4R69A

Lactate dehydrogenase in complex with inhibitor compound 13
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
331
structure length
325
Chain Sequence
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimization of 5-(2,6-dichlorophenyl)-3-hydroxy-2-mercaptocyclohex-2-enones as potent inhibitors of human lactate dehydrogenase.
pubmed doi rcsb
molecule keywords L-lactate dehydrogenase A chain
molecule tags Oxidoreductase
source organism Homo sapiens
total genus 112
structure length 325
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4r69A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4r69A02
3ZN2A 4D0RA 1R6DA 1E7MA 2JL1A 2O50A 1VJTA 2ZQZA 3O38A 1Z7BA 5IN4A 4OHUA 2JCYA 4BOYA 3QWFA 2HMTA 1KY5A 1LLCA 3DZIA 4KUGA 4XGIA 4YA6A 1WDMA 4J49A 3D0OA 3G17A 1AHIA 1H9AA 1L7EA 3NDJA 3NDRA 3M6IA 3W6ZA 4YCAA 4NU6A 3B1FA 3RBZA 1B3RA 1RYEA 2Y0DA 1ADGA 4WCFA 4CQLA 4RF4A 4RPLA 5GY7A 1Q0QA 4B7CA 3BTUA 5T64A 4YT4A 5KJ1A 1P1RA 4AJJA 3HB4X 3OQ1A 4D45A 1PQPA 1XG5A 2C5AA 3WQSB 1DAPA 1Y8QA 4YB8A 1LDBA 5TQVA 3FNHA 5AXAA 4NK5A 3BTSA 1QYDA 4Q3DA 3SJ7A 1IB6A 3KYCA 4QO7A 4CM4B 3HDJA 4BL5A 1BXZA 2B5VA 3WS7A 5C7IO 1BSVA 3KTDA 4UVGA 1YOVB 3PTZA 4ALLA 1W8DA 3W6UA 3FR8A 3H3JA 3UCEA 1ARZA 1GCOA 2VUSA 4XJTA 1U2GA 3RUEA 1EZ4A 1YDEA 4J16A 4TRMA 4ZJUA 2NVUB 9LDTA 2HLPA 7MDHA 3IJRA 1I3NA 3D3WB 3NYWA 5TJHA 5JDIC 2X5KO 2ZJ1A 3C7AA 5HRUA 4BUCA 2FY8A 3WSWA 2IXBA 1BHSA 1WVGA 4ZQHA 2ZB8A 4ZU3A 2AE2A 4E30A 2OL4A 2VYVA 3GGGA 4I8XA 4MVJM 4QTZA 1T26A 5CAEA 3K92A 4XQCA 1OC2A 4ND4A 4CM8A 2Q4EA 3IDSA 4BQPA 4DQUA 2FSVA 4I5FA 4IDBA 1RJWA 1IL0A 2EW2A 4GH5A 1SEVA 1TA4A 4QQRA 3GAZA 5BNFA 2Q45A 2FSSA 5CDSA 5JC8A 5JMWA 3COSA 3GFBA 3H4VA 1PZFA 3OHSX 3IUSA 2RCYA 4DBVO 5A9SB 2F00A 3KVOA 1WAMA 3I3OA 4PLHA 1EQ2A 3CUKA 5DBGA 4ND2A 1E1LA 1Y7TA 4B4OA 3F46A 3S2EA 2D3TA 4JP3A 4RVSA 1JA9A 3K5PA 5ADHA 4UUOA 3OF2A 4L73A 3WR5A 3AUTA 3I52A 1R4MA 4M8SA 4WLOA 3OIFA 4XYEA 3G49A 3VKUA 4XCVA 1BW9A 5DDIP 1NR1A 3ZNPA 4KOAA 5CEEA 3KYDA 3VPHA 3LQFA 5B12A 1IY8A 1E7WA 2DTEA 4QEDA 2GR9A 3DAPA 3VZQA 2FN7A 2Q99A 4PLWA 5LCXA 5AQ1A 5T57A 4YVFA 3RJ5A 2OBYA 1UXGA 4O5OA 1UXHA 1LNQA 3NAQA 4KQXA 2WD7B 2IXAA 4IIUA 1NPYA 1UZNA 4ZVVA 5KVCA 3ON5A 1D1SA 2WJPA 4EYEA 3NT2A 3U4CA 1DC4A 4PG8A 2ZTUA 1MC5A 5IAAA 3JQEA 1N7HA 1PS0A 3DOOA 1H94A 2ZCUA 4TKMA 3SLKA 4XEHA 1E5LA 3WYEA 1NPDA 2YHUA 1K5HA 1X7HA 4EZBA 3ZV5A 4IDFA 3KLPX 5F3RA 4CLDA 4BKOA 2J5QA 5CPBA 2AA3A 1LC3A 1XELA 4PVDA 1GEEA 2O3TA 4II3A 2P91A 3P2OA 1QSGA 4AJNA 3EAGA 3VZRA 2W2KA 4YJGA 1P0FA 1H6CA 2HSDA 2FPIA 3O03A 4MP8A 5COBA 4ZQFA 1TT7A 3OJOA 3NRCA 4EEZA 2GERA 3GGOA 5C7OO 5CFZA 4RVHA 1LLUA 4D7AA 4PCVA 2JHGA 3QVXA 3LU1A 1PJSA 2I6TA 3RU7A 2EJVA 1XEAA 1U9JA 4PLVA 3DBRB 3Q2KA 4YQYA 3I4FA 5JYDA 2CVQA 1WMBA 3G3EA 1X7GA 2NU6A 5G4KB 4DWVA 4TROA 3UICA 1SAYA 1VL6A 2BRUA 3GEMA 2QQ5A 3CINA 1ZK1A 4WOKA 5JLAA 5L40A 2YY7A 3GN2A 2H9IA 3NGLA 3INRA 2HUNA 4MO2A 1EEHA 3RUDA 4AICA 3BMQA 5KNLA 2PH5A 2OMEA 2PR2A 4HKTA 4AFNA 2Y1FA 3O8QB 3OJLA 4H15A 4E0BA 1PL6A 1K89A 1TB4A 4CLRA 5KOIA 2YHIA 2EXXA 3E48A 3IIEA 3OECA 3ZZNA 4XKJA 4J91A 4XQGA 2IZ1A 1GPDG 4FQ8A 5JCJD 1ONNA 3ADPA 3D5QA 2E49A 1G6KA 4XJSA 1SB8A 1AUPA 1QMGA 4UVEA 3OQBA 1VC2A 3ROQA 1EBFA 1AN9A 3I23A 5EIOA 2R6JA 4XR4A 4ND5A 4CLXA 1NVTA 1Y9EA 2W98A 1FDTA 1HDOA 3TL2A 2QRLA 2JFFA 1KY4A 1IYZA 3NKLA 3KSZO 4Z9FA 1Z75A 5A9TA 1OMOA 1QV6A 1I2ZA 1HE5A 1ZMTA 3PZRA 2Y93A 4KWHA 1QG6A 2OO5A 1B0AA 4I9HA 5F1PA 3DR3A 1U5CA 3C8MA 4GGPA 1XU9A 4N18A 4QSMA 3PXXA 3AI2A 3AY6A 4RVFA 5DOZA 4BO3A 3GNTA 3DB2A 4L74A 2Y1CA 4QT0A 4Z9YA 1A27A 4R3NA 1YBMA 3ABIA 1P45A 4R69A 1ZXBA 2JJYA 4RL6A 1TI7A 1P9LA 2GUGA 5H81A 1KIFA 2GN4A 2W90A 3BA1A 4RPJA 3WG9A 5CEFA 4ROSA 5B4VA 4D3DA 1U2DA 1PJ4A 3GEDA 4ALNA 2VHYA 2NACA 5KJFA 1ZW1A 3HDQA 1YS4A 1C1XA 1J49A 3OBBA 4OSPA 5CG2A 1CERA 3CPSA 4ZQEA 4JN6B 5HBRA 5KVQA 1NNUA 3B70A 4WCFC 3EZYA 1QLHA 3ASUA 1DIGA 3MEQA 4TWRA 5ICSA 3KHUA 2DBRA 3AM3A 4WNIA 5T67A 4E13A 3PJDA 1IULA 3VPGA 3AJRA 2EKPA 1P74A 1U5AA 2O2SA 2W8ZA 1LX6A 4PIVA 3SLGA 4JXKA 4YT5A 4RF3A 5KCZA 3WOHA 3JTMA 1YH3A 1C3VA 1SCUA 4PG4A 3WYCA 2FZWA 1YONA 4MVJG 1PJ3A 4NBWA 1K6IA 1W4ZA 2CDAA 4WNCA 1O5IA 4BNGA 2TMDA 3FR7A 4BNYA 4J1SA 3GT0A 2IE0A 3GR6A 3DBHA 1A7KA 3LVFO 4O1MA 4RJTA 5JNLA 2I66A 1YO6A 4U6QA 1LBEA 1UUFA 4W4TA 1LSSA 1N1GA 4D41A 3TZCA 1EMDA 1LC0A 1R4MB 1ZVMA 2VRBA 1QYCA 2CUKA 3U49A 3UF0A 1BW9B 3RUAA 1PL7A 5L4SA 2HKIA 4MIYA 1GYQA 2Q1TA 4CL8A 3GH3A 5JBIA 4CR8A 4R68A 2CMDA 3ZWOA 4ZQBA 2O7QA 3ROPA 1MX3A 4RVDA 1LSOA 1MLDA 3DDNA 4CMIB 4F46A 5IDQA 1JAXA 5IZCA 1P44A 3OEWA 1PGPA 4LCEA 2Q46A 2ILTA 2HQ1A 4A7PA 1E1MA 4D43A 4FFOA 1PQUA 3I6IA 1PL8A 3STHA 3Q0EA 1YKFA 4CM9D 4CL3A 5I7FA 2DQ4A 1MG5A 2JCVA 2TMGA 1H6AA 2JAHA 1EE9A 1QLJA 3GVXA 1XR3A 3TFOA 2FRDA 1R37A 2JFHA 3G0OA 3P5SA 4PLFA 3LF2A 5FF9A 2HCTA 5HS6A 4DLBA 2P68A 1ADFA 1HDYA 2NADA 4XRRA 1QORA 3GNSA 1UP4A 3TFQA 2X0NA 4BMSA 1E0DA 5L4NA 1K2WA 4CMAA 1PX0A 3ZWNA 5JAQA 4UUNA 1HDZA 1OI7A 2X4GA 4IGEA 5C5IA 4RPKA 2VN8A 3RD5A 4TSKA 2W2KB 3HHPA 1L1FA 4E32A 2H6EA 2NU9A 2O3RA 1NFFA 1UAGA 1X14A 2Q1WA 4NFYA 3A1NA 1GYPA 4UEJA 3TZHA 3EC7A 4OXKA 1KVUA 3VTFA 1VE9A 2HMSA 4KWIA 4IDAA 4CM4A 2E6UX 1ORRA 1RM3A 2FMUA 3TNLA 4GPD1 1PJ2A 2PD3A 1FDUA 2Y1DA 3BMOA 1X0XA 1KS9A 3WGTA 1HZJA 1P31A 1C14A 3QQPA 4O0LA 3Q6IA 1I2BA 1HSZA 4I5DA 4IGFA 4E3ZA 4XYGA 2C2YA 3ZU5A 4J7XA 2XF8A 1O0SA 2PGLA 2V6FA 2VNSA 3TOXA 3KZVA 2IZZA 1E3SA 3L07A 3F47A 4UVIA 1KYQA 4P38A 1DIBA 1KEWA 3Q2IA 1WDKA 3VPFA 1E3IA 3JYQA 3ZV4A 2H1SA 2CDBA 3MJSA 1P1HA 2FOIA 4OIMA 1LQUA 2VHXA 4IS3A 5CHEA 4WGGA 3ANMA 3ZNOA 1U3TA 1ZKMA 3JQ9A 4J2HA 3WQQA 3KO8A 1I2CA 4NZ9A 5BNTA 4KZPA 3ZV3A 3W4KA 4ZRNA 2FHSA 2A4KA 5A3JA 4L9RA 4YT8A 1R15A 3NGXA 1UXJA 2P9GA 1WXDA 2PV7A 3GDOA 4YYZA 2PZJA 4TRNA 1Y81A 3BMCB 4HWKA 4WLFA 3BHMA 1V8BA 5A9SA 4MOWA 2VT2A 3BTVA 3DTYA 3QVSA 4HNHA 3TF5A 4LCJA 2WM3A 1ONOA 2WDZA 2X7HA 2YZ7A 4GX2A 2GYYA 4NU5A 4FJ0A 1GY8A 4C7JA 2DFDA 1SNYA 3OP4A 2VYVD 3E1KA 4ND3A 4Q3NA 3KB6A 1YJ8A 1F17A 1PGNA 1V35A 3KLMX 4IM7A 3S2FA 2G82A 4GQAA 4KTVE 2GZ1A 1M75A 4EDFA 3PGXA 2R2GA 2B37A 3UOGA 2PK3A 4GX0A 4NBRA 5F1OA 3ICPA 3CH6A 3VC7A 1E6EA 3PVZA 1GZ3A 3PQFA 4EW6A 4DYVA 2X0RA 1NHGA 2EIHA 2Z95A 3FN4A 4XX0A 4CV0A 1ISGA 4DC0A 1CJCA 4KP7A 3GQVA 1ULUA 1CYDA 5K9ZA 3CE6A 4FFMA 1C1XB 1ZO8A 4BNWA 4EJ0A 4MVJI 3WGGA 5EL0A 1GFSA 1YE3A 4NR0A 3DZBA 3RUFA 4BO5A 4WE3A 3FNEA 4BB5A 1ADCA 4GI2A 5ER6A 2HRBA 4UVHA 4EI2A 5HS4A 4JGBA 3GOHA 1DFIA 2C20A 1LLDA 4JBGA 3EY4A 5JO9A 2P9EA 1DFHA 2EEZA 1I3MA 2BGKA 1NQTA 4IDDA 1R0KA 4HP8A 3PLNA 1I24A 3D1LA 4FJ2A 2B69A 1B7GO 4U6SA 2ET6A 5TJ9A 3RUHA 1NM5A 1LEHA 1DC5A 1QP8A 3ZHYA 1H2HA 4Q3AA 3RUIA 3H9UA 4GVLA 4A0SA 1NX6A 3GVCA 3WBFA 4Y6PA 5F21A 1I33A 4S3MA 3KM0A 3ZCXA 3PYXA 4W6ZA 3HFGA 2EV9A 3PRJA 3L77A 1GDHA 2X0JA 3DBRA 4J0EA 1HZZA 1QXSA 2O4CA 4GVXA 2FPPA 5KVVA 2CVOA 1MC4A 2JAPA 5G4KA 1W6UA 3CKYA 3ENNA 4CMBA 2AHRA 4OXNA 5B4UA 1HT0A 2YUTA 3H7AA 2UYYA 3L0DA 4PFJA 4BNJA 1GD1O 1DC6A 3HDHA 3WTCA 1F14A 3R6DA 4YRBA 3IP1A 1NVGA 2AG8A 3WGIA 4EJ6A 3TRIA 5CDTA 1B2LA 1NQ5A 3E6AA 3O8QA 4RLSA 4MP3A 1NBOA 1H5QA 3H9JA 3I9NA 3OM9A 1Q7CA 2Q49A 2CFCA 2Y05A 2OBNA 4AJ2A 2VYNA 4OQYA 1ZBQA 2C7VA 2P5UA 1IPFA 5TRTA 1EK5A 1DIRA 1EUZA 4DPLA 2E37A 3GF4A 1CF2O 4TRJA 4HADA 2GDZA 1KVQA 2AEJA 2OHXA 3RIHA 3SJUA 2VOJA 1ULSA 2RAFA 3KRTA 3DZKA 4M55A 1DJNA 1R12A 4FDAA 1SO8A 1IUKA 4J1TA 4LK3A 4BS9A 4YR9A 3CZRA 4WK6A 2OP0A 5KIAA 3WXBA 4IZIA 1GYRA 4J4BA 3JQAA 4XQEA 4DPKA 5DBIA 4BNLA 3ZU2A 3FBTA 2YW9A 3DOCA 3JD3A 4NMHA 1N7GA 1DSSG 1SEPA 3ICCA 4DA9A 4MVJH 3HADA 4YWJA 3L4SO 5G0WA 5A03A 4MIEA 2A9FA 3FPCA 2PA3A 4PRLA 2OFPA 3Q3CA 1ISFA 2EKQA 1EUCA 5JW6A 1DAOA 5F5LA 1EBUA 4PLTA 1R4NA 5GZ1A 2NNLD 3ENKA 3BMOB 4CM7A 5T8KA 4DTIA 3GRKA 1HE3A 2UV8A 3JQGA 1LRJA 3UN1A 3EW7A 4OAQA 1NHWA 3ZNQA 1BVUA 5IZCC 4G2NA 3OFSA 3WX0A 3RFXA 3F5QA 4ZGWA 1N8KA 2ZB7A 3RVDA 4BO0A 5JAZA 4R51A 2GZ3A 1MXFA 3ZWWA 1ZNQO 2HMVA 3I4CA 5IF3A 5CEJA 4IXTA 4CPDA 1PWZA 4WLUA 4OM8A 4WEQA 3ETDA 4RPGA 1MXHA 1DIHA 3KXDA 5ILOA 4IS2A 1UXIA 2UUPA 4FB5A 4GWGA 2Z1MA 3MOGA 1DPGA 4PLZA 2Y1GA 5IDXA 4TQGA 2PNFA 3AW9A 5ENVA 3GMSA 1YQXA 2JCXA 3P7MA 3OJ0A 1JKFA 3GFGA 4D79A 5TF4A 3UKOA 3KEOA 3QW2A 4BKQA 3MJTA 2Q50A 2D8AA 3O9ZA 3RC9A 1LDGA 1Y1PA 1ENYA 2YQ4A 1OC4A 1ISMA 1PZHA 3GPDG 1Y8RB 2ZYGA 4W9NA 2ZKLA 2B4RO 4RZIA 4U0KA 5FI3A 3RC7A 2ZB3A 1LA2A 4B8ZA 4IJUA 2NQ8A 3FWNA 3HE3A 4NFSA 3VDQA 1WLYA 2UAGA 1AHHA 5HA5A 4BNHA 1UP7A 1E3WA 2V6BA 2IODA 4EUFA 1E7RA 4IQ8A 2X6TA 5C3MA 2B35A 2G76A 4IY1A 3U09A 1P0CA 3NT5A 1B8VA 4FR5A 5G4LA 1X1TA 2OORA 2CD9A 3DBLB 5DNAA 3VPSA 5CDYA 1H6DA 4OL9A 4DMLA 3C1AA 4U8GA 2IDZA 5BR7A 2VOEA 3FCOA 3KETA 4ZRMA 1N2SA 4BGEA 4G81A 3SBOA 4PVCA 1HYEA 2YV3A 3DMYA 1P77A 4LSMA 4RF5A 4QECA 2D2IA 1RYDA 2EW8A 1VRWA 5DN9A 3IAHA 1BTOA 1FXSA 4K6FA 5ES3A 4LGVA 4CMIA 1NAHA 2CZCA 2C07A 3RKRA 3PHJA 5A1TA 3H5RA 5IG2A 3JQ9C 3JQFA 4UVDA 5JY6A 1OBFO 2Y1EA 3DFZA 4YXFA 1JU9A 2PKQO 4XA8A 2Y99A 3T7EA 2AEMA 3WSVA 4D3FA 3R0IA 3E03A 3WFJA 5AYVA 1C0LA 3KSUA 4R5HA 2QHXA 4HUJA 5EMHA 5GMOA 3PHGA 4GBJA 1ZEJA 2LDXA 3B20A 1XKQA 3E9MA 5JPIA 4XB1A 3UCXA 5GZ3A 3PQDA 4NNJA 1T1SA 3JQCA 1E92A 1EDOA 5I9LA 1LU9A 2JKVA 3C3XA 2PGDA 1E3EA 1OFGA 4ILKA 4YQZA 3U0BA 2DTXA 4YJFA 5A06A 4QXMA 2A92A 2X8LA 1VL0A 1DHRA 4OYRA 3WDSA 5CG1A 2X0IA 5I8ZA 2Q2QA 4J3FA 3S2GA 3ZWPA 5A5FA 2O4UX 1VLLA 4A2CA 1VKNA 2ZYAA 1JAYA 3RROA 4NH4A 2P2SA 8LDHA 1E7YA 5EJ2A 5TSDA 3UVEA 4S1VA 5A04A 1GZ4A 1I10A 3PFWO 1IZ0A 1XU7A 3ULKA 4D3SA 5DF1A 4BNNA 5IFLA 3ZHZA 3E9NA 1BXGB 2C7GA 2V6GA 4PZEA 5L95A 2YFHA 5CDGA 4JBIA 2GD1O 3LT2A 1X0VA 1ZFNA 2C2XA 5HTOA 1I0ZA 1IPEA 3EUWA 1ZSYA 2WMDA 3P19A 2WE8A 4M89A 1NFRA 4BGUA 2X58A 3HUDA 3HZZA 1DLJA 4O59O 3RKUA 2JD2A 2CDCA 2B4QA 3GNQA 1E7SA 1EK6A 3BYZA 2JFGA 3F4BA 1TXGA 4LW8A 3H3FA 3VPXA 1T2EA 1U7TA 3B1KA 3M1LA 3P2YA 1DOHA 4R9SA 4ND1A 3WJ7A 1XWFA 5G0SA 1KERA 1MFPA 1FDVA 3V5NA 3K8ZA 1CQJA 1HLDA 4PGFA 5AXCA 4AG3A 5B1YA 4KUEA 5BQFA 4B4VA 2DBZA 2X5JO 4CQMB 4B3IA 1M6HA 1BRMA 1EVIA 2AG5A 4OH1A 1BG6A 2EGGA 4N54A 3BMCA 1UR5A 3AOEA 2P5YA 1YBVA 4K1LA 4BNFA 4EJMA 2JHFA 3JQAB 4CMJA 1HYGA 1UZMA 3HFSA 1SPXA 1HDRA 2G1UA 2Z1NA 5DZSA 3AUUA 1SC6A 4E2WA 5TS3A 4JCOA 1TEHA 1E1KA 2DFVA 4QX6A 5LC1A 3DHYA 3I5MA 5I9MA 3WNVA 2NV6A 2QZ9A 1K6XA 3W1VA 2PWZA 2X5OA 3HQ4O 1PJCA 4DUPA 5KJEA 1OOEA 4BNXA 1F12A 2HJRA 1R4NB 3RSHA 4IQGA 4P4NA 1E7QA 3VTZA 1D4FA 1KEUA 1HYHA 2FR1A 1DIAA 3JQGB 3AM5A 3ZHBA 1YGYA 5U1PA 3H9GA 4L4XA 3F5SA 2QYTA 1GUYA 3AUSA 2BFAA 4I5EA 1YXMA 2J3JA 1TVEA 1VJ0A 1MA0A 2VT3A 4PLPA 2EGHA 5DP1A 3VH1A 2VWGA 4CV2A 2FR8A 1VI2A 1NPTO 4PRKA 4MVJD 3PP8A 3Q9NA 4FOOA 2BELA 4G5HA 1WMAA 4XZ3A 3ZI0A 1WDLA 4UREA 4NDNE 3UW3A 3IS3A 1JLLA 3QJ5A 2WYUA 2GF2A 3LDHA 1E6WA 4GX1A 4ID9A 4YDRA 5AVOA 3D4NA 1YQGA 4II2A 2VNAA 5EPOA 4W82A 2DKNA 4PZDA 4H3VA 5KKCA 4I1IA 1R16A 1E1NA 4NJOA 4BO6A 5COAA 1XCBA 2C0CA 2YJZA 2QYSA 4RDHA 2FZEA 3K2EA 1YB1A 1O95A 6LDHA 5B4TA 3GUYA 4ZHSA 5EQDA 1YDWA 5JAIA 3JD2A 1F06A 1UDAA 4BKRA 5JE8A 3AFNA 4CM5A 1JWAB 1QYVA 3WGYA 4AJ1A 3A06A 1E3WB 2A94A 1NQOA 3HG7A 4DRYA 1T1RA 3W8EA 3LK7A 2EF1A 3GEGA 3GG2A 3QY9A 4RORA 2WWRA 3UCFA 2NTNA 2W4QA 4E21A 1B8UA 1G0NA 4L4SA 1A9ZA 1UH5A 3CTMA 1LI4A 1BDMA 5HM8A 3LT0A 5T5QA 3U3XA 4DIOA 5JO0A 3PGJA 4TKLA 4L4RA 4CODB 3AY3A 1IHYA 1C0KA 3EMKA 4YAIA 1ML3A 3C1OA 1I3KA 4BO1A 4NJMA 1ZK4A 3AK4A 4WJZA 2J5RA 4BMNA 2HAEA 3FF4A 4B3HA 1Q7BA 3V2HA 2EP5A 2YV2A 3WIDA 4BV8A 4B7XA 3OJEA 1LDNA 3PHIA 2VHVA 2DU8A 4L75A 1Q2XA 4YAGA 1GQYA 3DFUA 3RC1A 3I9KA 4NPCA 4DQXA 3HDYA 2I76A 4E5PA 2WD8A 3R3SA 1OAAA 2H63A 4NBTA 1I32A 1WPQA 1XA0A 1WP4A 3GC6A 3ORFA 3GA0A 3GN1A 3QHAA 2I99A 2DVMA 1P1KA 4XYMA 4W9NC 4AJHA 1PGQA 1LDEA 1QRRA 1N9GA 2J8ZA 3KSDO 2X86A 1AE1A 3CEAA 2O48X 4K28A 3V8BA 3QSGA 4LMPA 1A9YA 3E9QA 4YJFB 3AFMA 3H9EO 4FGSA 5BT9A 5JDIA 3OH8A 3VZPA 4P4GA 5TNXA 3W4IA 1PZEA 2NQTA 4OQZA 3ZWCA 3HNPA 5JAMA 2WEKA 3ZU4A 3NEPX 3OSUA 4BIIA 3T7CA 1XDWA 3WGOA 2SCUA 3RAJA 5I8WA 2HO5A 3IJPA 4CV1A 1IE3A 3ADOA 3WGZA 3GRPA 2VTEA 2X23A 1H93A 2Q1UA 2VYND 4L0QA 2D0IA 1DXYA 2QW8A 4LRSB 4N5NA 4JJFA 3JQFC 1ZIDA 3TOZA 3WLEA 1PU2A 1GQ2A 4CQMD 2AQHA 4NHEA 5LDGA 3C7CB 1ZK0A 5ITWA 2VUTA 1C1DA 3GG9A 2V7PA 3JQAD 3K96A 3FHLA 3H9QA 4IMRA 4EITA 3TPCA 5L7YA 1JW9B 2WE7A 2C59A 3TQHA 3RJ9A 1FDSA 3B6ZA 2VTDA 1VSUA 4R9RA 3QWHA 2ZK7A 1ZSNA 1GR0A 2YDYA 3RASA 4DBZA 5JS6A 3H2SA 4Z0PA 1A5ZA 1EDZA 4IQ0A 3GY0A 4XYBA 1DRVA 3DC2A 3TWOA 1GV1A 1X7DA 3DXFA 1S7CA 3I9JA 3ZV6A 4YAJA 3BIOA 4QFDA 4I9UA 3GDGA 1EUDA 1Y6JA 3GZ4A 3CZMA 4E31A 1H2BA 4BO7A 4BNZA 1JVSA 3GMDA 2EERA 3GPIA 4H16A 4ALJA 5IZ4A 2PKQP 1UXKA 2VZ9A 3EGOA 3LZ6A 4FFNA 2XXBA 4DL9A 5JDCA 1Y8RA 3N7UA 4R4JA 4UEOA 5EINA 4K26A 4WECA 1A4IA 4M54A 3BTOA 3S8MA 1F8FA 2O23A 4BNVA 3QLJA 4ZICA 2NM0A 1X1EA 2PZLA 8ADHA 2RH4A 4MVJP 2W2LD 5G2OA 3VAZA 1Y5RA 4J43A 4MVJA 1LQTA 3QWAA 1LDMA 4WOJA 4IDGA 4DMMA 3WIEA 1CEQA 4GX5A 1YBAA 4XB2A 1M76A 3ZWBA 4CV3A 2BFPA 4W7HA 2F1KA 2J5KA 4H7PA 4WUVA 4BNIA 2BGMA 4CLOB 3DBLA 4FFRA 4GSKA 5JC1A 1F0YA 4RDIA 4FOSA 4B3JA 2Q3EA 1HXHA 2ZTVA 2PGJA 4JX8A 4B4UA 2Q1SA 1ENZA 2RH8A 4BNKA 3LSYA 2Q2VA 1ZUD1 3AM4A 3JSAA 3FNGA 3M1AA 3FI9A 5MDHA 1PS9A 3GHYA 4P22A 1ENPA 2DUUA 2XAAA 3PWSA 4BKPA 4BO8A 4HFMA 1T24A 5AXDA 1HL3A 2XOXA 2I67A 4RZHA 5JCXA 3V2UA 1V9LA 2BMAA 4RPHA 4GMFA 4Y98A 2G0TA 5TX7A 1ZCJA 4ALKA 2GCGA 4XQ9A 2CF6A 1Z6ZA 4FC7A 1JTVA 1PJBA 3H5NA 2YV1A 2EP7A 2ZIZA 4WPGA 2D1YA 2D5AA 1EQUA 1L7DA 2GRAA 1XIVA 4QFCA 1QYWA 5TLSA 3DZHA 5FFFA 5DULA 3E8XA 5L51A 3AOEC 1P1JA 2GNAA 4IJVA 4J90A 5I9NA 4DVJA 1Z74A 5I7EA 4M49A 1BGVA 5A02A 2NUAA 4BO4A 1DHTA 1T2CA 3FTNA 1M66A 2AQKA 2WYWA 3ASVA 3DTTA 2CF5A 3MCVA 1ISJA 1VL8A 2P4QA 3WLFA 1YWGO 1TT5A 3CIFA 1MUUA 4YAKA 4OOEA 2Y68A 3UXYA 3G79A 4JIGA 1VPDA 2PFGA 4FC6A 1RM4A 1ZJYA 4CM1A 3JV7A 4INAA 4BKUA 3DZFA 2UUOA 5KVSA 4J4TA 4MKXA 1BXGA 1GL3A 1PJTA 3IKTA 1YB5A 4O63O 5G0TA 3IQDB 4IDCA 3ZDFA 1XYGA 3JQDA 4RVGA 3ZU3A 4AJEA 4BGIA 1J5PA 1E6UA 5C7LO 1DDOA 1ZEMA 1HE2A 1Q0HA 3TN7A 5DBFA 4NJMB 5BSHA 1G0OA 1NVMB 4N5LA 2FWMX 2QX7A 3LLVA 4HXYA 4J6FA 4F6LA 3IKVA 3I9LA 2YQ5A 1T4DA 1U3VA 4KMSA 1N92A 1NR7A 4R1NA 3RCBA 4IIVA 1O6ZA 4YTEA 3PK0A 1KC1A 4R1TA 3X2FA 3PJFA 4YT2A 4OSOA 3VH3A 2DPHA 2NTVA 4WKGA 3FSRA 4ZQGA 3I6QA 3OEYA 4YJHB 2IYOA 3F3SA 5EERA 4XDYA 1PTJA 2ZATA 1GADO 3DAGA 1I8TA 1N9GB 3C85A 3ZGYA 3GVHA 1WZEA 4CQMA 1JVBA 4Y6RA 5U4QA 3FWZA 5CPFA 3AI1A 3A14A 1DJQA 4LRTB 3RFTA 1NTOA 5BSFA 1ISHA 4KTTE 5A4DA 1E5QA 4Y8VA 2GN8A 4R16A 3LT1A 5IDYA 5CP8A 3MWDB 1F8GA 1WW8A 3WNQA 3O4RA 3DZJA 4E2YA 1XSEA 4DC1A 2PD4A 1JQBA 1A4UA 2OZPA 2C29D 4URFA 3VKVA 3KOUA 3E18A 2DUWA 3ROMA 1T2FA 3MTJA 1RKXA 2BFOA 3BXXA 4U7WA 5ER9A 2I65A 5IDWA 2BFMA 3SVTA 4HV4A 3OMLA 3D4PA 3K31A 2ZCVA 5F1KA 5K6AA 4TMFA 3JQBA 2CSUA 5C37A 2FP4A 2G17A 4JROA 4JP2A 3WB9A 3WYBA 4E5KA 1J0XO 2VZ0A 3PDUA 2W2LA 2VWQA 3VH2A 4CMEA 2FR0A 5A3VA 1YB4A 3VHRA 1HE4A 1WZIA 1C1DB 1YL5A 5ILGA 2IEDA 3F4LA 4BQRA 1RM0A 4UULA 4M1QA 1U3UA 4AJPA 3VVBA 3DEYX 3PEFA 2IYPA 4GLLA 4MKZA 4R1SA 3UH1A 4R54A 4BB6A 4BNUA 4YRAA 2V65A 4JJIA 4OJNA 5DP2A 4A5OA 3GZNA 3JYPA 5KTKA 3WICA 4Z9XA 1BDBA 1HWYA 3GVIA 1PEDA 3HJAA 4IJWA 4A03A 4XGKA 3PYLA 4FFLA 3JQ8A 3SXPA 3C1TA 4PLGA 1U4OA 1HEUA 4M87A 5L45A 4YEDA 3ONDA 3TZ6A 3I83A 5ITVA 2CY0A 3DBVO 4Q3CA 2Y0CA 1PZGA 2O3UA 1FK8A 4CLEA 9LDBA 3IC5A 2I5PO 4ALMA 1ZK3A 2J3KA 3V1TC 2BHLA 5THQA 1LXCA 2VRCA 3S1LA 4FW8A 3U5TA 4R01A 4LISA 3U9LA 2GSDA 3F1KA 5JYEA 2O3SA 4DLLA 5JY1A 4J9VA 2NLOA 1YVEI 1GCUA 1Z82A 2AQ8A 4HY3A 1UDCA 2P9CA 1DRWA 4JBHA 2NU7A 3T4EA 4NBVA 3L6EA 4EUEA 3ZWMA 1NXQA 1KVTA 4GLOA 3WTBA 1IZ9A 4C7KA 5L53A 3CMCO 3OETA 4TVBA 2GGSA 3N74A 3D7LA 1KVSA 3IOYA 3FD8A 4XDZA 1Z7EA 3GVPA 3ETGA 3WWYA 4RV9A 1G1AA 4N7RA 4DIFA 2AW5A 3INGA 2YDXA 3AY7A 3JYLA 3NV9A 4FFPA 1LSUA 4MVJF 4XRGA 1WNTA 2JD1A 2R00A 1YRLA 2PTGA 3S55A 2QRKA 2Z5LA 1XQ6A 4NQZA 5IJZA 3GK3A 4DPMA 4DGSA 5COQA 1V3VA 2UVDA 4MKRA 4FIZA 4MINA 2Y67A 2AXQA 4Q39A 5TIIA 3BHJA 2HMWA 3ZHXA 4ZA2A 4F45A 3KEQA 3LC7O 4U0JA 3EZLA 3M2PA 4U5QA 3QVTA 3RUCA 2HDHA 3K6JA 4AJKA 3AUAA 3KYBA 2WTBA 4XWYA 3ROKA 3MTGA 1I01A 3NJ8A 5JDCC 1N5DA 3QVWA 3UHAA 5L7TA 3ITDA 3S2IA 3L4BA 3L6DA 1GQQA 1ZK2A 4Y9DA 4E2XA 3JQ7B 3RQSA 4FS3A 4MJLA 1EVJA 5CDUA 1O9BA 2CNBA 3NTQA 3CMMA 3CXRA 4OO3A 1LRLA 2AEFA 3K2BA 4CMKA 4DLAA 4J2OA 4PG6A 5FYDA 2BLLA 3TZKA 3A28A 4Q3BA 2BD0A 4GAEA 4CMHA 4D44A 1TT5B 2DAPA 3A9WA 4PG7A 1BXKA 2C54A 5G0UA 3SEFA 4LVCA 1SOVA 2PKRA 4C4OA 1DO8A 1U8XX 1R0SA 3H65A 3R1IA 1PGJA 1UAYA 1IHXA 4ONEA 3AU8A 1JKJA 3LT4A 3MJ4A 2V6MA 3QA9A 5BSGA 5DT9A 3VDRA 3NJ4A 4R1UA 2Y1OA 5I7VA 2O3QA 2VHZA 3OJFA 2GO1A 4CMGA 2XXJA 2IRWA 3AWDA 5DCUA 4ALIA 2E82A 1RWBA 4DIBA 1HKUA 1B3BA 1QR6A 4UUMA 4UEKA 1EVZA 4MPDA 1KETA 4CMCA 2HMUA 3SC4A 2RBEA 3ONFA 1MV8A 4YPOA 4CUJA 3HB5X 1I30A 3NDIA 5KKAA 4CR6A 4JK3A 1V3TA 4IMPA 3PHHA 4A26A 3D4OA 1NWHA 1Y9AA 4DXHA 4R5MA 1X15A 2PZMA 3DL2A 3Q9UA 1HTBA 3HWRA 1FDWA 4AL4A 3ONEA 5JMPA 4I08A 3LC2O 5FEUA 3DHNA 4WLVA 4CLHA 3RC2A 3GUCA 2OGUA 4RQUA 1IOLA 4B8WA 3ANLA 4GSLA 1JKIA 4JNKA 3MWEB 4MIOA 3WQRA 1BVRA 1O8CA 3MOIA 4Q3EA 3V1UA 3W8FA 4L76A 2AMFA 5GZ6A 4CJXA 1T2AA 1PJLA 3VVCA 3W4JA 4J7CA 3ZWAA 1QKIA 4KDEA 3O26A 1KBZA 3EVNA 3SX2A 2ZJ0A 2ZTMA 4Z0TA 3JCZA 4A27A 1NAIA 2X9GA 2EG9A 2VQ3A 3U4DA 3MZ0A 2EWMA 2PLAA 1CWUA 3DMTA 4BO9A 3A4VA 1B15A 4IJKA 2VHWA 3F6YA 3PJGA 4LVUA 1HDCA 2P4HX 2X1HA 4XR9A 3PDJA 5IXSA 1P3DA 4CLOA 2YYYA 3FTPA 4IXWA 4IZHA 4HFNA 3G1UA 4WCFB 4GGOA 5JXWA 3EDMA 3K73O 4CQLB 2WYVA 1VJ1A 3L9XA 3DHEA 1ZSVA 3AU9A 2C5EA 2OUIA 3I9OA 3PQEA 1HSOA 2VWHA 3ZH2A 3F9IA 2QZZA 4GKVA 3RI3A 1GTMA 4L8VA 3PJEA 4JLWA 1GZ6A 3PZBA 4Z0HO 4RCVA 1U3WA 1MFZA 2GPTA 1Y8QB 1VKOA 4QO8A 3K30A 2PY6A 4Z3DA 2JD0A 2ZTLA 1A7AA 3ZWVA 3MJCA 4LMRA 2QRJA 5BSEA 1KEPA 2E48A 3KYCB 1O89A 2GLXA 3JD1A 4KDFA 3TDKA 2BH9A 4WASA 4P8RA 2J3HA 4KQWA 1B26A 4FCCA 3WFIA 2BKAA 2GN6A 1M6WA 4E5YA 2GZ2A 3K9QO 4W99A 4MP6A 5BNIA 4E4YA 4DYDA 2EKLA 3GZNB 4IDEA 1T2DA 4OMUA 4NK4A 3U4IA 1NWCA 5FI5A 3BMNA 1Z73A 1VSVA 4J4HA 4PLCA 1Q0LA 3JQ8B 1HETA 4B79A 4FPXA 1DBVO 2BI7A 5H82A 1XLTA 1JWBB 1KEVA 1NP3A 2POQX 2I3AA 1CETA 4KUHA 1PJQA 4IBOA 3FRJA 4OXYA 1A72A 1H6BA 4ZD6A 1YJQA 4D0SA 4FN4A 4LN1A 4MDHA 2X22A 2B5WA 3F1LA 4CM8B 1UJMA 4GWKA 3C24A 3RBVA 1TLTA 2B4TO 2BF7A 2O3JA 1DB3A 2G5CA 3DZGA 4P4LA 2QIOA 1UP6A 2HK8A 2X9NA 3GLQA 3FBGA 1ONPA 1SB9A 5K6AC 5MGBA 5T8KC 5TT1A 1Q1NA 3QIVA 4PN3A 3JQBC 1X13A 1ID1A 2YFQA 4AJLA 2LDBA 5THKA 1ISIA 5ICMA 4YBZA 4XYLA 4J7UA 4FBGA 5B37A 4IINA 1VM6A 4MVJE 4NG5A 2D4AA 4W7IA 4CMEC 3UFXA 5DOVA 3PWKA 3DOJA 3BAZA 3JD4A 2HK7A 2RIRA 5L7WA 1T25A 1QYXA 1A71A 2HJSA 1LUAA 1YQDA 1PSDA 1HDGO 1PGOA 1Y5MA 3PYMA 3QP9A 4HFRA 4HX5A 3OA0A 4BVAA 2O2YA 1C0PA 4E12A 1GUZA 4OKIA 1BWSA 2DLDA 5AOVA 1AGNA 5JSFA 5T6BA 5DCYA 1NASA 3BHIA 3ZWYA 4Z3KA 4PG5A 5EN4A 3H6KA 1SMKA 4O6VA 3U4HA 1V3UA 2FPGA 4XIJA 3KYDB 1J4AA 2Q2WA 3QE3A 4ZN6A 2X9VA 1C0IA 4YJHA 2E4AA 1DFGA 1R0LA 3I9MA 3DONA 5L4LA 4EEXA 1J6UA 4J9UE 3HN2A 2D59A 2OP1A 3H8VA 4TRRA 2NWQA 3FPLA 5I7SA 2XPCA 2A35A 3INTA 3D64A 2PH3A 4J1QA 2CVZA 3WGQA 2NTJA 1U1IA 4B4WA 2VWPA 2QG4A 1EE2A 1ENOA 4RVUA 3X2EA 2O7SA 3G1TA 5TT0A 4M86A 2ZQYA 3WMWA 2GN9A 3FNFA 3EYWA 1LJ8A 4YRDA 4EGFA 1NFQA 4JJGA 3BZUA 2RHRA 1GPJA 4WCDA 3Q11A 1GAEO 4K6CA 3ETEA 2PD6A 3HSKA 1H9BA 3RWBA 1GEGA 1KC3A 4D46A 4E33A 1LSJA 4WEOA 2IZ0A 2R00C 3WMXA 1HDXA 3ANNA 1U8FO 3D5TA 4RQTA 4DQVA 4YJGB 2NVWA 3MJVA 5H83A 1CIVA 1QV7A 3TL3A 7ADHA 2IEBA 5K0ZA 3PWZA 4TZKA 1GUFA 3NUGA 4YJDA 1NYTA 3NTOA 1P1FA 1MP0A 4WLNA 5JCJA 2OXIA 3UGKA 4ESOA 3AOGA 1U28A 4N5MA 4LSWA 1D8AA 4Y6SA 4D42A 4NBUA 4K9DA 1U7HA 1YOVA 3H2ZA 1LLQA 2B0JA 2I3GA 1YL7A 4XGNA 2J6IA 4A73A 3L4BC 1WWKA 5F5NA 1K6JA 5A05A 3TSCA 3UUWA 3H5AA 2DBQA 4DREA 2NVUA 3PHLA 4PZCA 4F6CA 3D3WA 1PR9A 3PFFA 3V2GA 5JFOA 3SC6A 1XGKA 1V6AA 4TZTA 3QRWA 3BMQB 3MJEA 3DQPA 1GV0A 2ZYDA 3UAGA 4UUPA 1V0JA 1FF9A 1K0UA 5IN5A 3IP3A 1MB4A 1ZXLA 3IMFA 3QVOA 1I36A 4CLRB 1AXGA 1YL6A 3AI3A 2YHIB 3PPIA 1U4SA 1Z45A 3KV3O 4J0FA 4XIYA 5KJ6A 3JD0A 4IUYA 3JQ6A 1CRWG 2NVBA 3B1JA 3N58A 3PI7A 3PLRA 4GMGA 4EUHA 5A5EA 5A9RA 3QV1A 3QWBA 1DRUA 1MG0A 1ZMOA 1DC3A 3LYLA 2OOSA 4BGVA 3GHHA 1XHLA 4NIMA 1ZZEA 3RFVA 1DEHA 3QWIA 4X54A 1E3JA 4FD3A 4CM3A 3ZWXA 3RU9A 3NX4A 1E3LA 2HK9A 1PQWA 4RF2A 4OGWA 4YAEA 1CQIA 1M2WA 2HU2A 5J23A 3D3EA 4Y67A 1MGOA 2J3IA 1PIWA 2NU8A 3E5RA 3Q1LA 4AVYA 4J1NA 1FJHA 1RM5A 4UAGA 1SZJG 2ZB4A 3DWFA 5DCWA 1P33A 4FJ1A 5IXYA 3L9WA 1UDBA 5AXBA 5KWEA 4E5MA 3IUPA 1KOLA 3DAFA 3CSDA 4E6PA 4EBFA 1HF3A 3NT4A 3JYNA 1O94A 4PLYA 2PZKA 4BV9A 2VRCD 4BO2A 1EFKA 4OKNA 3GAFA 1PR3A 1T4BA 6ADHA 4ITUA 3EHEA 4HNGA 2VUUA 3VH4A 3WWZA 2EJWA 4AJ4A 3PIDA 3W8DA 1I5RA 3ZW8A 5KJCA 3LF1A 5U9CA 1LTHR 3DO5A 1B8PA 5TC4A 1K3TA 4FSHA 4HBGA 1D7OA 4CUKA 1I3LA 3BMNB 1SOWA 4Q9NA 4CR7A 1ADBA 1JN0A 5EQFA 3RBXA 1FMCA 3OIGA 4HFJA 4BMVA 3VZSA 1ZH8A 3EK2A 3JQ7A 2H5LA 1BMDA 2DC1A 2BGLA 3DMTC 3KUXA 3LLSA 4GKBA 2BI8A 3NTRA 2WD7A 3IL2A 1B16A 1HLPA 3WBBA 4AJOA 1N1EA 4RLHA 4GL4A 1PWXA 1AXEA 1R66A 2Q4BA 4JQCA 3ITKA 2AE1A 1LDYA 2HRZA 1D1TA 3M2TA 3E5MA 3ZW9A 2D5CA 2RHCA 2UDPA 2Y0EA 2WSBA 4YACA 3TZQA 5FWNA 1EVYA 3EVTA 1E77A 4AJIA 3OA2A 1EFLA 2DT5A 1P1IA 3VOSA 4Z6KA 4CUZA 5L3ZA 1ZJZA 4NI5A 5HWSA 1W0CA 4IPTA 1GU7A 3OICA 5LDHA 2EHDA 1H0KA 1XQ1A 3GGPA 4TVOA 4BHTA 1OZAA 4G65A 3GDFA 1UZLA 2Y66A 4BNTA 3C7DB 1PS8A 1SBYA 1B14A 2C82A 3JYOA 5EESA 4XD2A 2I9PA 4E2ZA 1Q7GA 4BNMA 4E5NA 1CDOA 1M67A 4RGBA 4CM9A 3DBHB 3E82A 3TJRA 1NQAO 5TGDA 3I1JA 4NFHA 4R41A 4WLEA 5G0VA 3ZNNA 2DTDA 2B36A 1D3AA 2GASA 3T4XA 2VCYA 4QUKA 1KVRA 3OQ6A 5ENDA 2AQIA 4I9NA 4F3YA 2DBVO 2B83A 4OOFA 3OIDA 4RO0A 3V1YA 3ST7A 1W73A 1HRDA 3R3JA 2DM6A 4CM6A 2NSDA 1S6YA 4B7UA 1DLIA 3KBOA 3WJAA 4FGWA 5L9AA 2DPGA 1JDJA 3PIIA 3L6OO 3WGHA 4R3WA 3LC1O 4A10A 1LRKA 4I5GA 2VZ8A 3U62A 3HN7A 1RPNA
chains in the Genus database with same CATH superfamily
2HLHA 4EO4A 1RKBA 1E7MA 2QVBA 2ZQZA 1GCIA 1Z7BA 4EUNA 4BOYA 4YS6A 4D97A 2HMTA 4PFKA 1LLCA 1OD6A 1OFHA 3CB2A 3DZIA 3L7OA 3NIGB 4HAZA 4QRHA 4YA6A 4D9GA 1BYIA 3G17A 5GONB 2MYTA 5FEMA 3D7KA 4DLKA 2FK7A 3W6ZA 2AXEA 1FP7A 3CZQA 1TU3A 2AJBA 2NO6A 4WZAA 1B3RA 1PT8A 2DXIA 3MXTA 4K9SA 4FHCA 3DZ8A 3ZJYA 3DOHA 5K6TA 1UC9A 4CQLA 3WQHA 2HD4A 5GY7A 3IPYA 5ANRB 4B7CA 3BTUA 2GTHA 4HDQB 5T64A 5CCXA 5E6SA 3VU9A 3AW8A 5KJ1A 1P1RA 4GOJA 3Q8XB 3HB4X 3N7TA 4D45A 1G5IA 2C5AA 2RCNA 1D2AA 4MS4B 4Q9LA 2E2WA 4MZXA 5TQVA 3BMXA 2M1ZA 3HJGA 3PFKA 1G2QA 3D7NA 3PQ8A 4Y9UA 1D6SA 3SQMA 1QPBA 3DBOB 3MTBA 2O0KA 3SJ7A 1X7XB 2GHQA 3HDJA 2BBOA 4PZZA 5DLDA 3I6YA 3U48A 4FDLA 1NBEA 3NC0C 4BN4A 1PZNA 4TKVB 3RVMA 5C7IO 1DO2A 5FA8A 3ZTYA 4CCSA 3DM9B 3PTZA 4KBYA 2IYLD 1RIFA 1NBWB 3FR8A 3H3JA 1FFXA 3LTEA 5J4VA 1PD1A 2CNWD 4KPUA 3BK7A 5K8TA 1E6KA 5IW8A 3HRIA 3U39A 4BFLA 3ZE6A 4TRMA 3K09A 1G3RA 5KMGB 2HLPA 5TJHA 1EGAA 2X5KO 2ZJ1A 2VJOA 4CDMA 4EJSB 2BFEA 2WTNA 5GM2A 2FY8A 2QPAA 2QL6A 2QA5A 2D1RA 2XADA 4F3RA 3WSWA 4ZYWA 2IXBA 2A8YA 1WS6A 4PX3A 4LYHA 5AM5A 1KGDA 2PX0A 4I2NA 3ZXSA 3OE7D 2VYVA 3HXQA 4GGMX 1USGA 4DJ5X 3B7WA 4U7TB 3I45A 3W77A 1T26A 2A5GA 5K3BA 1DBPA 3K92A 4XQCA 1OC2A 1W2WB 2BGJA 2J46A 1W0KA 1ZUIA 2ZJ5A 3PWTA 4ND4A 4ARSA 4EPYA 5KU1A 4DQUA 5LOVF 3D4LA 4OHYA 4I5FA 5HILA 2OQVA 1RJWA 2R4QA 1XCPA 1PG0A 3UHOA 3DEZA 3E7DA 4GH5A 3NXKA 1LS1A 3B7PA 3DAYA 4QQRA 5K8IA 2QN7A 3GAZA 3U7QA 2G5GX 4OHRA 1ZCAA 5I45A 5EIFA 2V9CA 3NRJA 3QLTA 5JC8A 1KQGA 3BKXA 3QLUC 1CZOA 3BWMA 4ZO7A 2R68A 4LFCB 3CISA 5BR8B 3H1BA 3IUSA 1F8UA 3N86A 4PONA 1KJYA 3GJ5A 3T99A 1CQIB 1U28C 1WAMA 2C4UA 2ZP1A 3VO9A 3I3OA 3QFSA 2EL7A 3EAQA 2IVFA 2DQYA 3EZFA 4UASA 3K4HA 1F7VA 3DB1A 1E1LA 2NU8B 4GS5A 4PCUA 1Y7TA 4B4OA 2D62A 4DCUA 2CJYA 5K0GA 5L3SA 2JAOA 2D3TA 1DJLA 4XW2A 3TMAA 4H60A 1JA9A 3OUZA 5D3KA 1BWPA 4WFQA 3K0HA 3S8EA 2DFNA 2X77A 1FA9A 4L72A 3RSZA 3KWJA 4KRFA 4ZPXA 1IATA 3AUTA 3BD7A 4M8SA 1KZHA 3A9TA 4WLOA 3OIFA 5EJ4A 5KYYA 5LZ9A 1KEEA 3BG5A 3Q8MA 2QTAA 1HYBA 3DQQA 4AS2A 1VPLA 4I6JA 1VCHA 4J94A 1NR1A 5D7BA 3AUFA 5DDIP 3TPZA 3ZNPA 1FP2A 4N3BA 2GKSA 1EJ0A 1PCXA 2DZDA 4I9FA 2CKMA 2XYPA 1FFEA 4LVOA 5B12A 4KNYA 1E7WA 1A0OA 5DHTA 4HXEB 4QEDA 4G0YA 1G4AE 2GR9A 1PUJA 3NHBA 2WJIA 2JLXA 3V55A 1AUXA 5IKEA 5AQ1A 4DNOA 2J0SA 3KEGA 4JLAA 4MJ7A 4REQA 5JUWA 2IWRA 4ZVKA 1JWLA 2FE1A 2FEXA 2V55B 1LNQA 4BQSA 2F62A 1NPYA 3BJMA 3DNMA 3VR4A 2QTMA 2WJPA 3NT2A 1J22A 3DCIA 3EULA 4PG8A 4QTUB 5AJHA 3ZQJA 3FLEA 3JQEA 1N7HA 3DOOA 2AFIA 3LGAA 2X8JB 4UCXA 5BRAA 1FVHA 3BXFA 1T0PA 1F1JA 4NE9A 3IP6A 3NASA 4HX9A 4YJ2F 1X7HA 3OSZA 3ZV5A 2XB8A 2WT9A 4IDFA 4Z1MA 2C42A 5F3RA 2GM9A 2J5QA 5JTTA 2BMDA 3ZBPA 4Y0AA 4NARA 1LC3A 2HHLA 5AKGA 2X42A 4C06A 3U3DA 4N41A 3QJYA 1NJSA 1N77A 4G5RA 2IU0A 4D9EA 1BCSB 3B3JA 5BWMA 2OHJA 4L57A 1UQRA 3OOSA 4QBIA 2NVOA 4F71A 2ZRNA 4YJGA 4A1OA 2JIPA 4YP6A 1FX0A 3V4LA 1GHTA 3TTTA 1E1CB 1N32B 4ZQFA 1EFPB 1MQAA 1TT7A 1BS1A 2GERA 3OJOA 1KP3A 2H1RA 3TLEA 1YR3A 5BPHA 5C7OO 1F9AA 2B4AA 2WWXA 1OVMA 3QVXA 4L0MA 5JHGB 3LU1A 1XTJA 1PJSA 2C7RA 121PA 2I6TA 1Z3IX 3NBZC 1AGRA 3KDAA 4PLVA 5GM1A 1G18A 4YQYA 3T3HA 3U0VA 4DAEA 3GFVA 4YRRA 1GLGA 4JBWA 1Z33A 4WESB 4DANA 5JYDA 1WMBA 3U1VA 2FSGA 3AP3A 1X7GA 2NU6A 3VPBA 1Q0SA 5KO2A 3BXZA 1CVLA 4G84A 3OC6A 4XOUA 3W1EA 5EMNA 1O0CA 3GEMA 3ESXA 3DLIA 4LOKA 2WWVD 5JSQA 4DIKA 1CT9A 4WOKA 3AGPA 2XCSB 3FHTA 2YY7A 4G0NA 4PIPA 4ER6A 1MB0A 1HURA 2BKUA 2I34A 5FOVA 1JDTA 2VP4A 2WLSA 4FWBA 4TLLB 4Y1RB 4DM4A 4W5HA 3UJAA 3ZE8A 4RTNA 1FVFA 2OMEA 3RU3A 3BICA 5AJYA 3ZLUA 6GPBA 3O8QB 3NUZA 4H15A 4L85A 4A4DA 2NN3C 5DI3B 4E0BA 1MF7A 1D07A 2VJBA 3L7NA 4KLRA 3D43A 1SWVA 2EXXA 2GI4A 3IIEA 1EEXB 4BQEA 1E4YA 3R8FA 1MOZA 2VTBA 1Y3FE 1P7CA 4P86A 3GCZA 1OYVA 4FQ8A 3OPXA 4KOEC 3MC1A 3CF6R 3E3MA 2H65A 4UKDA 3O8CA 3A7DA 4XJSA 5C80A 1M74A 3HWSA 4I3FA 2UVPA 3EN0A 3O8OB 3QVVA 4URUR 4QSHA 5KTMA 1DMRA 1AN9A 1QE3A 1U7UA 3EPRA 1KO7A 3WOVA 3CH4B 3AV3A 3R44A 3LE8A 4JC0A 2EHJA 2G7ZA 4CLXA 1VGQA 1S02A 2FU5C 3C14C 3G2QA 1PJRA 5KNBH 1F2VA 1EFAA 3TL2A 1K3FA 1C41A 5JT1A 2KHZA 3TCKA 3A3KA 2VDQB 3PPVA 3GGCA 1NY6A 1KY4A 1IYZA 4TMZA 1U6JA 1QR2A 4NABA 1UEXC 3TTVA 1ZMTA 1TDJA 4OP1A 2G72A 4F1JA 2JA1A 3MAAC 2W6ID 5JASA 1U2QA 2WIAA 2I2WA 5F1PA 1RI4A 1U5CA 2ZBPA 3C8MA 3CC8A 4TTSA 1XU9A 2AWNA 3W2FA 4ZHQB 1XJCA 4QSMA 3LDAA 3BE5A 2VKTA 3GNTA 2LE0A 3DV0A 2C7QA 4QT0A 4DY6A 3RAPR 5CVJA 4R3NA 1YBMA 3VHXB 3H9BA 3O73A 1DOAA 3GFFA 2CXRA 4NZPA 3P96A 4CZ2A 2F8MA 1I7QB 3BQNB 4KPYA 4TYWA 3F6RA 1XF9A 4OMCA 2GZHA 2HQSA 4OX9B 2Q0HA 4BQQA 1KIFA 5CEFA 4LZPA 1KZ4A 2PV0A 2HEIA 4TWIA 1TF2A 1TUEA 1AS2A 2Z58A 4D3DA 1U2DA 3GEDA 4ALNA 4KR3A 3MK31 4G4GA 4P92A 1YE8A 1HTTA 1HEYA 4GR5A 3VU8A 9ATCA 5KJFA 1XXHE 3HDQA 3EWAA 4ZJZA 4HMOA 1QH0A 3GIDA 3OBBA 1BYUA 4C4ZA 1HFJA 2Z6VA 3BX1A 3CLSD 2E85A 2IU3A 2NYVA 3AF5A 4LY9A 4ZQEA 5FBRB 2P7HA 4HQFA 1K5GA 2P9QA 3EMBA 2FG6C 2DPMA 5CAEB 1EDDA 3KJIA 2CBXA 2JGMA 4UFPA 3IBSA 1JJFA 3ZWDA 1DKLA 4D8UA 4NBLA 4HMPA 1ISSA 1SXGA 1NJ2A 1BN6A 1ZD8A 3OU7A 3ET5A 2RKBA 4A8JA 5ICSA 3AM3A 4DDTA 1XRJA 4WNIA 5KPJA 2Q4OA 1FYDA 1YK0A 3HS3A 4FFBB 3PJDA 4HGRA 2CFTA 4QVGA 3LX6A 3IDQA 4FOLA 4MHOA 4E88A 2H2FA 3KT6A 5DYNA 3Q7TA 4RGVA 1HR0B 2EX0A 2W8ZA 5HFNA 2EDAA 4US2R 1Z4KA 2DP4E 5AHOA 3ONWA 4HAUA 1C3VA 1SCUA 5JBQA 2WPNA 2YVQA 4G9BA 5BV2P 3WYCA 3LBNA 4MVJG 1DNPA 4BMYA 1GZUA 1OTHA 4BNGA 4MUYA 3CNQS 5E6RA 4YECA 4UCFA 1LK0A 2PFKA 3MVEA 4W9MC 2OSBA 2IE0A 3GT0A 3FM9A 4F4JA 3NVKI 4QLAA 3QVUA 2BZGA 1RYZA 3VNVA 1U2GC 2B8NA 2R751 1LSSA 1SIOA 1L2TA 1H85A 2A9QA 2QRGA 3P9ZA 2HCBA 3Q85A 3PQ4A 3U49A 5IBPA 3GARA 1UL1X 5A1JA 2OWDA 3B89A 1X6VA 3RUAA 1ACJA 2PU5A 1FP4B 3HXLA 4OQXA 4EHJA 4B3RB 1QNLA 1GYQA 2ZI9A 3ADKA 4QHSA 3VKFA 3HKCA 3HI4A 1EK0A 4JQSA 4U5XA 4R9UC 4YMVA 2OENG 3RYHA 1AC5A 2J0VA 4HPJB 5BV1A 3BSYA 3R40A 3KPYA 4MR7A 1JAXA 4C3UA 3HL0A 2PLWA 3OEWA 4UUQA 3VR6H 1SZCA 2MTBA 2CL7X 3FWKA 4LCEA 2JG3A 1BA2A 2XNKA 4MZDA 3CE9A 4DMRA 4AF7A 1QHYA 1MZPA 2IOQA 4A7PA 4D43A 3FKSA 1H69A 4JVLA 3GFSA 1P18A 1PL8A 1EFUA 3IH5A 3K6RA 5EJAA 2AV6A 3STHA 1KDPA 1YV9A 2QW1A 3R3ZA 2CLHB 5I7FA 2JCVA 1H6AA 1SUDA 1RVV1 3GVXA 1CS4C 2M6KA 2PRJA 1M1NB 2J4FA 4NCAA 1TZ2A 2I1QA 4IHKA 4C7OB 5BORA 2NG1A 3G0OA 4PLFA 3WMFA 3N59A 1CR6A 5DFAA 5ECYA 2X0EA 5KWSA 4DLBA 4A15A 3H0EA 3RU2A 4LV6A 5CW1A 5CIYA 4BMDA 4C6HA 1UP4A 5HJ5A 3H87A 2X0NA 4O4HB 5AICA 2XF2A 5IUNC 1Y8AA 2QN8A 4FI3F 2JK0A 3MG9A 4TV9B 4OBWA 3ET4A 1U0JA 1ZN8A 1O9GA 4DLUA 3AESA 4WKBA 3TLZA 1OI7A 3UA3A 4IGEA 5C5IA 1JJAA 2X9LA 4LPKA 4RPKA 2DLCX 3ELDA 1BMQA 2UXBB 5FPYA 4E32A 4MWZA 1X1DA 4MS4A 2RHGB 3F0TA 4GKKB 1UBMS 1UAGA 1X14A 2Q1WA 2JVJA 4FX5A 5C1IA 1B4DA 1RJGA 2V0NA 2V7TA 4UAJA 1ZD2P 3AVWA 2I62A 2BI4A 2CXUA 1FS6A 2HMSA 4KWIA 4Z7OB 2YJ3A 1X7XA 1WQ3A 4M9XA 4GNRA 1RM3A 3KUKA 3WL8A 2FMUA 3TNLA 3W9UA 3KALA 5C5EA 3BMOA 4PTYA 1WCXA 4R81A 1KS9A 1SBNE 1S9DA 1WG8A 3Q5GA 4A82A 3QQPA 4TKVA 4O0LA 5KCMA 4E3ZA 1J0DA 3WZMA 5CFLA 5JAPA 1QRUA 4LXQA 2VS1A 3GLIE 1TA0A 2C2YA 1KZ9A 1A9TA 3G02A 3NAZA 5FKJA 4WY2A 2AS0A 2G6BA 3D4BA 1O0SA 4KDRA 5TMBA 2QIPA 3FLAA 3TOXA 3KE8A 2IZZA 3RB8A 4AP9A 3L07A 3UBMA 1C2TA 2ZWMA 2B3DA 5HFAA 5KMGA 1O6CA 3CKMA 3TE6A 3KB8A 3BIJA 4EJSA 1A8PA 1KEWA 1VCOA 3Q2IA 4P3OA 3JYQA 2YJTD 1NVDA 4Q3OA 1PO7A 2CDBA 5DB4A 5H70A 5KB3A 3MJSA 1MOPA 4OIMA 1W2HA 3ZVLA 1LQUA 4Q4CA 1IHDA 3WO1A 1ZW6A 3IAXA 3BSSA 4WGGA 1E9RA 5HR5A 3MXOA 4R8MA 5CIWA 2OXTA 4EW2A 2XKKA 4GM1A 3AT1A 3GLGE 1ZKMA 4F2PA 3DDSA 4WUTA 3WQQA 1Q22A 2I7XA 3RNLA 1J9EA 2Q9CA 3ABSB 5JJ5A 3SVLA 4ZRNA 4C5BA 1SXJB 5JD4A 1I2MA 3QUTA 3L7CA 1OBVA 3K9FC 3T9DA 1RJFA 3N75A 4L9RA 1NN5A 3U1BA 1PL0A 5JCZA 3I2YX 3NGXA 3C5VA 1UXJA 1U9IA 2XMQA 2CHUA 3MWGA 5HKKA 1XD2B 2R7AA 1OLSB 4RNDB 1SUFA 4N7BA 2GXSA 4WLFA 1BN7A 1VPEA 3G2MA 1LPOA 1JQKA 3QE2A 3QVSA 2FLWA 2PX6A 3TQTA 4CDGA 2WM3A 1UBGA 3PC8C 3AVVA 3PEYA 2WDZA 4JYMA 2YZ7A 1B43A 3QKRB 4P9NA 3IEKA 4PTLA 2YV5A 2YV4A 3C6MA 2GYYA 2IWHA 3PDHA 3RSGA 5F73A 4FJ0A 4PO1A 5JJLA 2B92A 1SNYA 4EPXA 2WNIA 3NNSA 4Q3NA 2VDJA 3EZXA 1SCKA 1CUDA 4UHHA 4QVIA 4IM7A 1LW6E 1IM5A 3I2GA 3S27A 4CKEB 1J2UA 5IANA 3ITEA 2GZ1A 5FOTA 1ODTC 2K6GA 4RY0A 4EDFA 3DZCA 2R2GA 4KITB 1J8MF 1SUCA 2CUTA 2XWBF 4EF6A 4GX0A 5SZIA 1MQSA 3W2IA 3ZI7A 3SM3A 5K99A 2B2NA 2B8TA 1TCBA 3R7AA 3H18A 3PVZA 1IMJA 3LCJA 2FW7A 4PNHA 4O4LB 2LR0A 3FN4A 3R4CA 4ZQCB 5IABA 4AN4A 1V47A 1CJCA 1SFRA 2IUEA 4DC0A 4KP7A 1NA5A 2PRSA 1CYDA 3GQVA 3KB2A 3HWX1 1U81A 4TTAA 4WKOA 4JBNA 4BNWA 3WGGA 4EJ0A 2CMGA 3GA7A 4NR0A 3SGLA 3W6PA 1SGWA 4MPRA 3VRHA 2NMVA 1FFYA 2KYRA 2OD9A 2WB2A 4X1OA 3AVUA 2X8JA 2HRBA 5DNEA 4S0ZA 4UVHA 4MA0A 4XDGA 5ALJA 4DLPA 2I2BA 2ZSIA 4RD3A 4G0XA 4FWIB 4YCJA 5MN6A 4YRNA 4JBGA 1Y1QA 2CLFB 1F38A 3CRW1 4AB1A 4N48A 5DGHA 5AVSA 1ANKA 3ZOKA 5KYTA 4JHXA 1RE1A 1WUHS 3LQQA 4Q15A 4RS3A 3PLNA 4EW1A 3PJRA 1I24A 2DJ5A 3L84A 1M73E 1RRVA 4H7KA 1BCSA 3GX1A 2BISA 4IXMA 3M6VA 4DMKA 2B69A 3JRNA 4FMPA 4U6SA 2HX1A 5KWIA 1LEHA 1DC5A 1QP8A 4XUDA 1AZWA 4Q3AA 3RUIA 3U6BA 2ZBRA 3FDJA 1XD9A 2YC2C 3GVCA 3WBFA 4MUBA 1ZLXA 3QG1A 1I33A 2LPMA 1DXOA 1EFPA 1OX6A 2GPNA 2PPVA 5F21A 3KM0A 3ZCXA 1USWA 3T1OA 5BSKA 3HFGA 3M9XA 1V4NA 4AZ0B 1E5VA 5AT1A 5J2UB 1ZI6A 2WKPA 1QQBA 1JAZA 3L77A 4EF5A 2ZUBA 4BX9A 1L5OA 4E51A 1B8OA 4PSKA 4Q24A 3BREA 4YBRA 4UU1A 4WESA 1ZOLA 3JVEA 1IN1A 1E2EA 3L7YA 4URYR 5UKDA 1TC1A 1X1CA 2PEZA 2QYOA 3EC2A 3ECSA 3ENNA 4OXQA 1MO3A 3V7FA 4MS1B 3H7AA 4ZXPA 1DC6A 2ODPA 3HDHA 2P8JA 4COOA 1F14A 4YRBA 1XP8A 3AJ9A 3Q9LA 3DNPA 221PA 3IELA 3M6FA 2XI4A 3NG1A 4OA8A 4U9HS 4EJ6A 4UOEA 3WGIA 2Q3CA 3EZ6A 4EMBA 2G83A 4ZO4A 1B2LA 3T61A 2CWWA 2OFOA 1A9XA 3O8QA 1XDDA 4MP3A 4TQ9A 1MW9X 3AF4A 3AHCA 4TV8B 3WB2A 1Z5OA 5ALZA 3ZY6A 5JXJA 3H9JA 3SEQA 2JGAA 1J1ZA 5I7OA 5K05A 1JA0A 2ORIA 5FL7A 1GG2A 2DKOA 2VATA 4HLDA 1OHHD 5G1OA 1MD9A 4DSAA 1UKVY 1OH6A 2OBNA 13PKA 1TRKA 1DC7A 2VYNA 3T5BA 2WJJA 4WXYB 2FW1A 2P5UA 1IPFA 5TRTA 1XZJA 1Z0SA 3PS9A 5JS2A 3SF0A 1LPNA 2E37A 4DPLA 4Y2YA 3O84A 3AIIA 4IDPA 4EX7A 3HA3A 3ZK8A 1ZP6A 2OHXA 1M2OB 2PUWA 4UXIA 1U63A 2VOJA 2H18A 1G8YA 1GT6A 3A6HA 4PANA 3DZKA 2RHHA 4CIWA 4BS9A 2W7TA 3VTAA 3B5IA 3MRVA 1AMOA 2WDPA 4IZIA 3GMIA 1LF0A 1GYRA 3MT9A 4HOYA 1P4JA 3JQAA 4J4BA 4OI4A 4OQFA 4D9IA 4ZFNA 1U02A 1RZVA 1W46A 4OK6A 2ODEA 1OTXA 1XTTA 2YW9A 5CGZA 4OHMA 1SEPA 4MO9A 3G68A 3ICCA 4A0FA 4C22A 3H86A 4ABTA 1BOOA 3C4QA 2IH2A 4YWJA 3H1EA 1G7RA 1Y6QA 4PYLA 1RLJA 5A03A 1KAQA 1QV9A 2FLKA 2FRVA 1U0EA 3DE0X 4NMXB 1V39A 2O1EA 3NP7A 3K70D 1GL9B 3Q3CA 4ZYVA 1CYEA 2EKQA 3ZG6A 2HNKA 3QIAA 2R8PA 1TYBE 2QRUA 4PLTA 4YRTA 1J70A 1CR0A 3JALB 3QW4B 3KS9A 3SYMA 4A92A 4C4TA 5GZ1A 2EOAA 1V1JA 4DTIA 4ASUA 3A6GA 2ZDQA 4HDMB 1THGA 1RHJA 2V45A 2R47A 3EW7A 1NHWA 1ZS9A 4FDUA 5CR9A 1BVUA 3ZNQA 1BGWA 3C4VA 3OFSA 3WX0A 2QM8A 4YCNA 3IVGA 4LRYA 3EVZA 4E07A 3RVDA 2VYQA 3RJMA 1JS1X 5JAZA 3ICWA 1T0HB 2ZSDA 3JZAA 5B30A 3I4CA 2PKXA 5IH3A 2EFDB 4Q37A 4IXTA 4YGYA 1L5YA 2IYFA 3A9SA 1OY1A 3ETDA 4BFSA 1JU4A 3BXPA 5J5VA 1KRXA 3CGWA 2VBFA 3AG6A 1UXIA 1FZQA 3JAWA 2UUPA 1NMYA 3O93A 4HEA1 3CVJA 3P2IA 1TGVA 1VPTA 3FWPA 3SHQA 5ADHA 1Q19A 2XMGA 5K3EA 3WGVA 4GWGA 3WK5A 2XYQA 1DPGA 3EZ2A 4PLZA 1AKUA 2PNFA 5ENVA 3RG8A 1QHNA 3GMSA 5HCUA 3HPQA 4DR6B 3A4NA 621PA 2PXCA 3USZA 3GFGA 4FFBA 3W0LB 5TF4A 3UKOA 3C48A 1ZUNA 4FNOA 1F8XA 1RCFA 2QD1A 2Q50A 3UAZA 1YRBA 1LDGA 1W0JD 4JDUA 4NU0A 3DMHA 5BWCA 2QN6A 2YQ4A 2PGAA 5JSZB 1DUSA 1OC4A 3ZE2B 3E22A 1ISMA 5JANA 3CS3A 1J90A 4DNFA 3GEHA 5LQJA 1FRZA 2IZ6A 2ZKLA 3IDFA 3MT7A 5JAOA 3A1VA 1D6JA 2WUWE 1SXJE 4B8ZA 4BP3A 1AD2A 4IJUA 4FP9A 4B6FA 1E3MA 1G1MA 1UP7A 2R5NA 3AZPA 2V6BA 2VJPA 4EUFA 1UPBA 1OAOA 1V8FA 2O2JA 2YWCA 4MULA 4NPAA 1U04A 5B1IA 5BVGB 3QPCA 3ZGZA 2X6TA 3DDWA 1W4CA 2B35A 3CUWA 4IY1A 1B8VA 4FR5A 2AF4C 4HYQA 1X1TA 5E1BA 3BC1A 2XTZA 2CD9A 1WZ2A 1II9A 3VPSA 2X5NA 2CYCA 1H6DA 1TEXA 4DMLA 3X1KA 3RIEA 2UZIR 4R0VA 3UAOA 4FYWA 3AVTA 1FP4A 2R8ZA 2RGAA 3WLAA 4BGEA 2R8EA 1O97D 1S2DA 3SBOA 3CF4A 2YV3A 5C1OA 2WAXA 3VO8A 4GM4A 4LC9A 3PA6A 2DE0X 2E55A 2VAXA 4QECA 5FTKA 2EW8A 1VRWA 3WC4A 1XTKA 3FMIA 3TNJA 4DNPA 3HXTA 3ZZTA 4QJ3A 1WRBA 3IO5A 4C4YA 3PHJA 3KPWA 5G40A 5LLSA 1DBWA 3JQFA 4AN1A 4BP1A 5JY6A 3WBKA 1OBFO 2Y1EA 3DFZA 3K72B 1XVLA 4UUAA 1CUEA 5AM0A 2WAOA 1CZRA 2Y99A 4OIFA 4Z86A 3PX7A 2NZYA 5DRTA 1VJRA 2O2ZA 1ABEA 1YZVA 1EGHA 2G0AA 2LWIA 3HJRA 3I6MA 2H08A 3F3MA 2VSXA 1T8UA 1Q16A 1QHEA 4LOIA 1WV0A 2YCLA 4CQJA 3ZI4A 4Z7JA 5JWRA 3UMYA 4IUBS 1IG0A 4M1KA 3AM1A 1A3CA 3PHGA 1ZEJA 2LDXA 3NBUA 1XKQA 4GBJA 4CF5A 4DIMA 5LFAA 1XBTA 1M1NA 4XB1A 4C7OA 2ZUUA 5HRAA 3FCYA 1CY1A 2WUGA 1H1LB 1KO1A 5ALMA 3JX9A 5DWQA 1EDOA 1XMPA 4ED9A 5I9LA 2JKVA 3CR3C 3C3XA 1P60A 2PGDA 1GQSA 4U2GA 2BMVA 5KTSA 4ILKA 3CLSC 4GYKA 1GT91 4F92B 3RYIB 1JPJA 3DQZA 3HA7A 2O1SA 2YNMD 1GRVA 1DWUA 4ENPA 2A92A 2X8LA 3ICOA 4GU5A 5AD1A 2VDVE 4NAVA 2DUNA 4TV9A 2NUAB 3RTEA 3WDSA 4AUNA 3GFRA 3T3DA 3EFHA 4F4CA 2RD2A 1PVDA 3LLUA 3S5JA 1ZM4A 3V9AA 1OASA 4A2CA 5GOZA 2MSCB 3QPBA 2BBWA 1YUMA 2ZE5A 8LDHA 3P0RA 2KWIA 4HVLA 3TVYA 5BWLA 2Y1XA 2JJ1A 2VXOA 2OHHA 5TSDA 4HDKB 1BMFD 1WZNA 2R44A 1QIKA 1ZN2A 1GZ4A 1I10A 1ZINA 4B2PA 3V33A 2QM3A 4MUMA 1UINA 2WAMA 2CJPA 5FUXA 1RMQA 5IFLA 3C4JA 3SKXA 3V34A 4ZTBA 3AY0A 2BDTA 5K8CA 3ICEA 4GLJA 3UJ3X 1JF8A 2PT6A 2HPVA 3I37X 2QD3A 2WZQA 2WF9A 2IW3A 3A8TA 3G23A 1FC0A 2YFHA 5A4MS 2GD1O 2QX4A 3T1TA 4Q9JA 1VKRA 1TF5A 2R4UA 1GVNB 2WF6A 5JXGA 1Z8NA 3RHZA 1I0ZA 1THMA 1IPEA 3SR4A 4UFNA 1RADA 3EUWA 4XLZA 3RF6A 1QHIA 3NWBA 1ZSYA 2PS1A 1NLUA 2EQ5A 2NZ8A 4GPIB 3M6MD 4A2WA 2DETA 1EX9A 1QQ7A 4DNXA 2HZ7A 2HN9A 4PZUA 5ARBA 4O59O 3R09A 3INYA 3LWZA 1QK3A 1Z7YA 1X80B 2B4QA 2JIZD 4A5SA 1EK6A 1C9DB 3BYZA 3H16A 4RQAA 4LDQA 4PZ9A 1TXGA 1CG6A 1S2IA 5IEBA 2WMYA 1T2EA 5A0VA 3N1UA 2AC4A 4E22A 1WTCA 3P2YA 2ZRDA 4QU9A 1VHTA 1DOHA 3ZCVA 3LXUX 3HHEA 4B3DA 1XWFA 3E3AA 5G0SA 2J3DA 4INPA 1KERA 4NF2A 2BFWA 5IWAB 3K8ZA 3CSUA 2G1JA 1XLVA 5AXCA 4YMWA 4ZAGA 4Z54A 4AMBA 4KUEA 1AA6A 2UVQA 4P3XA 5BQFA 1FFHA 2X5JO 2VK4A 3PX2A 2PSSA 5B6IA 1S2MA 1FB5A 3KQTA 4NYIR 1EVIA 3CBGA 1XZCA 3ORHA 1XD2A 2EGGA 3DJFA 1IAQA 3ZC3A 2QI9F 3C41J 4I1PA 1XN4A 5F12A 2AG6A 3CZCA 3DVAA 4EJMA 1SHJA 2JHFA 4PM4A 1AO3A 1DRJA 1IBCA 2IOFA 5TB5A 1E99A 3AR5A 2GAJA 3QUBA 4M9QA 5LA6B 4MR8A 3ZD6A 2Y9MB 3LY5A 3OIUA 4AO6A 1NOJA 1DJPA 3JWPA 3MIZA 1HDRA 1LLFA 4GF5A 2Z1NA 1ZJWA 1YR1A 2DULA 4RANA 3BERA 3GLVA 5LNK6 5F9FA 2A78A 4JCOA 5TS3A 3AL3A 2NPFA 3DYIA 1TEHA 1E1KA 1EX6A 4UMEA 5LC1A 3I2JA 4M7WA 2BGRA 3ML1A 2CDRA 3W1VA 3D8HA 2X5OA 4AMUA 2O59A 1BIFA 4NOKA 4MUEA 1PJCA 5KJEA 4BNXA 5HCNA 1F12A 4CKEA 2HJRA 2KBEA 3S2UA 2QVXX 3X1XA 1PFWA 5ALPA 5A3RA 3RSHA 3CUVA 2B2CA 5BXYA 1SU8A 1BOFA 7AT1A 1D6NA 1M0TA 2GBIA 1DIAA 3JQGB 3MD9A 3EEBA 4URWR 1MJ5A 1CLEA 1TECE 4IZ6A 1WMEA 4L4XA 3QOYA 4FLMA 1VB3A 2OV6A 2OG1A 2QYTA 1GUYA 2V0CA 3RARA 3PUXA 1EFTA 2A88A 2O5VA 2Q07A 3BWCA 4FBLA 4I5EA 5KYNA 3LOPA 3QOFA 2Z9DA 3WLKX 1VJ0A 1MA0A 1UBOS 2ZRJA 3VH1A 2VVTA 5EG5A 1PDWA 1V95A 1WPXA 5K8VA 1NPTO 5KQMA 4UTNA 4MVJD 1T3LA 4DJEC 4FOOA 3ZHCA 2BELA 2W83A 3SS9X 3O4HA 2Z4SA 3N7AA 1DAFA 3LS2A 2K5UA 1Y63A 2F8TA 3IS3A 2C9CA 3FPJA 1QMPA 1SUAA 1MTOA 4OJYA 3MLBA 1JFTA 1WCV1 1E6WA 4YDRA 3RRYA 2W4MA 2O20A 2VNAA 3GQBB 2QENA 4G25A 1YRWA 1EUQA 4UZSA 2ERCA 1VBMA 5BSUA 1BVYF 4H3VA 1NUHA 1CBUA 4I1IA 4YUWA 2RGBA 3HYNA 3SKYA 1E1NA 2F2TA 2HDWA 4RKFA 4BO6A 4JBYA 2OFWA 3GEIA 2QYSA 4LZNA 1NLFA 4RDHA 3K2EA 2ARKA 2WSSD 1YB1A 2I6UA 2N42A 4PX2A 2PU7A 4Q1AA 4QYXA 4ZHSA 5EQDA 4ME6A 4FN5A 1YDWA 1FSPA 1E2MA 2J7PD 1DQSA 1D03A 2OFFA 4CYMA 1F06A 1K7XB 1UDAA 2Q5JA 4MXDA 2R3SA 1OX4B 4ERXA 2WU0A 4RE6A 1O08A 3A06A 3Q41A 3Q7RA 1UIMA 4DMGA 1J2JA 1XRSB 3G6KA 4O4IA 1WUIS 1GPWB 1L5WA 4ZOAA 3WIVA 4AZ0A 4DLRA 5J2UA 1X94A 3DLTA 4JY7A 1R4AA 2YQZA 3GG2A 2XLCA 4G09A 2QU7A 2W4QA 1Y0BA 1G0NA 4N0EA 4L4SA 1A9ZA 1LI4A 1X87A 2WHYA 3FHCB 3R6WA 1TVMA 3TEMA 5T5QA 2IPOA 2HT1A 5JO0A 1JG6A 6CHYA 4TKLA 4NYJR 2J87A 4H6VA 4C5AA 1S1CA 3NEJA 1N3IA 2I78A 3EMKA 1DI0A 2Z43A 1MV5A 3DKRA 2OYCA 5EIXA 4MS1A 3GB9A 5LMUB 2A33A 3MAJA 4KXFB 3F6EX 4QUIA 4L8LA 5DLEA 3A58B 3H4TA 1D8TA 1P3Y1 3REQB 2ACWA 1HNXB 2OV1A 4NFLA 1G55A 3N05A 3V2HA 2YV2A 1JR6A 2UXDB 1FSFA 4JWKA 3OJEA 2HBRA 4MQEB 5FJJA 3QFCA 3RC1A 4DQXA 3B38A 3I9KA 3EVGA 4CN8A 1CU1A 2I76A 4OHOA 4E5PA 4JLJA 1P3JA 4NWIA 2WD8A 3R75A 1GPUA 1CIPA 2XUQA 3QI2A 4PINA 5PNTA 4QOHA 4ZMBA 1WP4A 1L7XA 3D3KA 3SZMA 4D81A 4ZJPA 2CLDX 3UJDA 3QHAA 1E2PA 3URMA 3PGLA 3GLKA 4LXIA 2O2XA 2R4TA 2DEUA 5BSRA 4JHLA 4AJHA 4AKGA 1JQDA 4ARZB 4RK5A 1FJXA 3V6MA 2I6GA 3DXXA 4C43A 5K0CA 2PMCA 4I1UA 2UYGA 3DE1X 5GVSA 3OTIA 2WJ4A 3RIGA 2HU7A 3LMKA 3FCEA 1NP7A 3ZJTA 2Z8XA 2ZYRA 2RI1A 1VBKA 5TNXA 3W4IA 1Z13A 2NQTA 4OXRA 4NVRA 1NZJA 5K3AA 2OORC 3E9CA 3HNPA 1JI0A 1LZKA 5JAMA 4KGZA 2WEKA 3ZU4A 3OEHD 3OSUA 4BIIA 2GF9A 5DN6A 5JRDS 3ASZA 5SZKB 3WGOA 1R1DA 5BYKA 4X64B 1YBFA 2BUCA 4FNMA 2ANCA 1JJVA 4G6ZA 4Q9DA 3RW9A 4BECA 2DWOA 4W5RA 5LKAA 3QX3A 3ADOA 2WC1A 1KHTA 3F3KA 4YK7A 3WGZA 1UMCB 1JHRA 4P4TA 1JG7A 3V46A 4LDZA 3GRPA 3ODGA 3UC9A 1QGYA 2VTEA 2R0QC 4CNQA 1ZGCA 1S2LA 1KYZA 4L0QA 4J3JA 5EJMA 3G5AA 4OH7A 4LRSB 4HDMA 5M29A 3R6GA 2PCLA 3MS4A 4N5NA 5IBQA 4TV9F 1QHXA 1T1IA 3O82A 4TTIA 2HLDD 1U0GA 4DE5A 4E1VA 4JP1A 5BN1A 5LMCA 2O8EB 2P8SA 2VBCA 2XA1A 1Q50A 4KO3S 4OQ4A 3TOZA 1YT5A 2QJRA 3ZK9A 4CQMD 2AQHA 3C7TA 5HIKA 2ZRAA 1SD1A 4JLKA 3VSBA 4TLAA 2BZ0A 4KFCA 4YP1A 1ZK0A 2BZ1A 4UCQA 3WHKA 4AWBA 4DLNA 1A8UA 1KR2A 1UK7A 1QKKA 3IAS6 1OCEA 4N6NA 2V7PA 3I5XA 5DHPA 3VKWA 2JGRA 2RGYA 3R6TA 3RREA 4DXAA 3H9QA 1OGYA 2P2GA 3GPLA 2OXEA 2R5WA 3ETJA 2ZG6A 3TPCA 4EITA 1XJQA 1U2PA 2WE7A 3DLCA 3TQHA 5FH9A 3B6ZA 2HDNB 1DCTA 4O2BF 4R9RA 3QWHA 3NOVA 5WRFA 2ZK7A 3MWFA 1Z38A 3PEUA 4O25A 4DBZA 2HRDA 7YASA 2OK7A 3GY0A 4GPTA 3DC2A 4C78A 2PZEA 3AJEA 4O02B 3TWOA 1GV1A 4LF6B 2NUBA 3BIOA 4QFDA 3IILA 2FN8A 2LCQA 5BWBA 3AILA 2EZUA 1GPYA 2QVLA 4KK3A 1Y5LA 3O3CA 4WH0A 4ZKDA 3JZMA 2AYZA 1H2BA 4WXRA 4BNZA 4BO7A 3E8MA 3GMDA 4H16A 4TXHA 4ALJA 4CF6A 1Z0DA 4HWOA 2ST1A 2C31A 3OPYI 3EGOA 3LZ6A 3OQVA 2QD2A 3GCWA 4KI0A 5C3UA 5JSZA 1XA3A 5KNDH 1SQGA 1P4GA 3T52A 1G3UA 5EINA 1SR8A 3TDMA 3S8MA 1F8FA 3Q7QA 2LW7A 4IUDS 2XUAA 2RH4A 2Q4TA 2W2LD 1I4WA 2JKYA 3H3XA 5CYGA 1EVLA 1Y5RA 4J43A 1U65A 4UD6A 5AVXA 3K16A 3RIMA 4RWEA 1I13A 1LDMA 4IDGA 4WZAE 5T4BA 1N7IA 3WK9A 5BVGA 1UBHS 1ZA1A 4TXNA 4EHKA 1RXVA 1K1EA 3TTUA 1P39A 2FTKE 4ZAWA 3IQHX 3UXMA 4CV3A 1YCGA 2YVAA 4KGVA 4BNIA 5FPKA 4GDFA 3SQXA 2BRUC 3U7JA 3AVQA 3ZD8A 3C5CA 4FFRA 1LV7A 1QHSA 2O8FB 2FPRA 2QGFA 3NPMA 1SC9A 3U19A 1P6XA 3M6WA 5FR1A 4B3JA 4WK0B 1D0VA 4NV1A 2ZIEA 4JX8A 2HXSA 2Q1SA 1EP2B 1ENZA 3G0IA 3MQFA 3OTQA 4RS4A 1CDEA 1DUIA 4RY8A 3QXXA 1FUYB 2V5VA 4URZR 3K5IA 3M1AA 4MICA 4WZBA 3OD5A 1PS9A 2DHRA 4LNUB 3A3OA 4P22A 1I7LA 4AWXA 3KHSA 5F3DA 3K70C 3AV0B 4ND7A 5AXDA 1YULA 4BTEA 2V8OA 4RZHA 2F8SA 2HHCA 3AIOA 1V9LA 3HY4A 3GLSA 4RPHA 2JHPA 4Y98A 4TLDA 4XQ9A 2WHXA 3GOQA 4D4JA 1VHJA 1Z6ZA 2XA2A 4Q34A 1RKUA 3H5NA 3NOOA 1F5SA 4XQ0A 4FZRA 4LQCA 3VM6A 4C30A 4EVSA 6PFKA 1ATIA 1EESA 3D0KA 2D1YA 3U7FB 1YR8A 3NNDA 1CUWA 5EFZA 1K97A 1XDZA 1IDN1 3R3HA 1L4NA 1Q6ZA 2H1LA 2HSJA 4EP1A 4ENWA 1THTA 3BZWA 1OFUA 4MMXB 3DZHA 2P6UA 3QITA 1EFRA 1ZOPA 3AOEC 3E8XA 4N8DA 5L51A 3ZZ0A 3PC3A 2UU9B 3ZQ4A 3O94A 2G9NA 1MAAA 1RI2A 2ZYIA 4I4TF 5L3QB 1J9ZA 1YFJA 2C7PA 3KWFA 3N3BC 2FV8A 1EFVB 1G64A 4B6GA 5FUQA 3P0JA 4DVJA 1RD4A 4M49A 1IJEA 4KQ2A 1ZMRA 1NBIA 2VJMB 3SYKA 1GZVA 5HUJA 2QBYB 2NUAA 3UK6A 1DQZA 2JJ2A 4AP5A 4BO4A 3ZDZB 3FTNA 1CEXA 2FWIA 2AQKA 3DTTA 4LJ7