT4A 4BGVA 4RV9A 1TA4A 2J6IA 4IDAA 4WECA 5EQFA 2JFFA 4QFDA 1C1DB 4FR5A 1YQXA 1PJCA 3HFSA 4ZRNA 4UAGA 2VNSA 1E1NA 4NHEA 2DU8A 1C1XB 3WFIA 3GG9A 4W6ZA 3NKLA 4J7CA 4IBOA 1X0XA 3BTUA 4RVDA 3ZWPA 5ADHA 1BMDA 2GSDA 1T2EA 1XQ1A 3LF1A 4QQRA 4Q9NA 4GX1A 1V6AA 3PJFA 3ZZNA 2CUKA 3DOJA 3ZHYA 1CRWG 1E3JA 4U6QA 4CM4A 4HNHA 1MX3A 3TOXA 1C0LA 3GN1A 2ZTLA 4Q3EA 4FPXA 4LISA 1T4BA 4LRSB 4NMHA 2NU8A 2V7PA 3P7MA 3FRJA 4JP3A 1HKUA 4NG5A 1L1FA 4DTIA 3I23A 4I8XA 5A9SA 3H65A 1E3IA 4I9HA 4XJSA 3PK0A 5T64A 2Y05A 1XGKA 3AOEC 1AE1A 1C1DA 2HJSA 3LZ6A 1GCOA 5T5QA 2HMUA 1U4OA 5I8WA 1C1XA 2DPHA 3JSAA 5B4VA 2B4QA 2VT2A 5ER6A 3LU1A 1DC3A 1M67A 1GTMA 2B36A 2E82A 4XZ3A 5AVOA 3RU9A 5A9TA 1D8AA 5IDQA 3FHLA 3GVHA 4BO1A 2Y67A 4L8VA 2OXIA 2WJPA 4ZHSA 2LDBA 4F45A 2PZKA 5TGDA 3EK2A 4BS9A 3C7CB 3BAZA 5A9RA 4XQEA 5BQFA 1G6KA 1JW9B 5CAEA 3X2EA 3GZ4A 1LQUA 2CNBA 4GWKA 2DKNA 2W90A 4E5NA 1B26A 3LYLA 4J90A 2JCYA 4I5DA 1GYQA 2I3GA 3DO5A 3P5SA 3U4HA 2HMTA 3L9XA 1HLDA 5FYDA 1Z75A 4R9RA 2NUAA 4WKGA 1M6WA 4TSKA 3FNGA 3I9MA 1L7DA 3TF5A 4E31A 1E3LA 2HJRA 1RYDA 3GDGA 2AG5A 3IMFA 1SC6A 2GGSA 2BLLA 4CM6A 4MVJD 1ML3A 3RUAA 3VC7A 4XR9A 1PEDA 5A5EA 2Y1FA 1IUKA 2EEZA 3LLSA 3GFBA 4RQUA 5DOVA 3H8VA 3S2GA 4CPDA 5JS6A 1DFHA 1I36A 4PLGA 1XIVA 4LK3A 3LF2A 4PN3A 4X54A 1HZJA 3PQFA 3NDRA 1E6EA 3QHAA 2GCGA 1LU9A 2I66A 1SEPA 2DFDA 3RC9A 5AXDA 3FPCA 3WMWA 2HAEA 5CDUA 4A73A 5DBFA 4MKXA 3WNVA 1H6BA 4XYBA 5EJ2A 3JQAA 3FBTA 4UUOA 3KSUA 2HMWA 4KOAA 4GPD1 4FDAA 1O0SA 3L6OO 1M75A 3AY6A 2DUWA 2FPIA 1UZMA 2ZATA 1VJTA 4FC6A 4ZGWA 1SZJG 3FN4A 5J23A 5AXAA 2QX7A 4CMHA 3OEWA 1YOVB 1H6DA 1NPTO 2YUTA 3HB5X 5JC8A 2I76A 1JKIA 3OHSX 2JL1A 1W6UA 2CDAA 2J3JA 3GG2A 3TPCA 1E7RA 5IXSA 1IL0A 5ITVA 2EV9A 5CG1A 1FDVA 3IP1A 2WD8A 4GQAA 5JC1A 2G0TA 3LT0A 1ONNA 3BIOA 1N8KA 1PZGA 4DYVA 2Z1NA 3ZNNA 1YONA 4DMLA 4CODB 3C8MA 2C7VA 3MOIA 1ZCJA 3BHIA 3GH3A 4GLLA 4RPHA 2O3TA 3H7AA 4KWIA 3JTMA 3VPGA 5JYEA 3WGOA 1N1EA 4RZIA 2ZYDA 1ZBQA 2PWZA 4NDNE 4YT8A 4K6CA 3W8FA 1IPEA 1LSJA 1DJQA 1D3AA 4C4OA 1ADGA 3BMOA 2GZ1A 1XQ6A 2NWQA 4TRRA 3GVXA 4I5FA 4CM5A 3E1KA 2Q50A 3L07A 3IKVA 4YT2A 3U0BA 5DNAA 2WTBA 4MP6A 5KVQA 1NVMB 5JYDA 2HMVA 1OI7A 2P9GA 4LRTB 1I2CA 2W2KB 4FFMA 1ONPA 2OBNA 2OGUA 5TC4A 5G4KB 5IAAA 1T24A 4L4SA 5JAIA 4IUYA 4D7AA 4MO2A 3K2EA 3I1JA 3ZV6A 3HNPA 5EPOA 2O3SA 3WYBA 1K5HA 3RFVA 5TF4A 2EG9A 2QZZA 3ST7A 5CFZA 3PGXA 2DUUA 4OSPA 2I65A 3BHJA 3HE3A 4TMFA 4FGWA 5AXCA 4Y6SA 3H9GA 1MG0A 2AQKA 1KBZA 4KUEA 1MXFA 4CQMB 5L51A 5I9MA 2GZ3A 4MVJM 4F46A 3F46A 4MPDA 2Y1DA 4E6PA 2C5EA 2W2KA 1A4UA 2QG4A 3GOHA 1XLTA 3DBHB 4R69A 4PZCA 3LSYA 1GV1A 3HDQA 1J6UA 4XKJA 1IYZA 4GVXA 3ZU3A 1ORRA 3ZWXA 3ZN2A 4BNXA 3DR3A 1E6WA 2H5LA 5DT9A 1MLDA 3FF4A 3JQFC 4DC0A 4DIBA 2OORA 1CQIA 4NNJA 3ROMA 4BMVA 4MVJP 3QW2A 3GA0A 1VL8A 4YYZA 2DT5A 2HMSA 3G49A 2J3HA 1NHGA 2BFAA 1X7DA 1UH5A 3AUUA 3HDYA 3AM5A 4BO2A 1NAHA 1R0LA 4C7JA 4CQMA 1LDYA 1YDWA 1XU7A 1GPJA 3W4JA 4EI2A 1UDAA 2NU9A 2PH5A 5K9ZA 4BNUA 1BSVA 3WGGA 1W0CA 2VCYA 1MG5A 2NU7A 3IOYA 1X13A 3DBHA 3E82A 1R6DA 1ZSVA 4LVCA 3W8EA 1H2HA 1NQOA 2GD1O 1PL7A 3QSGA 1EMDA 1NVTA 3H5NA 3GUYA 1NX6A 1VPDA 1QKIA 3GGGA 4IQ8A 2GYYA 1DSSG 2WWRA 3DFUA 3CZRA 1F12A 4J7XA 4G2NA 4TQGA 4CLXA 1L7EA 4J4BA 4E5KA 9LDBA 4RO0A 3W1VA 1HDXA 1PJQA 4BNMA 1IHYA 1FDUA 2Y1GA 4Z0PA 1PWZA 1RM4A 2FHSA 2NADA 5JDIA 4XIJA 4YQYA 1QYVA 1JWBB 4JJFA 2RIRA 3WDSA 1BHSA 3IP3A 3FPLA 3E9QA 3GT0A 4L4XA 1QXSA 3ZGYA 2Y93A 4RF5A 4H15A 4TRNA 1NQ5A 3A1NA 3DTTA 4ITUA 1I33A 5A3JA 4WLNA 1ZEJA 2D8AA 1LLUA 3WIEA 5IZCC 3JQFA 4XD2A 1JWAB 1GV0A 1P1HA 4IDGA 1R15A 2D2IA 3G1UA 4GKVA 2ZTMA 4OH1A 1IHXA 4ALIA 8LDHA 2CZCA 1EQUA 4FCCA 1OOEA 5JLAA 5CDSA 4PLVA 4CV2A 1KC3A 1ZZEA 2EGGA 3LT2A 3OQBA 4YR9A 2ZTVA 3G3EA 3NV9A 3UKOA 5K0ZA 1IOLA 5B1YA 2DBVO 2CY0A 4NFSA 4RL6A 4IM7A 4EUEA 1JKFA 3DOCA 1VC2A 4YAKA 4II3A 5CHEA 4J0FA 3DZFA 1ZFNA 1SB9A 3L6EA 4JBHA 2ZQZA 3I6QA 3RUEA 1MGOA 3LLVA 3ZWNA 2O48X 1DLJA 2VRBA 1P1IA 4PRLA 4U8GA 4WE3A 1E3WA 3I9NA 1EE2A 2QQ5A 1G0OA 3QWBA 2AXQA 2DTDA 1GEGA 2I3AA 5GY7A 3ZWCA 3OA2A 4RF3A 2QW8A 2P4HX 4ALKA 4BB5A 4RJTA 3H5AA 5T67A 3GRPA 4YB8A 3PYXA 2CDBA 3QVXA 1YRLA 4J9UE 4M54A 2ZK7A 3TZCA 4QO7A 3VAZA 2WE8A 4PLTA 1Y8QB 4C7KA 2O2SA 4JIGA 4D43A 2J3KA 1Y81A 2DBRA 5BNTA 1ONOA 2Z95A 3VHRA 1P45A 3AJRA 5KVVA 1JVSA 2WE7A 4CUKA 1E0DA 4UUMA 4EJ0A 1ZNQO 4PLCA 5I7VA 5T57A 1Q2XA 4J49A 1HDCA 3RC1A 1E7SA 1GDHA 3I9KA 3KSDO 4AG3A 5DZSA 4Z3KA 5IZCA 4IDEA 3F4BA 1EE9A 5BT9A 3MOGA 3NDJA 4MP3A 1DFGA 4IGFA 1OC2A 3NGXA 5CPFA 3WB9A 1NQAO 2I99A 1XSEA 4YACA 1W4ZA 3ZH2A 5C7IO 5KJ6A 1X1TA 1T2AA 4FW8A 1IE3A 3CKYA 5CEEA 1DRVA 5F1PA 1LLCA 3MCVA 3D4NA 4GH5A 2ZIZA 5EN4A 1I01A 2GZ2A 5BNFA 3RI3A 2W8ZA 5EL0A 1KEWA 4QTZA 1Y8QA 4ND5A 1J0XO 3KO8A 2QRKA 1WMAA 4FFOA 1BXZA 5A1TA 1UXIA 2VUSA 1Q7CA 1NFRA 1T2FA 5CEJA 1YO6A 4TROA 1HLPA 3GY0A 2P68A 4KMSA 1YBAA 3KXDA 3GMSA 1P44A 2BHLA 1YVEI 4UEJA 3U62A 1A72A 3ETDA 3O26A 3WGHA 1YGYA 3HFGA 1SCUA 3OJ0A 2E37A 4WLVA 3AY3A 4CM7A 2NTVA 4I9NA 1AHHA 1F0YA 1JQBA 3LVFO 2AG8A 3AI2A 1PJLA 3JQEA 3RUDA 1DEHA 4CMEC 3WR5A 3CXRA 5G0UA 4K28A 5A05A 2EP5A 1H94A 2PY6A 2Q4EA 3U4IA 2NSDA 3WQQA 1PS9A 1UZLA 2Q1SA 2X4GA 3WJAA 5JY6A 4CLRB 3VKUA 1IULA 1HDRA 3SBOA 3WBFA 7MDHA 1LBEA 1NWCA 3OFSA 1V9LA 4EUHA 1HE5A 4GMGA 2UV8A 5H82A 4RPLA 1P1KA 4GX2A 2JD0A 4YWJA 1GR0A 1JVBA 3UICA 4MP8A 1HZZA 1T1SA 2BFOA 1OFGA 3RC7A 4BNYA 3BHMA 1J49A 5JY1A 2PGDA 2IODA 1TEHA 1LSUA 3AY7A 5JE8A 2JD2A 1YL7A 1AGNA 2FOIA 3KEOA 1C0PA 4J16A 4TKMA 4B4OA 3EVNA 3RUCA 3AU9A 4CL3A 4YA6A 1VI2A 3FTNA 3WGIA 4FFRA 4J1SA 1Y7TA 4CLRA 3LQFA 3PDJA 4J0EA 4P4NA 3RWBA 3ZHBA 1YKFA 4D45A 1RYEA 3VZPA 1V35A 5AOVA 4NJOA 4BO0A 3F5QA 2FPPA 4PVCA 5IDYA 4M86A 2VUTA 2P9EA 4PLHA 3I9LA 1PJTA 3NT5A 5DP2A 3OJFA 1GY8A 2GO1A 1Z6ZA 3MJ4A 4FBGA 4R3WA 4N7RA 4WCDA 2BD0A 1KEPA 3PGJA 3AM4A 3CTMA 2PKQP 5JDCC 1ULSA 2ZCVA 1U2GA 4XDZA 1FJHA 4XRGA 4BQRA 2J5QA 3KUXA 2H1SA 5U1PA 4CMEA 4MOWA 2QZ9A 5KNLA 3AWDA 4YAEA 3I52A 4XCVA 4XYLA 4DVJA 5JAMA 1W8DA 3GN2A 4BKRA 1UXHA 1AN9A 5JAZA 3HHPA 4B3IA 5KIAA 1EVZA 1ZUD1 1EUDA 5L45A 2UYYA 5IJZA 1LQTA 3TOZA 2ZCUA 3RAJA 1CDOA 5DN9A 2X58A 4OXNA 4AJIA 2C82A 3WX0A 1R16A 2Y0EA 4FFPA 4WLOA 1PR9A 4GKBA 3LDHA 3DL2A 5COBA 1EFLA 1E5LA 4DQXA 3GEGA 4I5GA 1RM3A 1VJ0A 4WCFC 2NU6A 5THQA 3PDUA 3V1YA 1MC4A 3UH1A 4EITA 2A92A 1BDMA 1VL0A 3G1TA 3M2TA 1N92A 3ZU5A 3DHEA 3KM0A 1GFSA 2NLOA 5A9SB 4FJ2A 4W7HA 1YE3A 1DXYA 3FWNA 3EGOA 4OKNA 4OO3A 3L9WA 3NT2A 3OSUA 1LDNA 1YB1A 1E1KA 1GAEO 1PGNA 1R4NB 1WZEA 4PVDA 1HSOA 1WMBA 3GHYA 1DAOA 4PLYA 4QEDA 4CM9D 2VWGA 1HSZA 2JFGA 1GYPA 4RDIA 1ISIA 5HWSA 1I32A 1A27A 2ZKLA 1I30A 4E5MA 3AU8A 3IAHA 3WBBA 1P74A 2RHRA 1V8BA 5IDXA 5JW6A 2IZ1A 3WGTA 2EHDA 4BNJA 3F3SA 5F5LA 1QV7A 5JDCA 2CFCA 4BGIA 3C3XA 4BNFA 4D46A 2D59A 4J1NA 2R00C 3RU7A 3L6DA 1Q7BA 3JYPA 4CJXA 3WMXA 2HLPA 3D5QA 4Q39A 5DBGA 3MJCA 1LXCA 3PJEA 4WCFB 4YAIA 1LJ8A 1EK5A 3K92A 4Q3DA 4CR6A 2VWQA 3DQPA 4BL5A 4ALJA 3FCOA 4WK6A 1UXJA 3IQDB 3ANNA 4LN1A 5MDHA 3FR7A 3I9OA 1U9JA 1ISHA 1F17A 4AJEA 1R4NA 1ZK4A 1I2ZA 3Q9UA 4B8ZA 4AICA 1KERA 3C7AA 3EUWA 1KETA 4OSOA 4YJGB 4EDFA 3OQ6A 3W6ZA 1BTOA 1EBUA 2F00A 3DZKA 2XF8A 3H2ZA 3NGLA 2IXBA 3ZNQA 3BMQB 4JXKA 1Y9EA 4MIOA 3RBVA 4E33A 4WNIA 4IQGA 4FQ8A 4J6FA 4GWGA 1SO8A 4RPJA 3ZWBA 4YAJA 4E2ZA 5T8KC 4J2HA 4AJ1A 4R1SA 1WXDA 5GZ6A 5K6AC 4E5PA 4L76A 2E48A 1KIFA 4CL8A 1FDSA 1K3TA 3PZRA 5EERA 4ZJUA 1TLTA 1N7HA 1CYDA 3G0OA 4TRJA 3WLFA 1U3VA 4WCFA 4R1TA 3FWZA 5JMWA 2BGMA 1JA9A 1B8UA 1UDCA 4IS3A 1HYHA 3IDSA 1Z45A 4J9VA 3AOGA 5A02A 3S1LA 1FMCA 3Q2IA 2BI8A 3JQAB 2OFPA 4JROA 1GD1O 3VPHA 3VDRA 2JD1A 4JBIA 1PGJA 1ISGA 3OBBA 3Q0EA 4PG7A 1MA0A 3F9IA 4YJGA 2YDXA 1SEVA 2X1HA 4R4JA 4BNVA 1BXGB 3KOUA 1BDBA 1IY8A 1BVUA 2QHXA 3BMQA 3D5TA 3W4KA 2IEBA 2D3TA 4M87A 4U7WA 2B37A 3JYLA 1EUZA 2X0NA 1HTBA 3GLQA 4AJHA 5CG2A 2FZWA 4A27A 3C1AA 3EDMA 1BW9B 2EKLA 1KC1A 1KVSA 4W7IA 3VH3A 1DDOA 4Y6PA 5JPIA 1H0KA 2P91A 3GNTA 4XQCA 1GUYA 1E7WA 3EAGA 2I5PO 4HP8A 4AFNA 1U5CA 1ENYA 3CEAA 3K5PA 3TJRA 3TL2A 3TZHA 1D4FA 1Y6JA 3QV1A 2R00A 3UGKA 4DRYA 2UAGA 3L77A 1VSUA 4HBGA 3A28A 3MJVA 1KY5A 4PCVA 2JJYA 4IJWA 1WW8A 2NV6A 4TZKA 4XYMA 4ZRMA 4OKIA 1DIAA 4BNHA 1YS4A 2VT3A 1BXKA 3ZWOA 2PKRA 4PG4A 2AE1A 3I4CA 9LDTA 4D44A 1UP7A 1J5PA 2X0JA 2IYOA 1LDMA 2GRAA 3AOEA 3IUSA 2E4AA 1GU7A 1ENPA 2D5CA 1BXGA 1H6CA 4R1UA 4DL9A 4OQYA 3DMYA 4IMRA 4P4LA 4PZEA 1NQTA 4B79A 5L9AA 1PJBA 3BMOB 4INAA 2GN4A 1FDTA 3U09A 2GERA 2NNLD 1S7CA 3GZNB 1PGPA 1B15A 4RCVA 4W4TA 1E7YA 5I9LA 3PJDA 1BW9A 3K96A 3JD2A 3V2UA 4LCJA 5T8KA 4WPGA 3T4EA 5HRUA 1PGQA 2Y1OA 1VKOA 5TQVA 1DIGA 3C7DB 3JYQA 2PD4A 3VVCA 2O7QA 2C07A 3A14A 4TZTA 1K6JA 2DFVA 3RC2A 3PJGA 4LCEA 4ZVVA 3OJEA 2VZ8A 4ND4A 2JHFA 3WSVA 3GF4A 2X22A 2HKIA 4OXYA 2H6EA 3E8XA 2OP0A 1ZMOA 4UEOA 5T6BA 2BRUA 3BMNA 3R0IA 1UAGA 2DQ4A 3CZMA 4BIIA 1UZNA 2OMEA 3DBVO 1HRDA 4KZPA 3I4FA 2X9VA 1CJCA 4LVUA 4ONEA 5KVSA 3GZNA 2VZ9A 2Q1TA 4YJDA 5TT0A 1U2DA 4DQVA 1PL6A 3MWDB 5AYVA 1GQYA 1DLIA 2IEDA 2V6BA 4Q3NA 4QXMA 2RBEA 3FTPA 4OQZA 3GRKA 5G0WA 4WNCA 4QSMA 1FF9A 3OIDA 4Y98A 2E49A 3OMLA 4NK5A 3QE3A 2AEFA 4NH4A 1IPFA 1G0NA 3HQ4O 5DBIA 4BNNA 1AXGA 1YB5A 3RJ5A 3DAGA 3ZWAA 3FNEA 1LRKA 3G79A 4KTVE 4XIYA 3UUWA 5IXYA 1XG5A 3PHHA 3H9QA 4HV4A 4JN6B 1K6IA 2W98A 3IUPA 4PIVA 1C0KA 2R6JA 1ZJYA 5L4LA 3K73O 3NTOA 3NTQA 3E03A 4D3DA 1ZO8A 4D41A 2RAFA 1H93A 2C29D 3RD5A 2FWMX 1GZ3A 3VTFA 3WFJA 4DMMA 4WASA 4ZICA 2GN6A 5IN5A 5TJ9A 2NACA 3INTA 1GPDG 2NQTA 1LC3A 3WQRA 2CD9A 4CLEA 4U5QA 1SAYA 1AUPA 2WEKA 1HETA 1HXHA 4PLFA 4BVAA 5FI5A 1DC6A 4WEQA 1X0VA 2O2YA 2X0IA 4R1NA 4A10A 1F06A 4A26A 4EJMA 5CDGA 4AVYA 1A9YA 1SPXA 3PEFA 2OP1A 4IDBA 3Q11A 4MKZA 2PR2A 3QWHA 2IYPA 1Q1NA 1NFFA 2EP7A 3ZW8A 3QVSA 3QWFA 3ZU2A 4DBVO 2C20A 2NVBA 3KYDB 1VJ1A 2VRCA 3LC2O 4A03A 3BTVA 3TZKA 3MWEB 2JAHA 3JD0A 2Y99A 3KHUA 2EXXA 3R3JA 4PFJA 5AQ1A 4RLHA 2DVMA 2Q2QA 4WEOA 2ZYAA 2P4QA 4BNKA 2C59A 2AEMA 3HADA 2JHGA 3HG7A 3PWZA 4EBFA 4JX8A 1V3UA 1WZIA 1LDEA 2UDPA 6ADHA 4HWKA 3IC5A 2BFPA 1PJ2A 2B4RO 3C85A 4YXFA 3H2SA 3QWAA 1E1MA 1SMKA 2X5OA 4A5OA 5TRTA 5ENDA 3RUFA 4PRKA 3BA1A 3C1TA 4NBTA 4DLAA 4E32A 3ZWVA 4CQLA 4BKQA 5JO0A 2JCVA 4FSHA 5C37A 4BV9A 2AQ8A 3ZNOA 4QFCA 3RUIA 1E7MA 4GX0A 4IINA 3MEQA 2PD3A 4G81A 3N74A 1SBYA 3N7UA 1NASA 5L4SA 1B0AA 5BSHA 2Q3EA 2OUIA 3OICA 3UN1A 3WTBA 3VZRA 4DC1A 5HBRA 5EINA 3KYDA 2GASA 2WSBA 3WQSB 1B2LA 1B16A 4TKLA 4CM8A 1OZAA 4W9NC 1A71A 1EDZA 4R51A 3RJ9A 3ZU4A 5HA5A 4RPKA 2CSUA 4J4TA 3VH1A 4XGIA 2CF5A 3NJ8A 2B69A 4R68A 3QVOA 1TVEA 4MVJF 4ALMA 1NXQA 1YBVA 2HRBA 2EIHA 4WLFA 3WXBA 3JQGB 1QORA 1H9AA 2AA3A 2HDHA 4FIZA 4KDEA 3RIHA 4DUPA 1ZEMA 1F8GA 5F1KA 1B8PA 1U3TA 5GZ1A 3GVCA 4YT4A 3KRTA 1B3RA 5U4QA 1NPYA 1OAAA 3S2IA 4AL4A 3D0OA 4GLOA 1E92A 2IZ0A 1DJNA 2NTNA 2AW5A 3TN7A 3E5RA 4RF2A 1UP6A 1E3WB 3O8QB 3M2PA 5BSFA 1QMGA 3F1LA 3JQ7B 4YTEA 1B14A 5HS6A 1ZXBA 1PL8A 2TMGA 1U3WA 4O63O 5EMHA 2AE2A 6LDHA 1RPNA 5ER9A 3OA0A 2NQ8A 2YHUA 5FWNA 3RCBA 3RROA 4O0LA 4Z9XA 4ZD6A 4AJLA 5DP1A 3KTDA 5MGBA 1HT0A 5JFOA 4GMFA 3VOSA 3IKTA 3JQGA 4R01A 4MJLA 4AJJA 3M1LA 4GBJA 4H16A 1Q7GA 3WG9A 4P22A 2P5YA 3INGA 3B6ZA 4MIEA 4ZA2A 4FFNA 1TXGA 1DHRA 1ISMA 2QIOA 1X7HA 4Z3DA 3I6IA 3L0DA 5FF9A 3ENNA 1E6UA 1R66A 4A0SA 2IZZA 4TWRA 3RFXA 1MP0A 4O1MA 4XGKA 4LSMA 1WPQA 2WYUA 1A5ZA 3VH2A 1QRRA 4FGSA 2RH4A 1EZ4A 4PZDA 1DRWA 3Q2KA 1GQ2A 1H2BA 2J3IA 1W73A 4BO8A 3GDFA 2ZB7A 3O8QA 2B83A 4KUGA 2O7SA 3VZSA 5EIOA 4XDYA 3JQ7A 4I9UA 3KZVA 4ZQGA 4NI5A 1VL6A 5H81A 5TT1A 2EGHA 4GL4A 1QSGA 3ULKA 3PFWO 4IQ0A 4E2YA 1Z82A 1HE2A 1I3LA 5ES3A 1DAPA 5TLSA 3UAGA 1I0ZA 1R4MB 3TRIA 3RVDA 3DONA 2F1KA 5TS3A 1P33A 1T2CA 1T4DA 1VRWA 3CSDA 1GQQA 5ILGA 4BQPA 3RKRA 4CMKA 1LLQA 1A7AA 1QLHA 3STHA 3F1KA 3H9JA 3F47A 3M1AA 4XB1A 2R2GA 3ICCA 1JN0A 4O5OA 1U8FO 3JQAD 3AUAA 3GR6A 3T4XA 1PQWA 2Y68A 2V6MA 4RF4A 1I24A 2VYNA 3KEQA 4IPTA 1P1FA 4BO4A 2BFMA 2QYSA 3EZLA 2CVZA 2YFQA 2YQ4A 2A4KA 3H3FA 4S1VA 4G65A 2C2YA 1P0FA 3K8ZA 3V1UA 3WGQA 1EQ2A 4OHUA 5BSEA 3B1KA 3FSRA 1LLDA 3KV3O 1DIHA 1WDLA 3B1FA 1YL5A 3FNHA 4KQXA 2GUGA 4N18A 4YPOA 1RM5A 1R4MA 3DBLB 4DBZA 2BGLA 3WS7A 2DC1A 2UVDA 4HUJA 4NIMA 2W2LA 1UUFA 3RQSA 1HYGA 1TI7A 3FD8A 3PFFA 5AXBA 4CM1A 2X5KO 4J1TA 1T25A 3INRA 3NJ4A 2UUPA 5COQA 4NU5A 2PLAA 4HFJA 4UVIA 4B8WA 4YRBA 3H3JA 2HK9A 4BNWA 2Y1CA 3ASVA 1XA0A 4WGGA 1U3UA 4DIOA 4E4YA 1GEEA 4FOOA 1TB4A 2D4AA 2OO5A 1R37A 4FJ1A 4OL9A 2ZB8A 2ZJ0A 1KS9A 4OOFA 3UHAA 1CETA 5HM8A 4CV3A 2O3UA 4CUZA 5F3RA 1DBVO 4D3SA 3ANMA 5HTOA 2PFGA 3DDNA 3PYMA 3PLNA 4KTTE 3DBLA 4EUFA 5IN4A 3ZHXA 3E18A 4NJMB 4IDFA 4R5MA 4W99A 5JCJA 4EZBA 4RVFA 3LK7A 3ZWYA 4FC7A 3QLJA 1VE9A 3SLGA 2FP4A 3NDIA 3NAQA 4Y67A 2GDZA 5JCXA 2PK3A 5HS4A 1NHWA 4XQ9A 1E3EA 5TX7A 2BKAA 1Y1PA 2Q45A 1P1JA 2VHWA 3PHGA 3X2FA 3I9JA 1NPDA 4XEHA 2EKQA 2WDZA 4CV0A 5JO9A 2DAPA 3MTGA 1GL3A 3F4LA 2DTXA 2HO5A 3IS3A 4BKPA 3DMTC 4CMJA 5BNIA 2VHXA 4YQZA 4GAEA 4M8SA 4WLEA 1LSOA 4YJFB 3EVTA 3PRJA 1O89A 4M89A 4OMUA 1PZEA 2JFHA 4N5NA 2NM0A 1EEHA 1PR3A 4U6SA 5LC1A 5BSGA 3E9MA 4JCOA 1YJQA 3O9ZA 4QECA 3QWIA 4XRRA 2GF2A 5DCUA 3K2BA 4IXTA 4R9SA 4OXKA 5F5NA 4NJMA 3TZ6A 3RSHA 1GADO 1QYXA 1BWSA 2X5JO 4JK3A 3PVZA 3ZV4A 4BMNA 1C3VA 2PNFA 2ZYGA 4BNZA 4XGNA 2X8LA 4GGPA 2BF7A 4OGWA 2FN7A 4E5YA 2GR9A 3DEYX 4ND1A 3CH6A 4PLZA 1HE4A 4D42A 4YVFA 4N5LA 4YJHB 4H7PA 5L3ZA 3D4OA 4IJVA 5I9NA 5KVCA 3GDOA 4ZQFA 1ID1A 3B70A 1P77A 4YJFA 3ROQA 1HE3A 4CQMD 3PXXA 1DPGA 3PI7A 4J7UA 1Y8RB 3H9UA 3E48A 2BELA 1A4IA 5L40A 4J3FA 1PX0A 2J5RA 3E5MA 2Z5LA 3WYEA 1X1EA 3JV7A 4GVLA 4MKRA 4RZHA 4B4WA 1I5RA 5KCZA 4UVGA 3GPIA 4HX5A 3GAFA 1EVIA 2TMDA 3EW7A 5L4NA 4OIMA 4L0QA 1CERA 1EBFA 1QV6A 3RBZA 1G1AA 3TWOA 1DB3A 2B5VA 8ADHA 2EWMA 2GPTA 5A3VA 2GLXA 2V6FA 3ONDA 3GK3A 2O3QA 1M6HA 3SX2A 2ZB3A 3COSA 4NBWA 2YHIB 3HZZA 4JJIA 2V6GA 3K6JA 1EVYA 2YFHA 3TL3A 1XELA 4EEZA 1ISFA 1QLJA 1NP3A 1Z73A 3DZHA 5F1OA 4YJHA 4L74A 4R3NA 1MFPA 4HY3A 4J43A 3DMTA 1K2WA 5JMPA 4PG5A 1K0UA 4NK4A 1RJWA 1Y8RA 5LDHA 4DWVA 1MUUA 4BO6A 3ZWWA 4YRDA 4RGBA 4E21A 1N9GB 3QVWA 3OEYA 1P9LA 4ZU3A 1MB4A 3WICA 2Q4BA 4L9RA 3CPSA 4KDFA 3NEPX 4DPMA 4E30A 2OOSA 3PLRA 4ID9A 3Q3CA 5JNLA 3AUSA 3ITDA 1PJ4A 2X9NA 3R6DA 1GUZA 2YHIA 5TJHA 3K9QO 1NVGA 3D64A 4UEKA 4Y8VA 4Y6RA 5CEFA 1NBOA 2AQIA 3ZW9A 4CR7A 1ZKMA 1ENOA 4UVHA 4M49A 5I8ZA 2HCTA 5DCYA 3QJ5A 2UUOA 2ET6A 2QYTA 3SXPA 3VH4A 1OMOA 5FFFA 4OOEA 1PU2A 2NTJA 3UF0A 2SCUA 3T7CA 3ZHZA 4CUJA 2FR8A 2P5UA 2FRDA 2DBZA 1N9GA 5C7OO 4QX6A 3PQDA 3ONFA 5KKCA 2VYVA 4NFHA 3FI9A 3EYWA 1DIBA 1QP8A 3DFZA 1I3MA 2EW8A 4PLPA 2O4UX 2XXBA 3QVTA 4QO8A 3DZBA 4LSWA 5CP8A 1PIWA 2I6TA 4B4VA 2G76A 1WDKA 4KUHA 4JJGA 2FMUA 2JAPA 2E6UX 2BI7A 3KYCA 3P2OA 4Q3AA 5KJFA 1BVRA 4IZIA 4KP7A 5C5IA 4AJOA 3ZWMA 4UREA 2VHZA 2WD7A 4CLHA 1C0IA 1F8FA 4IY1A 4Z9FA 2FR1A 1MFZA 3QP9A 3WWYA 1UXKA 1ZMTA 1H9BA 2YW9A 1P31A 4GSLA 1KVTA 1FXSA 1PS8A 1RWBA 3PZBA 4BOYA 1XKQA 4U0JA 4NZ9A 1WP4A 4JLWA 5JBIA 4P38A 4MVJH 4ZQEA 2O23A 1PSDA 2VNAA 1EFKA 5BR7A 3D4PA 4BNGA 2AHRA 3LC1O 2VYND 4Z0HO 2I67A 2Q1UA 3DTYA 3GQVA 3ASUA 5COAA 1UR5A 2VZ0A 3MJTA 3PIDA 3UFXA 3UVEA 1B3BA 4IDCA 4Z6KA 5U9CA 2OZPA 1Y9AA 2YY7A 4F6CA 4FFLA 4M55A 5THKA 1RKXA 1KEVA 4DXHA 1KVUA 3B20A 3GEMA 4TVBA 2EW2A 5B4UA 2EF1A 4OAQA 4NFYA 1EK6A 2PZJA 1N2SA 1N7GA 2YJZA 4OJNA 4XX0A 1YH3A 3LT4A 1KOLA 3RUHA 5A06A 4DPKA 3S2EA 2A9FA 1IZ9A 4UVEA 4BO9A 3KETA 1DC5A 3I3OA 2VHVA 2W2LD 4YEDA 5G4LA 3PIIA 3M6IA 4ALNA 3WWZA 5F21A 4DYDA 1LTHR 3PYLA 4ZQBA 2C5AA 5DF1A 2ZJ1A 3PHIA 3TDKA 3D7LA 1H5QA 1YXMA 3IIEA 3R3SA 3AUTA 4CV1A 1OC4A 3CMMA 1ISJA 2A35A 4DA9A 3G17A 1ULUA 3MJSA 3DZJA 4IDDA 3BMNB 4KQWA 5DULA 1YQDA 5KJEA 3KYBA 2D0IA 1S6YA 2XOXA 4MDHA 1P1RA 3F6YA 2X7HA 5G0SA 2WYWA 1U28A 3I83A 2AQHA 2VTEA 5JCJD 4BGEA 5KJCA 3H5RA 3DXFA 5ILOA 4DIFA 5K6AA 4D0RA 1PZFA 1O5IA 1T26A 2J8ZA 4IGEA 5JXWA 5TIIA 3AW9A 2QRJA 4WJZA 5ENVA 2NVWA 1MXHA 4WUVA 1V0JA 2CMDA 3AM3A 1P3DA 3PQEA 1N5DA 2O4CA 1GUFA 3GUCA 1LC0A 1DIRA 2QRLA 3AFNA 4W82A 1QG6A 3OQ1A 4RVGA 3Q6IA 3JCZA 3KVOA 3TQHA 1ZJZA 3ENKA 3KLMX 1OBFO 4IS2A 3ROPA 4HNGA 3V2GA 2Z1MA 4GSKA 4LMRA 1WNTA 1HDGO 2DLDA 3DOOA 4B3JA 3DB2A 1R0SA 4D79A 2B0JA 1LRJA 5IFLA 1NAIA 2HUNA 1LI4A 3S55A 1HWYA 4CMIB 2YV2A 2C2XA 4BKOA 1ZIDA 3WJ7A 1VLLA 4XYGA 5KWEA 5A4DA 3JQ9C 2IDZA 1AHIA 1UXGA 1YJ8A 2DTEA 3JQCA 1D1SA 1YOVA 1LDBA 3K30A 4HFRA 1DHTA 4CM3A 2HQ1A 3VPSA 2YQ5A 4ND2A 4K6FA 1LSSA 3DZGA 5ITWA 4HADA 4XR4A 2D5AA 5IG2A 1BGVA 2HU2A 2X23A 4NPCA 1E5QA 1DC4A 2Y1EA 3TSCA 2NVUB 3Q9NA 5I7SA 2ZQYA 3PTZA 3E6AA 1DFIA 1YL6A 3EMKA 3W6UA 1YDEA 1SB8A 2Y66A 3GAZA 4DQUA 3O4RA 4BNLA 4CQLB 5I7EA 4NQZA 1N1GA 1Q0LA 1M66A 4IIVA 3ROKA 3UW3A 2FR0A 4CMIA 1KYQA 3JQBC 1QYCA 3QA9A 4Q3CA 3N58A 4N54A 3WGZA 4YCAA 3GNSA 4NU6A 2VUUA 1X14A 4URFA 1WWKA 4IXWA 1U4SA 1V3TA 2ILTA 2RHCA 1T1RA 1IZ0A 4J2OA 4P8RA 4CM8B 3GGOA 1D7OA 5JDIC 3SVTA 7ADHA 4FOSA 3OP4A 5IDWA 1U7TA 4CMAA 1LRLA 4BO7A 1T2DA 2IRWA 4S3MA 5G4KA 3TNLA 3SC6A 3U49A 1XDWA 1O6ZA 2XXJA 2DBQA 1KEUA 1WDMA 1U7HA 2NVUA 2PZLA 3WLEA 2OL4A 4EJ6A 5FEUA 2VQ3A 4ZQHA 3KLPX 1LUAA 4FB5A 3BYZA 5DCWA 2YDYA 2AMFA 1XU9A 3V1TC 4B7XA 1JAXA 4UULA 1QR6A 1LX6A 4IZHA 1CQJA 5B4TA 1A7KA 1UAYA 5G2OA 4P4GA 3OM9A 1KVRA 3I5MA 4CLDA 3W4IA 1NR7A 1J4AA 3C1OA 2YV1A 3U4CA 3HWRA 2FPGA 5B12A 3JQ9A 1Y5MA 2BH9A 3A4VA 1U5AA 1PQUA 4ND3A 1LDGA 4IJKA 4F6LA 3VZQA 4L4RA 2XAAA 4K9DA 4XB2A 3DZIA 5G0VA 1I10A 2OHXA 3B1JA 1JLLA 1MC5A 3FNFA 4PG6A 3UCXA 3PWKA 3HUDA 4WLUA 2YV3A 3GNQA 2WMDA 2XPCA 3EHEA 4IIUA 4E13A 2CF6A 3SEFA 4MVJE 2CDCA 3TFQA 4OYRA 2YZ7A 5H83A 2VYVD 1YWGO 3T7EA 4K1LA 5A5FA 5L7WA 2Q2VA 1HL3A 3EC7A 3JD1A 3H6KA 5GZ3A 3VPFA 1E77A 5JAQA 3GMDA 1LNQA 3JQBA 4JBGA 2X86A 4QUKA 1SOWA 4UUPA 1Q0QA 2ZTUA 3QIVA 1Y5RA 3AI1A 1GYRA 3SJ7A 3C24A 5KTKA
chains in the Genus database with same CATH superfamily
1CPYA 3L1VA 4JT9A 5AKYA 4YRMA 3AIIA 4I4CA 3AESB 3KSAC 3IJPA 4QARA 3NRCA 3CR3C 5K0SA 1E2DA 1U0JA 1I7SB 2FA9A 1SC4A 2RJOA 4PQFA 4OGGA 1P9RA 5JXJA 3MTIA 4LBYA 1THMA 3RRNA 1JKJA 3ZD7A 3PGLA 3CT6A 4OY3A 3BGSA 1NY5A 3KLBA 5IBPA 2C2KA 3LFHA 3TL6A 3FOZA 3FOEC 1OH5A 2NMVA 2R7LA 1EEXB 4MDFA 1M6VA 4PSUA 4RHYA 4QOGA 4O5AA 2WVAA 5KOJB 2WAYA 1B0ZA 3PPIA 3IH5A 2CXHA 3MTJA 3UKDA 4GOXA 4JBLA 1HBJA 4LYYA 4H7EA 4RMJA 1GZDA 1TCBA 4CM9A 1UC9A 3D6AA 2FZKA 3LTNC 1EVJA 2AK2A 5EP3A 2XV1A 1JIKA 4NQRA 4RPGA 1O6BA 3BJEA 4PYOA 4N48A 2CVOA 2HWUA 1KGSA 1F6BA 1XTUA 2FSVC 1KFBB 1PYGA 1ANKA 4QICA 2VDOB 5EESA 3TTTA 4EWLA 3REGA 4TYWA 4R41A 5NLLA 3LQKA 2HQBA 1R0KA 5A4IS 3W5CA 4N1AA 3R1IA 3C3YA 4W9NA 3MD0A 1ZJJA 5GMOA 4W5RA 3U7QB 3E22B 3CLUD 1OXSC 3AI3A 2JJMA 2IYEA 2J5KA 4KB5A 3WNQA 4IO1A 1TZCA 4YO7A 3W2TA 1G59A 1IY9A 4F8EA 3WL8A 2NYAA 4D97A 3CLSD 2CUNA 2WFLB 4WI1A 2J87A 4PV7A 1TT5B 1HNZB 1XD8A 5TSDA 2XIQA 4PXSA 1F5NA 1VPTA 3SR3A 4G0UA 5EQTA 1E66A 3REQA 3IAM1 5JS8A 3Q8WA 4O4IA 4FJ0A 4FZJA 4BQEA 5I48A 3LQ1A 4LY0A 1I3OA 2ZSJA 2GO7A 4BB6A 3BTOA 4AB1A 3NDPA 4LMBA 5IJ9B 4JXXA 1FU7A 1W44A 1XEXB 4B3CA 1QHNA 5A62A 1HA3A 2O8FB 2QXYA 5C3UA 1Y7HA 4IICA 4AJ2A 1TAUA 4TKZA 3PP8A 3ICPA 1JG4A 2H9IA 2VOEA 3HB4X 4LIPD 5CPBA 4C3VA 2R79A 1EQAA 2R6CA 4RTLA 1YE8A 4N5MA 4YI3A 1BVYF 3S6JA 1FDWA 1R74A 4A91A 4ZOAA 3OJLA 3IV6A 1DCFA 2E5LB 2Q3CA 1H66A 3M5WA 3OZXA 3UMFA 3EGVA 1ESNA 4KVFA 2WAMA 5KKAA 2F3SA 1K89A 1O03A 3TLGA 5LQSA 1CF2O 2R62A 1NUUA 4CLOB 4K3VA 4YAUA 2B25A 4C88A 4FS3A 1EUCA 2I9PA 1DTEA 3BRWD 3H18A 4JSYA 1BMQA 2Q49A 3OLXA 4E12A 1JL3A 5KQMA 5KSWB 4YCNA 1P60A 1Z62A 3SN6A 4C7OB 4OYHA 1W4LA 2ZWPA 1TO6A 3OPVA 4WVLA 1NFQA 5EZ5A 3OIFA 4BO3A 1MH9A 2Z3ZA 4PN7A 4ZMSA 3GFVA 1F6DA 2BGTA 2AOWA 3V2HA 2Q5CA 5T3YA 5E8RA 3JVDA 2W0SA 3BXXA 2OTCA 4BLRA 4LZLA 5B6PA 4EI8A 5IF3A 1ADBA 1OT5A 1XLVA 4IEFB 5BWOA 2WZDA 1ZU4A 5AVRA 1L9KA 4WXEA 2LDXA 3U9SA 4GGOA 5SYAA 2MIIA 4QUIA 1ADFA 3DOEA 3EPPA 1M8KA 4ZVLA 4B82A 5ICMA 2J0UB 2XHZA 1V1RA 2H4WA 3MMNA 5G3YA 3DHYA 4DLLA 3UPUA 1N5RA 1Z15A 1B7GO 1A2QA 4CFZA 2VWPA 2C1ZA 2P9CA 3HN7A 5DVZA 2XYHA 5IYZA 4Y1RA 1H6AA 3S8MA 3DV0B 3HDHA 2TS1A 2ONCA 3FBWA 1M2NA 4RLSA 5DV9A 5F4ZA 3K8YA 2P35A 3T1TA 1JE1A 4Z0TA 4Y9SA 2QUIA 3VDQA 1Z5WA 3KKQA 3QY9A 1Z8FA 3EEOA 2GJ9A 2XWJI 2V65A 4AS1A 4RQTA 3M34A 4RKRA 2ZU0C 3BCSA 3HYRA 5LQNA 2JKVA 2Q9AA 1PO7A 4HXYA 4MQFB 1J56A 3F49S 4KIUA 3QLVC 4FKMA 5C35A 4MKIA 2NZWA 2Z56A 3EBPA 1CY6A 2HRZA 5CITA 1DRUA 2FSHA 4FGUA 2WHYA 1I3NA 3EXHC 3L4BC 4QATA 2WWFA 1B8VA 2A0FA 3VNAA 3G5MA 2P2DA 3JX9A 1RZRD 4IV0A 1XMJA 2OXRA 3ETEA 2GKGA 3ELWA 2Z04A 4QYIB 3WB2A 4IHJF 3V4ZA 2DHDA 1VM6A 3DAFA 1UP4A 1YUNA 2CDRA 4GEKA 4IWXA 2G8NA 3WGNA 5FX2A 3JQPA 5FHQA 4QJ5A 2QRQA 1PJ3A 4QNRA 2FY8A 3EGCA 4XGRA 4BKUA 3BMCB 4BMSA 4DLTA 1AKVA 5J43A 2C7OA 4P31A 1J22A 1NNUA 3IPRA 2JGAA 2QN8A 2EHJA 4JGBA 3HDJA 3QKRA 5C8YA 1O94A 4PLWA 3DULA 1XQXA 2CXXA 3A3PA 2R4QA 1JEJA 4V03A 1ULTA 1S3GA 4X85A 4IMPA 2C5LA 4QE3A 4DUGD 1SVSA 1E3SA 3AF0A 3FLEA 1GZ6A 2H63A 3L8CA 3KSZO 2PUWA 2NN3C 4NBNA 3T5AA 1UBMS 3O7MA 3OPYA 4C1BA 1EB9A 3AHEA 3HWX1 3JQ8A 2G1UA 4QLOA 4WJKB 2LP4Y 3KHKA 5CD1A 3A6GA 1D1TA 2J48A 4X6YA 3TX2A 4AY6A 3HEBA 3CSUA 2AKEA 3OF2A 3LPDA 3KTAA 2XB2A 3B6MA 1QVVA 1TYDE 4O6VA 1ZH8A 1U0GA 4ALLA 4DWOA 1L8AA 3FYTA 3ID6C 1RYYA 1Q11A 3ITKA 5CT8A 1QU3A 2JCXA 3T3IA 4XWOA 1PDWA 2W2VA 2NXCA 4GPEA 2C00A 2WU4A 4XQGA 2QLNA 4NOMA 3GVPA 5AUQA 2IUYA 1Z08A 4F56A 2ZCJA 2NAFA 1Z63A 1P2VA 1ODTC 1ZIPA 2B2CA 2I4IA 3OWOA 4YRFA 4ANFA 4KE8A 3VKVA 1MX9A 4X3PA 4DY4A 1Z5NA 3JZAA 4LFBB 4CTMA 2RDMA 4JYZA 1N5IA 1WXQA 5ALNA 3THXA 3EJ6A 5JZVA 3M4NA 6ABPA 4HKTA 5I9BA 2P2GA 5HUQA 1FSSA 2GVNA 2VHYA 1IBRA 2ETXA 3PKIA 4XA8A 1JR2A 4AG5A 4NYMQ 2KLHA 4PZZA 1SNYA 4C3ZA 2AMVA 2KS6A 2ZUCA 1KI4A 2QJTA 3P19A 5K3DA 5KU1A 4TYYA 1PQPA 1N4AA 2R87A 4NR0A 3WGLA 2V45A 5TNXA 1UBRS 1PYOA 3GIDA 3JATA 4U9UA 4ZQCB 4YI5A 5BW5A 2PD6A 3DBRB 5FOUA 4FYMA 3OKFA 4GW3A 2BMAA 2ADFA 2R4UA 4PC3A 2JIMA 5KQSA 1BYIA 2JB9A 4J91A 1EIWA 4G4GA 2CFRA 2FSSA 1QJ4A 4PCVA 2ZI3A 3FRIA 4KSYA 3VR4A 1LEHA 2VDWA 2Z2KA 3C8UA 4OUKX 3KX2A 1XI2A 3EZFA 1IHPA 4RSMA 5CH3A 5FTNA 3ABOB 3SNHA 2JW5A 1G8JA 5DGHA 5EWMB 1FPMA 1KPIA 2QEQA 5IH3A 5EY5B 3QBJA 4C89A 2EZ9A 1GOTA 2IKQA 2NW6A 3HN2A 3DDZX 4LJLA 4DBLE 2PYDA 1AKNA 3VMMA 3D3WA 2FE1A 2FJPA 4H6PA 1ELOA 1C7JA 1JHYA 2W48A 2JC3A 1JBQA 3DQZA 2PVPA 3NOQA 5HF8A 1TPZA 1BROA 3NBAA 4MROA 5GJVC 2GK4A 1P0CA 4GE3A 5THXA 3NYWA 2F9LA 2C0CA 1L5MA 1T15A 4CKCB 2ZT5A 2AH5A 1E58A 4WD3A 3E84A 3SZRA 4IVPA 2RH8A 4P3OA 4GI2A 2FDCA 2R6HA 4UPDA 3BZUA 1X7XB 3FY4A 5TPWA 1DELA 4FW9A 4L5AA 5CDYA 1R8YA 2H7XA 2YASA 3CMCO 4RMNA 3MVEA 5CCDA 2H4JA 1MIOB 2QN7A 1CRLA 5MF6A 1ZAKA 3OM0A 3PDHA 4LW8A 4N9WA 1K7SN 1WF6A 3LP6A 4OXXA 3AIMA 4CM4B 2F90A 3N8IA 3ROZA 4KO3S 3NUGA 4DG8A 1D8TA 4Y2TA 2XT0A 3R2JA 2NUTB 2PGJA 4YRKA 5T4FA 3ABIA 1ECFA 1USKA 2GSWA 4WFIA 3JD4A 4CEIB 2WD7B 2NU8B 2YJNA 1ACJA 4Q9HA 4JQCA 3KUCA 3GPDG 1FB5A 1JU9A 1H23A 4MUKA 1X15A 3IRUA 3K4QA 2Z8ZA 1JWLA 1BHQ1 5C32A 3VU8A 1OH7A 2BT4A 3ENZA 2I78A 2CVPA 2J6IA 2ZEJA 4WECA 2JFFA 1KRHA 2YH2A 2ZJAA 3M81A 4WH0A 4MAMA 3VZDA 5C4IA 4FCVA 2JASA 4HWPA 1E9CA 3PNKA 3N39C 1E1NA 1WSBA 1YTLA 1C1XB 4CCWA 1PFVA 2B61A 1OKKA 1U7PA 3NKLA 3S68A 1H2RS 2A5FA 4J7CA 1X0XA 3BTUA 4NF2A 3DHWC 4RVDA 4TTPA 1UBKS 2OV3A 5EZYF 3ZWPA 5ADHA 1U98A 4QQRA 2AOXA 2Z4TA 3LQ4A 4Q9NA 3RSGA 3PJFA 3F96A 1AS2A 2ANBA 1CRWG 5H8WA 1HV8A 4U6QA 1AB6A 2QXUA 1Q22A 3RSCA 1UINA 3VBEA 2QMOA 4HNHA 5JZOA 3BFXA 2ZTLA 1L4EA 4LISA 4OH7A 5LKRA 2W42A 2IHJA 4P3XA 5CAEB 2YXEA 1SXPA 1AXRA 1AOXA 1A4XA 4NMHA 2W5UA 3U19A 2NXWA 4JP3A 1E3TA 1HKUA 1V1MB 3R76A 4DTIA 3SXUB 2WSLA 1ZRMA 4JB2A 1FSZA 2YVAA 3N0TA 1IEXA 4M1WA 2Z2YA 4LHXA 4OATA 3KT8A 4L6CA 4WY2A 4XSVA 4DV4B 4E6EA 2QUAA 3NRBA 1JIJA 4UHBA 5C5CA 4DA7A 1UPTA 1O97D 2HJSA 3NBKA 2Z4SA 1AUXA 4JYCA 1M0EA 1JGTA 3EH2A 5KNCH 5K0TA 2HMUA 4GYYA 3V42A 4OGKA 2RHOA 4DSTA 1YKGA 5A0TA 2VT2A 1XZMA 5ER6A 3LU1A 3ZUGA 4AIIA 1N9KA 1M67A 2BEKA 5AVOA 3U4MA 3TLZA 2KWIA 1GXSB 1D8AA 2VJOA 5A9TA 3B48A 4WKPA 3WKBA 2G36A 2I6QA 3GVHA 5EGNA 4BO1A 3U7JA 4EVQA 1K98A 5DM0A 4ZHSA 4HEA6 5FO1A 5TGDA 4BS9A 4TLLB 4HQ0A 4EHDA 4ND7A 1MF7A 1THGA 4M4SA 4WDRA 1L3IA 5A9RA 1E9BA 4XQEA 3FJ1A 1JW9B 2J9GA 4OQMA 4BMYA 4IV8A 2BUCA 1X3SA 4YMGA 2DKNA 4E5NA 3DGEC 4ZOLF 3EQ8A 3LYLA 2DXIA 2I34A 1GYQA 2HCBA 2FSGA 3B8HA 3DO5A 3BD8A 3G02A 1HLDA 5EJGA 1Z75A 1U8EA 3CS3A 2WK1A 4R9RA 4RJ2A 2C98A 1V43A 1JV2B 3DL7A 4ETWA 3U7GA 3FNGA 3A1DA 3H8JA 4RMGA 1E3LA 2JLSA 2PQ0A 3M6UA 2ONJA 1DJOA 4BAGA 5L3QB 4YROA 1D5WA 2NIPA 5GQSA 4KYIB 5EJ8A 1GJRA 2QJWA 1W1IA 1V4NA 4ES6A 2ZRQA 3VR1A 3AZQA 4PHTA 1ZIOA 1VDMA 2Q6KA 3DV2A 2EFDB 1ES9A 2Y1FA 1QO7A 3HPRA 3JQQA 1U0OC 3OX1A 3LLSA 1ZISA 3P0RA 2BKVA 1KJNA 3PVSA 3ZC3A 5HOEA 4CQJA 2VNKA 1AKRA 2GPAA 2B20A 2AV6A 1YHZA 4HDRB 4KKVA 2HJVA 5FPTA 3WBJA 3ITNA 1XIVA 4KKXB 3T06B 2DCMA 4C6SA 4PN3A 4X54A 1EB8A 5KAPA 3PQFA 5HZHA 3U7FB 3NDRA 1CUYA 2H48A 5AI0A 3HY3A 3TLEA 3W7BA 4PQYA 5LBTA 5CLQA 1LU9A 3BGVA 1SEPA 2DFDA 3RC9A 1JFFB 1G2IA 2P75A 3NTVA 4Z4GA 1RR6A 4KR7A 1UBSB 4A73A 4YCJA 4FFBB 4G5XA 3I73A 2RCNA 4S05A 1E1RD 3NUQA 4JLNA 3I58A 4GRDA 2D2FA 4GQBA 2MINA 4HRYA 3A8TA 3D02A 1VHTA 4FDAA 2V74B 5ALWA 3KL2A 1RKQA 4X8OA 1YS1X 2PSHA 4ZODA 2NPIA 3A25A 1UZMA 3O91A 4L51A 1VJTA 1SKQA 4CG2A 2W6IA 2AI3A 1G21E 2B8NA 1NPTO 4H3HB 1BD3A 1ZGGA 4CNQA 5I4BA 2I76A 5JC8A 2XDAA 1JA0A 2O5RA 4M6WA 1U5BB 2RKOA 2EJCA 3GJSA 2CDAA 4LNHA 3F67A 3UAOA 2H2WA 2W6OA 5FUXA 3I37X 4HAUA 1TU3A 3KUDA 4FSDA 3IP1A 3IT0A 2WD8A 3VI4B 1R8QA 1B4DA 3SIPA 3IQWA 1T5LA 3KOMA 3BIOA 3HBNA 4DYVA 3AG6A 4EKNB 4TV9F 5FNZA 3TZEA 4H4EA 4PNZA 4DMLA 4E07A 1A9SA 1A95A 2C2OA 1N3BA 2HD4A 3MOIA 1WD5A 2IEZA 3BHIA 3GH3A 3QPBA 2HCJB 4GLLA 4RPHA 2AW3A 4G9BA 2O52A 2BEWB 3SZOA 1CY7A 4KWIA 3PB3A 3JTMA 3GFSA 1AQLA 1N8SA 3N2LA 4X5OA 3VPGA 5IH7A 4UQLA 1EXVA 1N1EA 5TQ2A 4RZIA 2PWZA 3E27A 3AEQB 3DH0A 5HKLA 2I9KA 4Q3LA 2GEFA 1IPEA 1I51A 1LSJA 1DJQA 1PZXA 2QLBA 4MS4B 2J33A 5BWBA 1W4CA 4HQLA 1MH1A 3NHJA 3R5JA 4AXXA 5HZMA 2Q50A 1ND6A 3PENA 3RVJA 1BD4A 4FNAA 1K27A 4MP6A 4FT2A 3FKQA 3PCRB 5GGXA 2R66A 1NVMB 3RVQA 1WE2A 4LRTB 1ZNWA 4IHAA 4WZAA 3GX1A 2C04A 5KWJA 1YK0A 4PFKA 5IAEA 3W2HA 5JH7A 1J5EB 1QP4A 3VM6A 1XKXA 1PFYA 2CCGA 5B1DA 1NBHA 2PNJA 4X6UA 3RVMA 3EY9A 4J94A 1E5DA 2QU7A 3DCIA 3NC0C 2NTYC 3OE5A 3ZV6A 1U7UA 5EPOA 3LRTA 1WW2A 2H9AA 3P9NA 1WOMA 2WIGA 4HMOA 2OOKA 3VJKA 3A6PC 1CE8A 1ZD5A 2FZCA 3QOWA 2XYGA 5DYIA 1WW3A 1POWA 1CQIB 4HAVA 1MC8A 1LZKA 2WJ3A 3GEPA 3SX4A 4D8YA 4HB3A 4LOHA 1DZIA 2H5JA 2WKRA 1UCFA 3IP6A 3PGXA 4PYMA 3BHJA 4Q37A 4TL6A 4KQFA 4M1KA 4ZI3A 2P2YA 5CYPA 3T4UA 2FWPA 2GVZC 2JGNA 3H9GA 4IYRA 1MG0A 1R6BX 3WL7A 3WL5A 1LVUA 3AXSA 2AQKA 1KBZA 2JIDA 1MXFA 4KUEA 1G5QA 4O33A 3DVAA 4CQMB 5C51B 1U0BB 4C7XA 1T4CB 2XA2A 3IB3A 4E6PA 3TGLA 2C5EA 4G26A 4X8MA 2NU9B 2W2KA 1T5BA 3Q5EA 3GOHA 5KWIA 1EXDA 4JU8A 1FP4B 1SIUA 1XTIA 4KQMA 2LBPA 1ODIA 3H5TA 3HBJA 3IURA 1KYYA 4GE0A 3UJCA 3IVAA 1J6UA 3MIIA 1G21B 4X3OA 5FOWA 3ZU3A 3PUZA 4MW5A 3ZWXA 3ZJTA 3N5KA 1T5HX 2FWRA 2I80A 2QN9A 3NFRA 1ECCA 2H5LA 3LCRA 3T4PA 2WSYB 3FF4A 3JQFC 1L0BA 1SOMA 2OORA 3C4JA 3UXHA 2FI1A 3V48A 4RIIA 4NABA 5CMLA 1EKXA 4MVJP 3GA0A 3LVQE 4MR8B 1YU6A 2HMSA 1F2TA 2HNAA 2J3HA 1AK9A 2FQXA 5KCMA 4F5EA 1NHGA 3AILA 3UJ8A 3ORHA 5HW0A 1QZZA 1X7DA 3H1EA 3HDYA 3IBSA 3PQ7A 1QGZA 3AM5A 1KYWA 1YQWA 1RBYA 2XTJA 4DCTA 1TCAA 4GC9A 1R5OA 2VHTA 4JU9A 5IM4F 4YP1A 3ZLUA 1XU7A 4GXTA 3G8BA 4D4HA 5DXJA 3W4JA 2H9YA 3LWZA 4R7GA 5B2EA 1PRYA 2DUMA 2PH5A 3ZXSA 5K9ZA 4BNUA 1ISPA 3BCHA 3JASA 4EA7A 1MG5A 2DUNA 2PKWA 3DBHA 2UVPA 2CN1A 2E18A 2R86A 1KE2A 1P5JA 1Y4UA 2VP5A 4I3FA 4IFEA 2QX8A 1K63A 4UNPA 3IE1A 2JIPA 3RF6A 2Y4OA 1FNSA 3HB1A 2QOEA 2GD1O 3KD2A 3OJCA 2A33A 1YCHA 2B82A 5CK5A 1EMDA 4KI7A 5B6IA 5C18A 3H5NA 4LJSA 3TCXB 4ZEWA 4EB6A 5AHKA 3ZGNA 2ZZKA 3UWMA 2WWVD 3RVRA 1D6SA 3SHTA 1C9MA 3TG8A 3GGGA 4Y9UA 1HGXA 3CKLA 5EWLA 5LXTB 4QAQA 2F1OA 1EXWA 2IYZA 3DFUA 3CZRA 1F12A 2OFOA 2O6LA 4G2NA 4J75A 4MRAA 3M33A 5EKDA 4ZAGA 4RO0A 5K0NA 3W1VA 2IDMA 4A0GA 4WX2B 2IYXA 1J06A 3NEYA 4KIJA 2FW9A 4I6GA 4NZZA 4BQFA 2E4UA 1Y37A 1O8BA 4EG7A 4BNMA 2Y1GA 1JEYB 1RC1A 3GCGA 4YPVA 4H3SA 4IHQA 4F1WA 1Z07A 3MTEA 2HF9A 5TVGA 4B44A 1G38A 3CCBA 1HQKA 2JGKA 2VLBA 4XWTA 3ND5A 1KDTA 4WUTA 3D81A 4IWYA 5AICA 3FPLA 4TQUS 4PWYA 2JNWA 4RF5A 4R8SA 4GQIA 1IN1A 2FLWA 4JI0B 1NQ5A 3A1NA 1UODA 5K2MA 5A3JA 4WLNA 2GAJA 3VNRA 3AF6A 4P86A 1LLUA 4KQ1A 5IJ0B 3WL4A 3H2IA 1XF9A 5IZCC 1R3UA 1ZOSA 4O4IB 1DAMA 3R4VA 3MWYW 1P1HA 1XCOA 2C83A 2D2IA 4BX8A 4GKVA 3S70A 1IHXA 2BMDA 4PU0A 3RFUA 2WHXA 2DERA 5JLAA 1BS9A 1OOEA 3PUJA 3IV9A 1QKJA 2WTAA 3QVUA 3Q3HA 4A3SA 2XEDA 5DO9A 3D3JA 4S04A 3L92A 3HKCB 3UKOA 3W3ZB 3P9ZA 5ADUS 1RZ3A 1QHEA 1XCJA 3AUKA 5IK2D 2DBVO 4NFSA 1WJGA 4RL6A 1MVOA 1V9CA 5LD2C 3BKXA 3IDQA 2A30A 1MKYA 2IYWA 1BA2A 2QG6A 5LP1A 1ZH2A 4WQMA 5CHEA 4EQ6B 4XVCA 3QUAA 4LZJA 4O2BA 1FMFA 1Z2EA 1Z8NA 3AB3A 3DAYA 3TNFA 4DG9A 4UD6A 2EYUA 4K8RB 2K4MA 4RTJA 3R77A 1KU0A 4NAVA 3JTEA 4Q4HA 5BSTA 2XCUA 5AW9A 2HNBA 1RXIA 1Z34A 3KPWA 4M83A 4LY9A 1F2VA 4OHFA 3ZWNA 4DQKA 4REQA 2Q4OA 1P1IA 4PRLA 1I1HA 2PT9A 3RRYA 3HO1A 5TV2A 1T2VA 1EE2A 4WGFA 4GL2A 3QWBA 4GI7A 2OCBA 1GEGA 1ZUNA 3L1UA 4YH1A 5GY7A 1EHYA 2W11A 4EATA 4DCSA 2QTLA 2QW8A 5IUKC 2ONKA 1P7VA 2P4HX 4MTCA 1KI6A 2QR5A 5IVDA 3UAYA 2D5LA 1RJGA 1WUHS 1NJ1A 3QVXA 4LC1A 1XZ8A 4C06A 4BFSA 2YFKA 2PWAA 1AN0A 3SQWA 3MYRA 1X8LA 2WE8A 3JRWA 3JWIA 1E2IA 1GZ7A 2GJ4A 4C7KA 4FM9A 1UT6A 4O2RA 5AK0A 1Y81A 1E1CA 2GEUA 4JQZA 1NNSA 4D6XA 1WUKS 3AJRA 3N3BC 1JVSA 1GTVA 4CUKA 3VKWA 4GBGA 5AW8A 1G5FA 1WV0A 1XNHA 3QM1A 1UZUA 2GHRA 4H4DA 4PSKA 2OILA 1FFYA 3Q7SA 4N41A 2ZWVA 1VTKA 3KKKA 4PLCA 4WMLA 3TMYA 4ZAYA 3CVVA 1USIA 3DS8A 2XE8A 4J49A 3VRHA 4JS0A 3L8YA 2IYYA 4I55B 3U3KA 3LUFA 1E7SA 2M6KA 5DZSA 4EHFA 3D6VA 5DHQA 1AKEA 3K9NA 2FSIA 1VG8A 4MP3A 4RD4A 5T41A 1SCUB 5KNCA 5ERGB 3LPLA 3WB9A 4LDPA 1FLAA 2I99A 2XVXA 3KKEA 4QUHA 4YACA 4UMEA 1W4ZA 2K7ZA 5KJ6A 2QSJA 1C3OB 4CT0A 1T2AA 4RY9A 3ZGZA 4MWEA 3LQQA 5IM5A 3RUPA 4C0LA 1LLCA 2O9JA 2SECE 3MCVA 4GM0A 2PH7A 5EN4A 4DARA 5JMOA 3DE7X 2MR5A 2W8ZA 1FLDA 1F0PA 3QELA 3STVA 1KEWA 4AG6A 4EMTA 4UAJA 4BZWA 1WDWB 3TW4A 2JS7A 3IXQA 1OV6A 5FBRB 3ZZTA 2OM2A 1PFQA 2ZXEA 3NBXX 5DM4A 1XRSB 2C2HA 1PNRA 621PA 3W2EA 1RYBA 4FFOA 1BXZA 1TD1A 1DQZA 3P96A 2P1DA 1WMDA 3AUXA 2VUSA 3C48A 2P30A 5F5XA 1T2FA 4CF7A 4MPJA 1YO6A 4U2DA 3A7DA 3ASYA 1NBAA 3VYWA 3WL3A 2IYQA 3W3AD 1P4SA 3MW8A 3PV0A 1NVEA 2ZGVA 1ZVJA 3JVUA 1A72A 2GZAA 3ETDA 4JB8A 4LYDA 2D8MA 2AZTA 4E22A 1IWPB 2A9VA 1YGYA 2YNMC 4ZZ2A 3R7SA 2IOFA 2QM8A 1RFGE 4CM7A 2NTVA 2CLKB 1YR9A 1WBDA 2UXBB 3DEZA 3OVMA 4C76A 3AI2A 3DE1X 4MVCA 2CC2A 4JLOA 3WR5A 5A05A 4D82A 4NY1A 1CR1A 2IC5A 4L3OA 1CS0A 1T1IA 2Q4EA 3PSAA 1LFDB 4O4HF 2NSDA 2WA1A 5DXAA 1IHUA 3FJOA 2X4GA 4JQOA 2GJAA 2W6JA 3CF4A 2AEEA 2QRHA 4ZI7A 5ESRA 1CUDA 1TECE 1VL2A 1EGVB 2IY9A 4ZDIA 2W71A 3PPWA 1WP9A 3SBOA 7MDHA 4PHFA 8MHTA 3UC9A 1KORA 3H75A 3FGZA 3EXG1 4CI9A 2P0YA 3AC0A 1P1KA 3LCVB 2VJYA 4GMHA 2QT9A 1DOZA 1WUJS 3E3MA 2IK8A 3FYCA 4QXQA 3EG9A 3UICA 1NVBA 3BIJA 1HZZA 4HYQA 2VF8A 3AI7A 3CLTD 2VYCA 4LDAA 3FTCA 4RXUA 2X2FA 3EUEA 3N3AC 3RC7A 3H1AA 4Q0MA 1KK0A 2IA5A 2FMHA 3BHMA 1QCCA 3GPBA 3PXCX 1JDVA 3JPWA 4JJ6A 4N6OA 3RV3A 1ZM3A 5JE8A 2JD2A 2OCAA 1H4SA 3PIRA 1AGNA 1SCJA 2ASVA 1Y7IA 3ZVRA 4Q9LA 1G9SA 3U17A 2CFIA 4MLPA 4DJFC 4KN6A 4OBXA 3VNBA 4DCNA 1W36D 4TTTS 3AU9A 4KO2S 4CL3A 4YA6A 2E1PA 4TYQA 1EDBA 1TZBA 4CLRA 3QG1A 3NANA 3PDJA 3KTOA 3MGGA 3RWBA 4JZYA 3VZPA 1V35A 4HN9A 2B1GA 4Z4QA 4A6EA 4Q5IA 1OLOA 3CVXA 3WKAA 4M9SA 4O02B 1EFVA 1J0CA 1HTWA 1Q3TA 2FPPA 1XMIA 3I76A 2BGJA 3NCTA 4ARZB 2HEIA 3H0CA 4MXDA 1RWWA 1A2KC 2UUCB 2R5NA 3NT5A 3EZ7A 1EUDB 5DP2A 1YR1A 2ZIVB 4K9OA 4TMYA 5A7GA 2Q0SA 1KI3A 1QLWA 1UJCA 4C6TA 4N7RA 2FH5B 1XXHA 1BIFA 2HU5A 4JH0A 5YASA 1VBMA 4LX0A 3BX1A 3PGJA 3VR5D 3WQHA 2YXNA 4XAQA 4B6GA 2RGNC 5DM1A 3G8AA 4O8CA 2HT1A 1H4TA 1HFJA 4FB4A 1QPGA 3OQPA 4Q00A 3KUXA 1VSBA 1CLUA 2VK2A 5E6SB 3TM5A 1JZTA 1M8FA 2VSOA 4CMEA 3KVNA 1CVRA 2GLUA 3K0AB 4CCSA 2QZ9A 5KNLA 3G0GA 1GPAA 1QDLB 4F60A 5A3SA 1LGYA 4AJ9A 2F1RA 1NMSA 2PO7A 2ZT7A 4MI9A 2CBGA 1W8DA 4ACAA 1TAHA 1XNGA 4OV6B 4P82A 4BKRA 1UXHA 2ZR0A 2F43A 2MYNA 3AERA 3LGSA 5K2OA 3HHPA 5D2CA 2XXAB 2DWOA 3CH4B 4WOBA 1EVZA 3CF0A 1PEAA 4PPQA 3ZDYB 4IHJB 1IUOA 1CY0A 1EJ2A 1SWWA 4OU4A 1SUIA 3HYLA 3V97A 1D2CA 4GOOD 3II6X 1C3LA 4QQKA 1CDOA 2VL7A 3LM8A 5DN9A 1UWLA 4OXNA 2L42A 3SZUA 3WC4A 3R6TA 2C82A 1R16A 5ICFA 4G07A 3WBKA 2FMIA 2CHQA 4G0VA 4U3JA 1PR9A 2QYHA 2ASEA 4GKBA 4KQ6A 3T7JA 4I3HA 3K0FA 5COBA 2YIVX 1EFLA 2EW1A 2Z8XA 3LOQA 3A6KA 2OV6A 3CCCA 3KKPA 2Y0BA 1VJ0A 4WCFC 2NU6A 4TVKA 3PDUA 3KXKA 1DCTA 1P3Y1 5LOVB 1MC4A 2ZS9A 4GVPA 4XD7D 2A92A 5K0JA 3J7AC 5BUQA 1TE2A 1N92A 3IA2A 3OE1A 3KM0A 4NV3A 1GFSA 3AQ4A 3B7PA 4LNAA 3EGOA 3BWXA 1DOAA 3BFJA 3OTWA 3EVEA 3ZU6A 3AJAA 3QEAZ 3C5WP 4Q7EA 1JHZA 3GHYA 3OIWA 3KKZA 4PLYA 2ZRPA 4QEDA 4WBNF 3QE9Y 1HSZA 4RDIA 4Z49A 1ISIA 1I32A 1IN5A 4IIHA 4G97A 2WOJA 1WTAA 1UBTS 1D04A 3AU8A 3OEHA 3T15A 1S2GA 3VC3A 2HRCA 3HJCA 5IDXA 2FFBA 1RMYA 1MN6A 2IZ1A 2REOA 1W5TA 4BNJA 5EJMA 3A2NA 3DEFA 1KNXA 3A7EA 1R2QA 4ITVA 3Q8MA 2CFCA 2QMUA 3CXUA 3I30X 1ZPDA 5DHPA 2GCOA 3C3XA 4QG7A 4D46A 1ZICA 2BL4A 4TSFD 2D59A 3RU7A 4UCFA 4KITB 1YD7A 5LSAA 4A15A 2ZTSA 1Q7BA 2ZUVA 2IFTA 3RNOA 1FSPA 2UZAA 4Q39A 4CF3A 2PU5A 2Z5FA 3PWTA 2WU0A 3AV3A 3L06A 4I4IA 3IIKA 3IMKA 4KJXA 4CR6A 1NJ5A 1GNLA 4BL5A 1M0TA 1YRYE 2A0KA 4ZCPA 3ANNA 3D1VA 4DQ0A 2HJHA 3ND9A 4KFTA 5MDHA 3FR7A 2LCFA 1U9JA 3I9OA 1NI5A 3IAS6 1R4NA 3Q9SA 1OQAA 2FOLA 1I2ZA 2VSFA 3I2YX 4FMCF 1JMKC 1KERA 2XH8A 4H4CA 4W1RA 4YDHB 4JJ8A 4EDFA 3OQ6A 2H8KA 4XFKA 2Z5GA 4ETIA 1N5KA 3MPOA 1Y9EA 2AFIA 4RJKA 4FQ8A 3ND8A 4AMZA 1BFKA 4RPJA 3ZWBA 4OCZA 5AESA 5T8KC 3BD9A 4ZALA 1T8UA 2ZI7A 3WNZA 5K6AC 4N3NA 2BDEA 5GJWC 4CL8A 2P40A 4Q24A 4WXYB 3BE5A 4AMYA 1K3TA 4NP6A 3HP7A 1V7ZA 1TLTA 4ZJUA 4LHSA 8ATCA 3E70C 1C0EA 1RAGA 4DV7B 4GKKB 2EL9A 4XIIA 3BJZA 4DW8A 4R1TA 1F8YA 3FWZA 1GLVA 2BGMA 1F51E 4RVOA 2A58A 2HIHA 1OTHA 4Y2HA 2CWWA 3AVPA 3AOGA 2CCJA 4N9QA 5AJXA 2AFHA 1OLXA 3Q2IA 4QPPA 2BI8A 3AG5A 1TQDA 4YFYA 2C4TA 2A9PA 1PLKA 3DVSX 1XZAA 3KVYA 1ISGA 1SQFA 2PQ6A 4RJJA 1ZY2A 1MA0A 4KLCA 1RWXA 5SZJA 3HCOA 3V4SA 3RS0A 4YJGA 2YDXA 4R4JA 2X1HA 1U1CA 4BNVA 1NJGA 4QGAA 1BXGB 3GT3A 3F7MA 3HBFA 3HKDA 3PX2A 3LUJA 4QAJA 3VZCA 1YF3A 4CGYA 4R2WA 3I1IA 3THWB 3V7UA 2B37A 1OX4A 4MQEB 1GFIA 1W4BA 3TSYA 2ZBRA 3K15A 2F1HA 3R7WA 3SWWA 4A27A 1Q7EA 3C1AA 4P32A 3WGMA 5JD4A 3BG5A 1BS1A 1IY2A 2I6SA 4W8GA 3TZLA 1Q15A 3UMGA 1JHXA 1DDOA 2YCLA 2VTVA 1H0KA 4UU0A 2O14A 4Y6PA 2ATVA 5D87A 1IBMB 3R5TA 5D00A 2I5PO 4WESA 1U5CA 1ENYA 3CEAA 3K5PA 3KV1A 2Q7DA 4ZZ3A 1D4FA 3QV1A 2E4ZA 4RM3A 2VP4A 5LYJA 4DRYA 3LRPA 4ZZ0A 3L77A 4HN2A 4HBGA 3CBGA 2QM7A 1MMFB 2JJYA 2XTZA 2NV6A 3BH0A 3L7BA 4TZKA 3ZQJA 1A9XA 4OFZA 3ESCA 4U5XA 2HEGA 4P3KA 4UC0A 3TPFA 1YS4A 2G9QA 2AI1A 1GG8A 2D3WA 2P9ZA 3G2LA 3OZDA 1D9XA 4PG4A 1L7MA 2JBHA 2W7TA 9LDTA 1GILA 2VVTA 2X0JA 2GRAA 2EZ4A 3AOEA 3IUSA 5AH0A 4B3RB 3DV9A 4H2DA 4DDHA 1JG7A 4OHRA 4OQYA 4PZEA 1NQTA 4HBZA 1VDZA 3UB3A 1PJBA 3A70A 4INAA 5BSRA 1FDTA 3A1EA 4G4SP 3ZWKA 2GERA 2NNLD 1S7CA 3GZNB 4FUQA 1PGPA 3W5IA 2E4VA 1BYUA 2HZBA 3ZE8A 2VC2B 2V3WA 3MT0A 3K96A 1O7JA 2GK3A 4XCQA 4LCJA 3ITEA 1DMSA 5HRUA 4QASA 4WZAB 1PGQA 5JH7B 1H1TA 1UM8A 3L49A 2ZUSA 3G23A 4TUYF 4C3OB 3VVCA 3NKFA 4EPYA 1YR2A 2B1QA 2C07A 2F2TA 1FP1D 3A14A 3D6HA 3OY7A 2JRCA 2D00A 2PYZA 2ID8A 4MEAA 4TZTA 5FNVA 5JNVA 3UJNA 2DFVA 1L1QA 4LCEA 1PT8A 3FDFA 1P17A 3OJEA 4ZVVA 3T35A 5D3MA 3VNUA 3UWSA 3IVMA 4G85A 4M98A 4DM3A 2F4NA 5K01A 1H0HA 3UAXA 1FDRA 3KB8A 4DOMA 1Z0IA 2WTNA 2HKIA 4IFTA 1YASA 1W19A 2UUAB 4OJYA 4UEOA 3SQOA 2BRUA 3BMNA 3IR5A 1OAOA 4LY6A 2B9VA 2GM9A 3D7NA 1OSNA 1VIVA 5D3KA 1W36B 1UZNA 1KAHA 1V8DA 4CIDA 4LVUA 1U1DA 2H4ZA 3BAFA 2O2GA 3E23A 4OXQA 3URMA 4C0XA 1EM8B 4AZWA 1U2DA 1PL6A 3SIRA 5AYVA 2PX4A 2K2WA 4B5KA 2G88A 2V6BA 2HV8A 3TQQA 1HY3A 3TTSA 5GWXA 5KNBH 3GJ6A 4E03A 1G55A 1SD1A 2I4LA 3M70A 3P9PA 2FU5C 2IU4A 2OB1A 2PBRA 4N47A 1VYVA 1TO2E 3HQ4O 3NHPA 3QFHA 4LOLA 4BNNA 3NBYC 4Y7CA 4YRZA 3MMZA 3W78A 1DQYA 1MAUA 3FNEA 2XVZA 3IKMB 1B6SA 1LRKA 3DSRA 3G79A 2VJLA 3K1AB 2YN0A 4QRIA 3RVBA 1IAVA 2DF8A 2XF2A 1BMFD 3PHHA 5CJ2A 1CRPA 1UEXC 1QFZA 1M1YE 3NTUA 5AR1A 1QIIA 4BWGA 1YI8A 4HV4A 1KKUA 4ZYXA 5B7NA 1NNEA 3IUPA 4GR5A 2GUWA 1O6FA 1G3MA 1FCJA 2AOUA 4LQ4A 1SC1A 4BV3A 4C2AA 1NF8A 2DP4E 2H08A 1GZHB 4OJMX 4B43A 1XRPA 2QRUA 4A16A 2ZPUA 4QUGA 4RH0A 3V9AA 4D3DA 4D41A 1LBHA 1JJIA 1RLJA 1RXYA 3S2YA 3TDNA 3V9PA 3P9XA 3STWA 3TQSA 3RVNA 1LBTA 2VPWA 2GN6A 4OJKA 4WASA 5TJ9A 3HCRA 2SKEA 1LD3A 3INTA 2P0EA 4FHZA 2KHZA 3WZMA 2EBWA 3FOWA 3K5WA 2H31A 1UMBA 1HETA 5F3DA 1P2UA 2Z6VA 3HXQA 3TAXA 2CMFA 4XLTA 4C07A 2BGUA 1L3CA 2UZ3A 1X0VA 2O2YA 2X0IA 4HRXA 2Q7XA 1F06A 3PC8C 2X4LA 4KH1A 5ALGA 3SP1A 4RD0A 4A26A 3U56A 1XP5A 3G5LA 3L46A 1CIJA 2HIMA 3W2FA 4CL2A 2WNIA 3QMMA 3Q11A 3AVOA 3X2SA 2CVFA 1Z4JA 1JQKA 1CCWA 4R0MA 5BSKA 1NFFA 3ABZA 1JQLB 5L6LB 1YB2A 3QVSA 1KJQA 4XDHA 1E1QD 5IKEA 4DBVO 1WX1A 4Z7QB 3IEVA 4GPZA 2VRCA 1PG5A 2CMGA 2OSBA 1QOZA 1XJQA 3TKLA 3VNQA 2JLRA 1Y42X 1TQ4A 1ZWKA 1RI2A 3KHUA 2EXXA 1M34E 1JQEA 3R3JA 1ZVQA 4GXRA 3NP9A 4RD3A 5H9VA 3ZLVA 5IAOA 2Q2QA 1TK2A 4WEOA 2ZYAA 4WVFA 4BFXA 4QODA 4BNKA 2C59A 2AEMA 4RY8A 2AX3A 1DMRA 6ADHA 4TV9B 2OHJA 2JFUA 1SHUX 1QTNA 2BFPA 3VXKA