4UNRA

Mtb tmk in complex with compound 23
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
209
structure length
186
Chain Sequence
b'MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAEDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE KINASE
publication title Structure Guided Lead Generation for M. Tuberculosis Thymidylate Kinase (Mtb Tmk): Discovery of 3-Cyanopyridone and 1,6-Naphthyridin-2-One as Potent Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 70
structure length 186
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4unrA00
2AD5A 1DARA 1JNYA 1OE0A 2EFCB 4OHWA 1OFIA 3VNVA 1QBKC 2V7QD 3ZQ6A 4LOAA 3QXJA 5DYGA 5LD2B 4Q18A 1E0JA 1QHHB 3Q7PA 1T8UA 1VMAA 2XXAA 2WSSD 3GFTA 4Q1BA 3PUXA 4U00A 4Q21A 1D9XA 2G0TA 3OZXA 3THOA 1ZC4A 3BB1A 4JSYA 5FBLB 4H1UA 2EVWX 2GZHA 4JYCA 4HB2A 2CBZA 4PC1A 3RABA 4C9BA 3SDZA 3PEWA 2WZQA 4G5RA 2FFHA 2WICA 2ZYVX 4LUCA 3B2EA 3ZS8A 1VG8A 4DLWA 5KSOA 3TVDA 2H18A 1FQJA 1G3MA 4KFUA 1IN7A 1W36B 4PQFA 4N0DA 4IXNA 1N6PA 1R4AA 1LTQA 4A2WA 3CKLA 3AM1A 2JDID 5KDLA 3GJ7A 2XSZD 1G4AE 4OI1A 2RGXA 2VO1A 1UFQA 1YE8A 5E95A 4OQXA 1XZQA 4GFDA 3NXSA 3W5JA 4PAMA 1KI6A 2UVQA 4NDZA 1ZCBA 5EE3A 1XZPA 3CNOA 1NBME 4UNRA 4Q03A 2JASA 3SFZA 2BOVA 1U90A 1R0XA 2IEYA 2VL7A 3DDCA 2QTVB 2ZQ5A 3ETLA 1HH4A 1A2KC 1BYIA 1N3BA 1S96A 3KKPA 4A1FA 2XNDA 721PA 5EXXA 4XSHA 3RNLA 4PHGA 4B2LA 1PLLA 3D3QA 3QENA 4RFSB 2GNOA 4WZAE 3QI2A 1VG1A 1AJEA 1DG3A 4WOPA 1DG1G 1XFAA 1R6BX 2FJUA 2YOFA 5HE9A 5TXGA 1ETUA 3CB4A 1KI4A 1R0ZA 5CM8B 4DUGD 3R8CA 3RS4A 1YJ5A 2XB2A 2C9YA 1Q1BA 1RW4A 2NPFA 1YZKA 1N6LA 4ZPXA 4JKIA 2GILA 3GJ3A 4E22A 4N3NA 4MQBA 1OH7A 2C78A 1EK0A 2EU8A 4LYJA 2JAQA 3LFUA 1VTKA 2AK3A 3GFOA 1TUIA 2HDNB 3BAFA 3SJCA 4I4LA 2GZAA 5JZVA 1I2MA 1FUUA 3AGPA 4GI7A 5JFGA 4URWR 3LBHA 1KNXA 4S35A 5TY0A 4HUTA 2BC9A 2J7PD 3VR4A 1A82A 2FSHA 5L3SB 2PZGA 3R9WA 2WMNB 5JS7A 4TYYA 2GEVA 1SULA 3KTAB 1Z6XA 3U3OA 1OB5A 2RHDA 3A4NA 3SJAA 3HYTA 1FTSA 2OLJA 4DIDA 3ONWA 5D3MA 1GRRA 2IT1A 4X8LA 4II7A 1F2TB 2PX0A 1JJ7A 2MSDB 1NP6A 4OL0A 5BW8A 2CJWB 4IRUB 4Q9LA 2BJVA 1TF5A 1G20E 4NE2A 3SBEA 2D4HA 2R44A 3IBGA 1CRPA 1J70A 2DCUA 3G82C 1LFDB 1T0HB 3CH5A 2IUTA 4MRRA 2VHUA 1ELOA 2C77A 2IYLD 1JR3D 3NBFA 2QU8A 2RMKA 4C7OB 3RDPA 3GLHE 2KE5A 2ZI4A 1IXSB 4PSVA 4B32A 2O8FB 3BXZA 2QM7A 4M22A 2VP2A 1RJ9A 4PC2A 1KJWA 2IUSA 3PENA 1N5KA 4DC9A 1E79A 2CVFA 3GJ0A 3K0CC 4FW9A 1NG9A 1Q1ZA 4N1AA 1JEDA 2FU5C 5L3QA 3IIMA 2RCNA 3MWJA 4G5GA 4JLKA 4QBGB 2JLXA 1ZVQA 4PSKA 1I4LD 1H8EA 1CXZA 2P5SA 3CNLA 3ZJYA 4EPYA 5M04A 1OB2A 1G1MA 4GPTA 2HLDD 3P20A 4Q48A 2ERYA 1CJTC 2IYVA 4B3CA 1W5SA 3L43A 5G3YA 1FX0B 2IS6A 4LSGA 5AUQA 3UIEA 4ZV4A 4IFBA 4ARZA 1W0JD 3DM5A 1W36D 4BPBA 2R6GA 2GJAA 2JGNA 4BECA 4GSYA 1EG7A 2P6RA 4A9AA 4ZCLA 1NBMA 4A2QA 3QF7A 3PVSA 4MDEA 1E2MA 3FYHA 4DLVA 3EZ7A 3WYAA 1XX6A 3QKRB 2YWGA 2BDTA 4AIIA 2ZJOA 5KNBA 3WMGA 3ZVNA 1QHXA 2E1RA 3QKTA 1VG9B 1XB2A 3R9IA 1IAQA 1J90A 2CK3A 3CO5A 4FXPA 3BC1A 5FFMA 1GKYA 3LV8A 5K8IA 4MRSA 1TADA 2RAPA 1KO1A 5LBIA 3LRPA 3I4LA 4B33A 2G88A 1W47A 4B75A 2R9VA 2TMKA 1KDRA 4FCTA 1OXXK 2ZITA 1D2EA 3FGNA 4XVQA 1EFRD 1OXVA 1M6NA 1UBFA 4OJQA 1LW7A 1E9RA 3I61A 1EFHA 3GJ4A 3EA0A 4NCHA 3C16C 4D0NA 5KDDA 5DO9A 4Q7LA 2FFBA 3WHLA 3KJIA 2VLIA 3I5YA 1ZIPA 3U44A 1DOAA 1Z6AA 3UWOA 4UKDA 3ND9A 2W2TA 1JBKA 5EXPA 3SJZA 4NYJR 4DEXA 4UJ5A 3KJGA 2GRJA 1JEEA 2JCSA 3LX8A 4PC7A 4A0GA 4CEIA 2A5DA 3B7GA 3ZIAA 3ICQB 2GXSA 2B92A 2NMVA 4AG5A 1YU9A 2IF2A 4Q9JA 1OH5A 2QQ0A 1Z28A 1CJKC 2QQEA 4Q4AB 2R6CA 5EE5B 4EFNA 3PR1A 4NYJQ 4EJSA 3IBYA 3RAPR 3RS3A 1XDBA 1IJFA 1XU4A 3EIEA 5CLQA 1XCMA 5HCIA 4EFLA 1NRJB 1OHHA 1P60A 4LHXA 3QNUA 5E7JA 2AN9A 1OFTA 2AFHE 3NC1C 3QXSA 4BFVA 2JIZA 2GEUA 2OM2A 2BM1A 2XGJA 4C0LA 1II0A 4ASUD 1BMFA 821PA 1KSHA 4P33A 2QTHA 2REXB 4JS0A 1TEVA 3T12A 4PPNA 2I1VB 2D74A 1OFHA 1N6OA 3NBXX 3IO5A 421PA 3LW8A 3BFXA 3RANA 5FUXA 1NJGA 1UF9A 3CWZA 3GLHA 1T3LA 3PV0A 1E4YA 1ZNYA 2HF9A 3FMOB 2JEOA 3QEJA 1M7GA 2JLUA 1B23P 4P4SA 3ZZTA 1YQTA 4DBLC 1QZXA 4JLJA 1G16A 4FI3C 3AKDA 4WXPA 2ZRKA 1AGRA 3FE2A 5JSZB 4KSBA 5JBQA 2PZFA 5FH9A 2Q9BA 3JVVA 2RB4A 2CL7X 2N1BA 3OIWA 2ANCA 1CJUC 2ZSAA 4IDHA 2IS1A 1NY5A 2ZJAA 5HKKA 1CRQA 3B1XA 3E2IA 2GBLA 1G3RA 3W90A 4BRWA 1Z8FA 1LB1B 4I1SA 2GJKA 2OFXA 4UQOA 3I5XA 1OLOA 1JXMA 2RGNA 2VRWA 4PQYA 1GZSA 2WWFA 3FDIA 4QHSA 4YLGA 2GDJA 1RRFA 3AVXA 1D5CA 2FZ4A 3BGWA 4PX9A 4Q01A 2O8DA 1EX6A 1DAFA 2CE2X 2CMKA 2GCOB 3A58B 4M1TA 4OKSA 3SFVA 1IBRA 1XD2B 2GCNA 2LKCA 2OBMA 3S1AB 1D9ZA 4XWOA 4MYCA 2FEMA 4TMWA 4M9ZA 1BIFA 4YMTA 2F1JA 2YC4C 2C2HA 4Q4JA 3N2EA 4C0QC 3DMNA 1M7HA 1ZRHA 4HB0A 2C95A 4Q4LA 3THWB 4ABYA 4OQLA 1ZUHA 4B76A 2W6IA 3P32A 4PHTA 2WAYA 1B0UA 1XEWY 1YZGA 1SVSA 4GMDA 4M2LA 4D4KA 2R2AA 1WE2A 2ZRPA 4L16A 4F91B 1NLYA 3LY5A 3FFAA 1E2GA 2V8OA 2D2EA 4D2IA 4OHZA 5JEDA 1UEJA 2W58A 3QOFA 4JL5A 3VU9B 1GNRA 3T34A 1HUQA 1HQYE 1US8A 4QC2A 2Q3FA 2G6BA 5KYKA 1TU3A 4OBEA 1TQ2A 1MV5A 5A4JA 3UG6A 5GADl 5CK5A 5C4MA 2A5FA 1T4GA 2DFKB 1E2JA 1ZP6A 2Z83A 4LHVA 4RD4A 2O5VA 1XCGB 2EFGA 5H70A 1Z2CA 2RKOA 3K70C 4I1VA 4IXMA 1KMHB 4DCVA 5HCNA 1WF3A 1EGAA 4TLAA 5FOWA 3RS5A 2OAQ1 1YVDA 4US0R 5EP3A 1Q44A 1NN5A 4AY2A 4X8MA 1RKBA 1JPNA 3CONA 2F43B 1F3OA 2YWHA 3K1JA 4MGZR 3R7WA 1Q0UA 3K0EA 3X1YA 3RRNA 2IYQA 1U0LA 3CNNA 1KMQA 2BMDA 3AVOA 5AJVB 4GMXA 1WBDA 5B57C 3QBTA 4Z8XA 3A4MA 2BWJA 4Q4HB 2WJVA 1QDEA 4MITA 5FTKA 4X8HA 3KXLA 3OHMA 3GJ6A 3NDPA 3UK6A 4YXWD 4K81B 3UMRA 2QP9X 3B1WA 2A78A 4TTQA 2JLSA 3CM0A 2RGBA 4NYMR 4OJKA 2MMGA 3AF4A 2P5TB 2PBRA 4A0RA 2ZAOA 3M1IA 5AUNB 2ZJBA 1UPTA 3EC1A 3L8YA 3MJHA 3K53A 1AM4D 3QXHA 1G8HA 2V1XA 1X6VA 4NL4H 5JI3E 2C9OA 4HAXA 2GAOA 1U99A 2I3BA 3K09A 2ZYWX 2EFDB 3EC2A 1KTVA 1VG0B 4NYMQ 1KK1A 1OYYA 2QPAA 5C2JB 4D25A 3HYRA 4JLNA 2A7QA 4EJSC 3SOPA 1A4RA 4Q9KA 4LC1A 4AWXA 1CS4C 3WYFA 5H1YA 4BFXA 3SC3A 3IGFA 2D06A 2XZOA 1X86B 2IHBA 3EIHA 3K0AA 3LXXA 1SKQA 1TL7C 2D7CA 2PT5A 1KI7A 5CDFE 4NMMA 4LYAA 2Q9AA 3MLEA 3AVQA 1E96A 2V4ZA 4Q9IA 3VR6A 2OE2A 1S1CA 3F8TA 4RVCA 3GPLA 5KTYA 2IXGA 3KUDA 2JJ1A 1IQPA 1IJEA 6Q21A 3GLGB 3OFNA 1QHNA 2JJ2A 3CUEF 3VNUA 3W6OA 3E1SA 2BBOA 4C3ZA 2XOKA 3OEHD 3F3YA 1K6MA 1G8YA 2V9PA 1SKYB 2ZYUX 4Q1EA 2GJ9A 4KITB 3O8DA 4XD7D 2ZJ5A 3U3KA 4OQMA 4BGDA 4DLYA 3I8XA 5C1BA 1IN4A 3K9HA 2IS2A 3RS2A 3QVVA 3SR0A 1IXRC 2EQBA 2ODWA 2CL6X 4M0LA 4US1R 1F2UA 4ZI2A 2QTFA 1SVOA 1E2LA 1GRQA 4ZKDA 2FX3A 1GL7A 1XEWX 2RGNC 2GJSA 2ZROA 1BOFA 1YR7A 1TUEA 2QPTA 3GLIE 1IOZA 3L2OB 1M74A 3DZDA 2NPIA 1E0KA 5IDVA 4F93B 3OE7A 3M6AA 3EW9A 1XP8A 4ZDKA 1E2DA 2Q21A 3HPQA 4TQUS 4TSFD 1G17A 1AQUA 4HEJA 3THYB 1TTTA 4EPTA 5E7IA 2NO7A 4G5QA 4BFUA 1FP6A 1P6XA 5B30A 4C2UA 3QJYA 5F9FA 3I8SA 4A36A 4R71A 4TL6A 5C18A 3U4QA 2VP4A 2F1RA 2W0SA 1SVIA 3HU1A 3CW2A 5TVKA 5FL7D 3ASYA 1LV7A 1S4QA 5EZ5A 2B7CA 5F98A 1E9DA 1SQ5A 1P3JA 4ZCMA 2KBEA 2QN6A 2G3YA 5EP4A 5GJVC 3FKSD 3LO5A 5JWOA 1GTVA 2PMKA 4QGFA 1JAIA 2ZRDA 1SXJE 2QE7D 3OIYA 3CF0A 4M1YA 2R65A 3FMFA 2GESA 1WCV1 3CPHA 4TT3A 4QM6A 4QGHA 2X8AA 5JCZA 2CL0X 2NO6A 3REFA 2ZJYA 4RD2A 1G5PA 3LQQA 1HT2E 4U7DA 3IQXA 2HJGA 4URZR 4R7ZA 3PEVA 4Q19A 1E9CA 1T0JB 1XJCA 3H0KA 1TAGA 4JL6A 5G53C 1WBBA 2QRNA 4ZI3A 1CR0A 4PZZA 4A8JA 5L3VA 3MUFA 1HEIA 3REGA 2C5LA 2EWVA 3EG5A 4LK2A 4AD8A 3AF3A 2QRZA 1LF0A 3BK7A 2GF9A 4L4UA 1XEXB 2OHFA 2JLQA 4Z54A 1T6NA 1VECA 4KXFB 2EFEB 4EPXA 1KSFX 4OHXA 1ZJ6A 4PSAA 4LRWA 5FUYA 4ZO4A 5DLQC 1UDWA 3DOFA 3FHTA 2ZYTX 3L8ZA 5UKDA 4IOMA 3X2SA 3C8UA 2IYYA 2PLRA 4PANA 1DADA 4RSGA 1OSNA 1L4UA 1PJRA 3AP1A 4DT1B 2ZTSA 1WDTA 3FVQA 2D7DA 2HV8A 5DI3A 1W0KA 1MABB 4M53A 5JCPA 4BQSA 1RRCA 4TMKA 4Q1AA 2ZREA 4EQ6B 2IYWA 3UKDA 1ZC3A 5CDFA 3TQCA 4DDWA 4TL9A 5FI1B 2FPMA 1YRBA 2HXYA 1AS3A 3EXAA 3TRFA 3BH6A 4TTRA 2IWHA 4Z1MD 2X1VA 2QY9A 4HYYA 4ZDWA 3X1XA 1TEXA 1U81A 4QJ5A 1EFCA 5EZ6B 5HTKA 1MR3F 1Q3TA 4BE7B 3Q7QA 3J81k 3K09C 4NCNA 2J59A 2D3WA 4HB4A 4DJTA 4UXJA 3EIQA 3OEED 3ZH9B 3RVBA 4Q7JB 3A8TA 2QEQA 3GJ5A 4OHYA 3GD7A 4O2LA 1DAIA 4KBGA 1L8QA 3EZ2A 5IK2A 3T1TA 2ZI9A 4GZMA 3SHWA 3VKWA 1KI6B 4QXAA 3FMPB 4JLMA 3AKEA 3I3SR 2AWNA 3CH4B 2Z6VA 2YWEA 4ZIRA 4JSTA 4U5XA 3IEUA 5C46F 1AN0A 4AKIA 4UNPA 4B44A 2FEOA 3BRWD 3QQ5A 4L15A 3GLFB 3SEAA 1FPMA 1OIWA 4K8OA 2OCBA 4CGZA 4KJZA 3CRMA 3GLIA 2H92A 4DWJA 4WZ6A 4YMSA 2VF8A 3GFPA 4UNQA 4QOSA 4LYHA 4YDHB 3OAAA 4BLOA 1ESNA 2WVJA 4H9GA 1XBTA 5KSZA 3I62A 3DKPA 2OLKA 5BQ5A 4ON9A 3U7EB 4URXR 2FN4A 4TMXA 2ATXA 2BHRA 1ANKA 2NQ2C 2VEDA 2VP0A 4HAVA 2EYUA 4P0TA 4N0EA 1GSIA 1RC8A 1QHGA 2HCJB 1E9FA 2BIFA 1P61B 3I32A 1II8A 4MKFA 4QL3A 1GG2A 3V00A 2QG6A 1J8YF 3VR1A 4LJYA 3PEYA 2NO9A 3EZFA 4B74A 4JL8A 3ZGXA 4B3XA 3IIKA 1R10A 5TDHA 1A2BA 1FQKA 4DUGA 1SXJA 1U98A 2DWQA 2WJYA 1YZNA 4LHZA 2W2XA 4I81A 1GL9B 1IHUA 3GEEA 4PZYA 4QFMA 3LVQE 2Q9CA 1KSGA 2A9KA 2YOGA 4PFSA 5DI9A 5TB5A 1G8FA 4URVR 2ZUCA 4D6PA 3EPLA 4JIMA 3UANA 5DNYB 2FDCA 2ZS8A 1P2SA 4PPFA 2YZ2A 5D3MB 2YINC 4EPVA 1RYFA 3AVVA 4KV9A 1H65A 3LWNA 2VP9A 4XWAA 4BASA 4DRZA 1OXTA 3KB2A 4B6FA 4RFVA 3LDAA 2SHKA 4G01B 2AX4A 3RC8A 1WA5A 2FSGA 3QVUA 1GOTA 1A1VA 2ZPTX 2C04A 5J4YA 1G6OA 4B3FX 4A8JC 3PEUA 4A2PA 1CLUA 3X1WA 5GVSA 2H5EA 4LV5B 1RJ9B 3RRMA 4YQFA 1DS6A 3NH6A 4IVRA 2YHSA 4M8NE 3THXA 4DCNA 4D80A 4DSUA 3TUIC 5L3QB 1N6RA 4BRUA 2CVHA 5FPKA 1SZPA 3ADKA 5CB6A 3X1DA 3EPJA 3AKYA 4LHYA 1C4OA 3IHLA 1OYWA 5JRZA 4XSGA 1PVOA 1XJ0A 3WMEA 1X1RA 1XNJA 2OCYC 1UAAA 4F4JA 1G7SA 1ZM9A 2WM9B 4DLZA 2RGCA 1J99A 3V4RA 2VA8A 2CE7A 2G1JA 2WPDA 4DVGA 2ZSBA 3A37A 1KOFA 5LDDC 4BFZA 5FUWA 1PV4A 4JVMA 2ZI7A 2J1LA 1XTKA 3U3JA 3CR7A 4PQRA 3QKSA 4IEIA 3P27A 2VHQA 3FFBA 3DMDA 1I4DD 4G5OA 2WV9A 2CLDX 1XXHE 5DN6A 3CIOA 1E2KA 1HY3A 2DFNA 1NF3A 5LPNA 1R7RA 1HE8B 4NU0A 3IO3A 3K70B 3KUCA 3U2QA 2H7VA 4B2IA 4AYWA 4BLRA 2FMXA 3I1FA 4GBMA 2V6JA 1FZQA 1R5OA 4HZUB 2X77A 4PAOA 2QBYB 3NHAA 1H8HA 4S2EA 3Q5DA 3MG9A 2XNDD 3LA6A 3NEJA 3TKLA 3EAQA 3SN6A 2JLZA 3UATA 3AP2A 2PL3A 3WP0A 1NMZA 4IDQA 4PAQA 2ONJA 1E9BA 4Q02A 2ZI3A 4LJ7A 3GMTA 2YWFA 4JVNA 3RS0A 5F3WB 1S9DA 5FPHA 4G5SA 2BJWA 1OKKA 4PZLA 4TMVA 2WJHA 5BYJA 1PUIA 2EYQA 2WKPA 3BWDD 4P31A 4B71A 1W5TA 2VQSA 1JB1A 1F48A 4QM7A 3FMIA 1E2HA 3PUVA 1VHTA 1XMJA 5F9HA 2C98A 3SI7A 2P6NA 1LS1A 5FOVA 3U44B 2BBTA 3NEYA 1ZD1A 4TQ9A 1GUAA 1N2CE 2KI5A 4XTRA 1N6IA 1XF9A 3KJEA 2W6JA 4CEIB 3T15A 2DY1A 1HYQA 4PO9A 3ZYCA 2QMEA 3KXIA 4UXHA 4HDQB 1MRSA 4CYMA 1W7AA 5TMPA 5ELXA 1Z0DA 1KO4A 1HA3A 2O0HA 3G5UA 1JECA 4Z51A 2QORA 1KI1A 1MH1A 4M1KA 5FTMA 4EJSB 3N2IA 4A6PA 1WRBA 1KNQA 3VX3A 1UBEA 2DYKA 2XB4A 3N70A 3RC3A 1DO0A 2NZ8A 2ZU0C 4OI4A 1T5LA 2ZJZA 1OPXA 2VSFA 4Q1DA 2VTKA 5KO2A 4KODA 5JMTA 4O2RA 2IA5A 2DPXA 3BE4A 3RWOA 1NVWQ 3UXMA 2GWHA 4C0HA 3B9PA 1LS6A 2FFAA 5KOYA 4JLAA 1VHLA 2ZRMA 2IYSA 3PITA 3LLMA 4D4LA 1G7RA 4RJLA 5J47A 4P4SB 4TN1A 2GKSA 1NSFA 4CEHA 3T35A 4LJAA 5JECA 1HV8A 3ND8A 1K5DA 4YMVA 1KSJA 4P4UA 1F2TA 4P4TA 1M8PA 3TW4A 5DH9A 1E2NA 2XJ4A 1E79D 2VHJA 5EE9A 2WKRA 4L9SA 1NVVR 2GK7A 1E94E 3QPWA 4WXRA 5D3QA 3BORA 1H8ED 2H57A 1E0AA 1F5NA 1GIAA 3TAUA 4KSCA 4B3GA 5K8UA 1VYVA 5CJ2A 2O8DB 3T06B 3L0OA 3NIBA 3ASZA 3UMFA 2AKYA 2O8FA 4QHTA 4MGIR 1NVVQ 2GXUA 2KJQA 4Q4JB 4OK5A 2Z4RA 4LY6A 2PMDA 5JJLA 1SVWA 1XXHA 1N6HA 4KO8A 1ZW6A 3EARA 5DISB 1R8QA 2NG1A 5C4GB 5HZHA 1Z0IA 4ERNA 4WIAA 1NBMD 3QE0A 2BMEA 1KK3A 4K46A 1OW3B 3MFYA 1NIPA 1RPZA 5FR2A 4GT1A 3NKVA 3DEFA 3JZAA 1E99A 3LBNA 1UKEA 2QAGA 1EWRA 2ZSFA 3DVLA 2A5GA 4LJ5A 1Z2AA 1FX0A 1T3HA 1S1MA 3NVAA 1VIAA 3PUYA 2B21A 1ZM7A 3K70D 2CK3D 1T5IA 3JVUA 1DVRA 4CEJB 1US8B 4EPRA 3IQWA 1GNQA 4V0OA 5JJIA 4NTZA 1T8TA 3TR0A 5AR1A 3ZVLA 3LX5A 4RCYA 1P2TA 4TTPA 4DSNA 1M34E 2V1UA 3KKQA 1MOZA 2A2ZA 4TYNA 2DWPA 3CRW1 4UXIA 5TV2A 3W8RA 4TYPA 2BCGY 4NCKA 1NVUQ 2IXEA 4F38A 2H1LA 3M4YA 1U8ZA 3FTQA 2FPLA 2J0UA 1SVMA 3IHWA 4QNRA 1ZNWA 2J41A 5SZKB 3HR8A 3R7WB 3RS7A 3QG1A 5FTJA 4P3YA 3O8RA 4KBFA 1AQYA 4QBHA 1KJYA 4TMTA 2PT7A 4MYTA 3FKQA 3QEOA 2OCAA 1W2GA 8OHMA 1P62B 2ZETA 2WJIA 1E98A 1G64A 3ZIAD 3ZVMA 5SZJA 1TX4B 1IONA 4BFYA 1MO5A 2QZ4A 4FD2A 3H4MA 1W4CA 1Z5ZA 2W2VA 2J45A 2ZXUA 2RGDA 1XTSA 1Z6YA 2VHCA 3KQHA 1ZYUA 2OV2A 3DHWC 1AS0A 4EUNA 1Q12A 5FUVA 1Z22A 2OT3B 4TLEA 1OHHD 2C9CA 1Z47A 2MMCA 2JIZD 1Z63A 4H1VA 2OILA 1ZD8A 1BMFD 1FOEB 1S9HA 2YJTD 1S8FA 2HXSA 1QRAA 2J7KA 4HLDA 1U8YA 4PC3A 4Q4AA 5BYKA 1NNEA 3EPKA 4KU4A 1U8AA 3CRRA 4GOJA 1GVNB 2ATVA 1ZM4A 3U6BA 1KDTA 1Z0JA 4CIDA 2O52A 4D0GA 2F55A 2IL1A 1G4UR 2BKEA 3AP3A 3C7KA 3O47A 4CT5A 4HZIA 5CIWA 4HDOB 3RHFA 4FMBB 1G41A 1RRPA 1KI2A 1SGWA 4IVPA 4O3MA 2G9NA 5HE8A 1BH2A 1UKYA 3NC0C 4RD1A 1A5TA 4IHQA 3QKUA 1W1WA 4B73A 4DCUA 1E2IA 4AKEA 2DB3A 5E4FA 3BB4A 3QF4A 5HKKD 1QF9A 2O0JA 3O8CA 4DB4A 4MGKR 4ZCIA 1BYUA 1AZTA 3AVPA 3TQFA 2AXPA 2QGNA 3ZS9A 3MRSA 1Q1QA 4QGAA 1E2PA 4JLOA 4UNNA 2ZJ2A 4JVSB 4EPWA 1AK2A 2ZE8A 2QAJA 2GTPA 2WIAA 1J2JA 1F2UB 3HP1A 4BFTA 4BZPA 1ZM2A 4AKGA 2ZE7A 1IN5A 4A0HA 2XJ9A 1Q3HA 4RD3A 1KI9A 3RRZA 2Q3HA 4EKDA 4ZDIA 2R6FA 4B2PA 2ZRNA 1ZNXA 2W6ID 1YZLA 4XTCS 3TAHA 2F3TA 4ZDJA 1N0VC 1BO6A 2Q6TA 1PLKA 4PO1A 4BLQA 4LGMA 1SKYE 2WOOA 1FMLA 3I73A 1MT0A 4I1OA 4O25A 4M1MA 1HT1E 4LYFA 1XD2A 3CRQA 3T5DA 4DSTA 1G3IA 4FMCF 5KHOC 4MRVA 1JAHA 4BZXA 2ZRBA 5FOSA 2IYUA 3K0FB 1NY6A 3ECCA 1FFHA 3QSYA 2WAXA 3U60B 3FOZA 1E1QA 1GM5A 2GXQA 1F6BA 2ZE5A 2R6DA 3LH5A 1EX7A 2QAGC 3RRYA 521PA 5BWMA 4GZLA 4M1WA 2VIIA 1EXMA 1M7BA 3PFIA 2O8EA 2Z4SA 1ZU5A 5AWFC 2ZR7A 4DKXA 2J0VA 3SNHA 1FW6A 4C0JA 2HT1A 3C15C 4AYTA 4AURA 4B6EA 3VU9A 2R6AA 3BFKA 2OSBA 4KYUA 4ACAA 3Q8XB 4DLXA 2ZVQX 4BFSA 1YZUA 3EA5A 4PPGA 1Z08A 4Q66C 4OI0A 1P75A 3B78A 3B5JA 4A8JB 1II9A 4TLBA 3D6TB 1F60A 4IJMA 3B6EA 3LXRA 1W4RA 1GILA 2E9SA 4Q47A 4WA7A 2V3CC 4IOLA 1GKIA 3P26A 1NI3A 1CR4A 1GRNA 3KX2A 2AWOA 2O8CB 2GBLC 1V43A 3LBIA 1TPZA 5B64A 4EFMA 1R0YA 2NTYC 2QI9C 3IPXA 5CYPA 2GAAA 2G1KA 2A3RA 3VQTA 1G19A 3QPUA 1PZNA 1CP2A 1YR9A 3TW8B 3NH9A 2QP3A 4GOXA 3W6PA 3GCGA 3R20A 4GNKA 4LX0A 1COWA 3EX7C 1E1RA 1G5TA 3CBQA 5E7MA 4BEBA 4OK6A 1EFTA 1QG4A 3FHOA 1WB9A 4WW0A 4KHZA 4B34A 3B8HA 5DI3B 3W9YA 4Q4HA 3QG5A 4D81A 3KQUA 4V02A 4TZ6A 1QHYA 3RLFA 3LQRA 4F7WA 4DDTA 4HAZA 1QHSA 1J7KA 3T61A 3CWQA 1E6CA 4Q7MB 4E07A 4HUQA 2WWHA 1NVXQ 1ODFA 1UKZA 3V9PA 2AR7A 2CLCX 2NOAA 5FPTA 1D6JA 1G3QA 4YC7A 3GP8A 3TH5A 4LCBA 3E5HA 1SVKA 5G40A 4XJXA 2J0QA 2X2EA 3CZQA 4C0BA 5CK4A 2LKDA 3KDSE 1AZSC 2JJ1D 2WWWA 3OFND 3LNCA 2JJ2D 5HR5A 1ESMA 3TE6A 2JLVA 2C96A 2C99A 2NO0A 4V0NA 1KAOA 1Z29A 2JLWA 2XOKD 3SS8A 3AVTA 4FN5A 2UZIR 4B47A 1P2UA 5A0FA 2CCGA 1O3YA 2VSOA 1ZU4A 2B6HA 2D2FA 3Q3JB 2GA8A 1CJVC 2OBLA 4J0QA 1NKSA 2AL7A 1U2RA 1FNNA 5JWHA 3KL4A 2ZAMA 4CW7A 1RVDA 2J0SA 4QG7A 2PX3A 2ZRLA 4TL7A 3GLIB 2DBYA 2OZEA 3B1ZA 3L0SA 4IDOA 3HPRA 3OF5A 5KUTA 1W44A 1G291 1NLFA 5IRCD 4HB3A 1UDXA 3GJ8A 3Q9LA 1DAEA 1CR2A 1P9RA 1SHKA 4MKGA 5DHFA 4CDGA 4EAQA 5K8TA 3KKMA 4NKRA 2WBLC 1KI8A 4Z8YA 1JR6A 2QL6A 1TMKA 1S0UA 2CNWA 4HLCA 3SHFA 2GXAA 3OE7D 4B3BA 2F1HA 1JPJA 4HDCA 2OESA 1KO5A 1JJVA 4DZZA 2OO7A 2WKQA 4LDJA 2RGGA 4AG6A 5J4LA 2XXAB 3AF0A 5DSZA 1Z6GA 2XZPA 2YV5A 3CF2A 1G6HA 3GLFE 2HYIC 1N0UA 3EASA 1M2OB 2XTMA 1XMSA 4M1OA 2FV8A 3RYTC 2O8BA 2ZUBA 2XTNA 1DBSA 1JR3E 3FB4A 3ZQJA 2V7QA 3L82B 4YMWA 3TIFA 1XD9A 1NKTA 4GRAA 3PJRA 4FWTA 3T1OA 4A15A 1AIPA 2WSSA 2REOA 2WSMA 2J87A 2D62A 5GVRA 3IEVA 2B8TA 2ANBA 3WNBA 3CX6A 3MWYW 4TT3D 1U9IA 5JRJA 1PUJA 2FA9A 5DIFA 2N46A 2ONKA 3VX4A 4HAUA 4RY2A 2Q3MA 1M1YE 5SZIA 1HURA 3K9NA 3UWKA 4TYQA 2JDIA 1SVLA 2ORVA 2XSZA 3P4XA 1JQJC 1A7JA 3CR8A 1DAHA 1MO4A 5ANRB 4M1SA 3AV0B 1W2HA 3ADBA 2XX3A 3TK1A 5JHHB 1HQCA 5JS8A 1X8JA 3C5CA 2W00A 3DO6A 3MSXA 1CEEA 1Z83A 3Q85A 2R62A 2VH5R 2WOJA 4NCJA 1UBCA 3A1VA 4RD0A 4W5JA 5FPYA 3U5ZB 3DL0A 4IDNA 4M9QA 3TUZC 3K0CA 4NZYA 1CJMA 1KYIA 2Z0MA 2ODEA 3BOSA 4Q00A 1W0KD 4LBWA 4RZXA 4UNSA 1UKVY 3VAAA 1KDPA 3LW7A 5H8WA 3LD9A 5FI0B 3LVRE 1W48A 4QRHA 5K8LA 1YZTA 1YZQA 5CM9C 3ADCA 2FOLA 2IHYA 4M4SA 2QT1A 2OG2A 1TQ6A 2ODBA 5CYOA 5AJWA 3WMFA 3UPUA 3CF6R 4V0LA 2ZRHA 3WRXC 2ZU6A 2F9MA 5KNCA 1HE1C 1MABA 3QKSB 4JLPA 3W8NA 1RE0A 2Y8EA 4EQ6A 1GFIA 3AF2A 3C41J 4WZBE 5F2EA 4MYUA 5IK2D 2Q0HA 2IWRA 3ZZ0A 1C9KA 5IHPA 1XMVA 3WXMA 2NGRA 2YYZA 1GP2A 3CZPA 4E03A 2PJZA 1JQLB 5EE0A 1AGPA 4AK9A 1W46A 4MRNA 2GEDA 3DOEA 4LJ9A 1G8PA 2J7PA 4V0ME 4JKYA 2VYFA 3I92A 4OHVA 3IPYA 4BUJA 3MMPA 4RCZA 4NYIR 4RKEA 3DM9B 2PJRA 2AD1A 2F6RA 5KSYA 2GK6A 2MSCB 4LJ6A 3MWKA 5EP2A 4F92B 1ZCAA 1X8LA 4GOKA 3TNFA 2JLYA 1P7CA 1T3SA 1V5WA 4RKFA 5GJBA 2FF7A 4I1UA 1E0SA 1OJLA 1CIPA 2OCPA 1E69A 3T1QA 1FUKA 3KQKA 3OAAD 3HU3A 2ERXA 5KPDA 4NYIQ 1YRAA 4ITRC 3GLFA 4BZQA 4GL2A 4HATA 1IXZA 2FNAA 3QY0A 4KLNA 3EPHA 4YONB 2FPKA 3ZZUA 4IOKA 5BXQC 5JHGB 4OYHA 4YDSA 3OIUA 3U3RA 3NTUA 4BLTA 4KFRA 1DPFA 2CHGA 1HTWA 1JR3A 1KIMA 2BVNA 4M9XA 4U02A 2J3EA 4D82A 1Q1EA 1X1SA 3SYKA 4L5BA 4Y0AA 1KZ7B 4M9SA 2DFLA 2KWIA 3KFXA 2R8RA 5FOTA 4XVRA 4E5UA 3W3ZB 5HPYB 5KNDA 4Q9HA 1SXJD 5BN3A 2ZSDA 1VIYA 4ARZB 1R8SA 1E9SA 4HLQB 1QHHA 3LAWA 1KO8A 3FPAA 2VF7A 1CKEA 4IFEA 2IK8A 4W7SA 5SZHB 5JJKA 4KVGA 4F4CA 2ZJ8A 2HLDA 5EXSA 4G0NA 2ORWA 4IOJA 4QGGA 3T5GA 3H2YA 4LI0A 3K9LA 4GP6A 1JALA 3C5HA 4R9UC 2YVUA 2ZR9A 3NWJA 3GJXC 1W0JA 1G7CA 4FCVA 2QA5A 1RFLA 5DE3A 5FOXA 1EFUA 1U9IC 1Z0FA 2IBMA 2PLFA 3HR7A 3HJNA 5EUMA 5JI2E 3QXXA 4CZ2A 1BKDR 2N42A 3RSOA 5L3RA 4CEHB 5CLLA 2VP5A 2ZRJA 1TQDA 2IUUA 2WIBA 2OFWA 3QXCA 3W34A 5IF9A 1MKYA 2REBA 3TSOA 2ZIAA 3BH7A 3PCRB 4CF7A 4ESVA 1IM2A 2B8WA 3CPEA 5EUQB 1GWNA 1JI0A 3P1JA 1UBGA 3MCAA 1KKMA 2QMHA 3BERA 4RFSA 1XRJA 3MGCA 1EFRA 1U94A 5FBVB 5KSPA 2DWOA 3WBKA 1KGDA 1ZD9A 2ZEJA 1VDZA 1LY1A 2KBFA 3PQCA 4KI0A 4PR0A 221PA 1R2QA 1R5BA 5JWRA 4M21A 2WPDD 1XXHB 1N5IA 1WP9A 3M0EA 2G77B 1ZMXA 2P3SA 1U0HC 3AQ4A 2WHXA 3K9GA 3Q5EA 1OFUX 1VCOA 1D8TA 2CXXA 3QPVA 2PEZA 4LBVA 4NH0A 3TGPA 4PC6A 1TNDA 4TL8A 1OIVA 1SXJC 2QAGB 4V0MA 5EE1A 4D4MA 5DN6D 4TLDA 1P73A 2ASEA 4FWIB 4Q5IA 4PO8A 3SJBA 3ZD6A 3VMFA 4C2TA 3UG7A 3C14C 1LF5A 2AXNA 4LWZA 2BMJA 4NONA 4DCTA 1TF2A 1ZUNB 1L2TA 4OI2A 3MJRA 5AJZA 5L3SA 4DLRA 1H8HD 3GLHB 1L4YA 4W9MC 4EDHA 1E2EA 1XTIA 2ZVPX 3BIFA 3FWYA 5EP1A 1DTSA 3KTAA 5LB2A 3KQLA 2ZR0A 3R8FA 1GITA 1KY3A 4DXAA 1XTQA 4ASUA 1Q20A 3EZ9A 1PLJA 2QUZA 2ZI5A 1XTJA 1OKKD 2CJWA 3HDTA 2G83A 1KK2A 2DHRA 5FTLA 4HZUA 3TR5A 3TUJC 3HWSA 2QBYA 4LV8B 4L8GA 2J0UB 1D2NA 2CDNA 2F1IA 4LJ4A 4BFWA 3B1VA 4HSEA 2QROA 1ONBA 4XOIA 4JLVA 4MRPA 4PPQA 3AUYA 5FBWB 4C7OA 2W6JD 3WRYC 2WWXA 4JBWA 1Y3AA 1E4VA 2WJGA 2CHQA 4AC9A 3DZ8A 4Q1CA 1TQ4A 4IEEA 1QVAA 3SYNA 2ZRFA 1CTQA 2PCLA 2Z43A 1CU1A 1IN6A 3MWLA 3AEZA 3MD0A 4A92A 1XMIA 2HYDA 4BWYA 2KB0A 2W83A 2OUKA 4QHYA 5AJXA 3LLUA 4DIEA 4URYR 2QMOA 2ODNA 4DLTA 1ZIOA 2ZI6A 1W49A 1GL6A 3IKJA 4LBYA 4E09A 3BH0A 3H86A 2ECKA 1OT3A 2AHOA 4LBZA 2BCJQ 1MRNA 4PTLA 1W4AA 3KZ1E 5LD2C 2WJJA 3AVWA 2ORIA 2FFQA 3TSZA 1O87A 5KU1A 2NZJA 1KHTA 3SE0A 4AYXA 1VPLA 4W5HA 4C0AC 4ZKEA 2QSZA 2QMUA 5AK0A 3IUYA 4JVLA 4URUR 4PHHA 2H16A 3TMKA 2FGKA 5FBRB 3CPJB 5A5GA 1G9XA 2ZRGA 2JA1A 4BLSA 2GVZC 2XTZA 1Z0AA 4NPHA 5JLJA 2BKUA 2ZRIA 3QKRA 2PEYA 1IY0A 1OF1A 2K5UA 4A6XA 3N5CA 2WTUA 2HEIA 4OQFA 1W36C 1P9NA 4R2HA 2ZM5A 2ZRAA 1WXQA 2X19A 3CX8A 3NDBB 3QF4B 3TVTA 2V54A 1DEKA 5GJWC 1Q22A 2XNSA 3PIRA 2F7SA 3WBJA 4KFTA 1RZ3A 1P4SA 1RIFA 2CLSA 2E87A 2IYXA 1J8MF 4R98A 2QP4A 4NCIA 3TJZA 2MSEB 3OESA 1VCMA 2RH5A 4A82A 4LC0A 3EWSA 1RRGA 2IYTA 4RZUA 2WWIA 1DAKA 1N5JA 4TYWA 4TLCA 3BS4A 2QM8A 3MAAC 3AVYA 1LNZA 4QBIA 4RZ2A 4L9WA 1NIJA 2P6UA 4JLBA 4IW3B 3E70C 4XWKA 1L7VC 2RGEA 1UADA 3GQBA 3QBVA 1OXSC 3B1YA 1JXOA 4JBYA 3U7GA 1KI3A 1G3UA 4V0KA 4QNMA 1YR8A 1E9AA 2BEKA 4POAA 1K5GA 1CF4A 3WNDA 2B7BA 3F0TA 3VHXA 3DKVA 4DCSA 1P5ZB 3BBPA 3H84A 1LVGA 3AKCA 1TU4A 4YXWA 4CT4B 1VCNA 3IILA 1NN3A 3AUXA 4C0KA 5KDOA 1T91A 1ZBDA 2W0MA 3R9XA 3K0AB 1ZINA 4LZZA 4DDVA 2IF0A 4I99A 2RGAA 4PHFA 3PUZA 3QUSA 4CRWB 3SU8A 3ADDA 4QJ3A 2A5JA 3SBDA 2GVDC 2WMOB 2ZANA 5CIQA 5J5CA 3GEHA 5EJEA 1S3SA 2O8EB 2P0EA 2XITA 2HT6A 2BEJA 2CHVA 2V6IA 4HAYA 4ACBA 3QIAA 1FL9A 4IKEA 4EIWA 1G8GA 4G3XA 1EWQA 1FMJA 3KKOA 3SQXA 4D0LB 2I4IA 2QT0A 4JT4A 4MDFA 4O0MA 1G21E 2F3RA 2P65A 2XZLA 4QJ4A 4CEJA 2FGJA 3KKNA 4NP6A 5B58C 1KJZA 1W4BA 2UKDA 3ICEA 3NBYC 4MKIA 2YNMA 3B9QA 2BV3A 4A0FA 3G0HA 4NHOA 4MUAA 3ZLJA 2CCJA 1CR1A 1IN8A 1XTRA 1DAGA 5JSZA 3VKGA 1AKYA 3TLXA 3OIVA 2QGZA 3OEHA 3PUWA 2ZE6A 1FNMA 4HAWA 4JBXA 3VFDA 1P2VA 2RHMA 2FWRA 1SHZA 3GLGE 1EESA 1N6KA 4Q7KA 1CULC 4MKHA 4XD7A 3PXGA 3TSWA 2LCFA 1NJFA 4LJ8A 5DYIA 2O0KA 1Q57A 4B48A 4JT2A 3PG5A 2BM0A 4MYHA 5GJCA 1TF7A 4JJKA 2GCOA 2IYZA 5G3ZA 4HLUA 3S1AA 5AJYA 4DT1A 5AUPB 3U4QB 2OFOA 3L0PA 1C1YA 3K0SA 4IDPA 3THWA 4GP7A 4WVFA 4HUQB 4AI6A 3VKHA 2FSIA 1N5LA 3ZD7A 1AKEA 4Y0VA 4TSFA 1ZM3A 2Z5FA 2WWYA 1DAMA 4C0SA 3CLVA 4B35A 2LWIA 1X8KA 2EWWA 1D2MA 3SYLA 1OIXA 2XEXA 5H68A 1Z6TA 1CBUA 3NHBA 3IIJA 3X1ZA 1WQ1R 5FL7A 2DFTA 4G1UC 4OQNA 4MUBA 3U7FB 3B82A 3WNCA 4PXAA 2FZLA 3D31A 1XEFA 3W5IA 2VPPA 3FKSA 5TARA 4LHWA 1NN0A 3F5FA 4D26A 4FMCB 3A1UA 1KY2A 1YKSA 3B85A 4IVQA 4ESHA 2QE7A 3AB3A 3A36A 1KMHA 2IEZA 5EQTA 2AK2A 3U7HB 3RSLA 1DELA 1QG2A 4JZKA 3ZVRA 4Q1FA 2G0NA 1GDDA 3NBZC 1Q21A 1NG1A 1GNPA 4X8OA 2F43A 1Z3IX 2IC5A 1ZAKA 2WWGA 1ZNZA 4GDFA 1XJQA 2YC2C 3Q72A 4LPKA 5LB4A 4B3DA 5EXTA 1R5NA 1WMSA 1VYUA 2H17A 1N0WA 2CCKA 3CRVA 3BB3A 4RZ3A 121PA 4LPSA 4KYIB 2DR3A 3AVUA 2GCPA 3EZ6A 1E32A 1XCPA 1NSTA 1Z06A 2EW1A 2ZS9A 2O8BB 4QKQA 3VR3A 5CB8A 1S2MA 5FR1A 5J4KA 1E1QD 2NIPA 4ILEA 5J40A 2VP6A 1RYHA 1XD8A 2OEPA 2J46A 4FMDF 4FINA 1KAGA 4MA4A 3A4LA 4OK3A 3SZRA 4QBFA 1G18A 4R2IA 1KKLA 3AGQA 3B13B 2BBWA 4MH0R 2P67A 2ZSEA 3K0FA 1XPUA 2J5XA 1X3SA 1OH8A 4KFSA 2GHIA 2A5YB 2IYRA 2X2FA 4Z1MA 1OH6A 2EFHB 4C4PA 2QPOA 3U3MA 4ZIRB 4TQAA 4TZ0A 2ZUDA 4UJ3A 4F4IA 5FPSA 3KXKA 1YR6A 4DLSA 1I2DA 3OEEA 2L0XA 1DE0A 1N25A 3U61B 2ZS7A 4KVAA 5DHAA 4A4DA 3VHLB 2VSXA 5J4HA 4RD6A 3AF1A 3WP1B 4DEYA 3GLGA 1XPRA 1T9HA 1XWIA 1KO7A 2OBNA 1VKJA 4B43A 1DO2A 2JJ8A 3WY9A 3WHKA 5G41A 4DB2A 2JLRA 3KJHA 1GAJA 4CVNA 3BD9A 3UMSA 1GKUB 4NBSA 1AA9A 1UJ2A 2FG5A 4LV6A 5IT5A 3SQWA 4FMDB 4XVUA 1COWD 3C4JA 5AUOB 1E1RD 2OAP1 2J9RA 2JATA 1VYTA 4KLZA 2IS4A 4XIGS 2GJ8A 5BN5A 3JZMA 2IX3A 1E2QA 3ZDQA 5J4VA 3A1WA 1NMXA 2O8CA 5BN4A 1II8B 3BJIC 3D8BA 2P2LA 3H1TA 1E2FA 3B60A 3NG1A 1KDOA 2HJVA 1NN1A 2KSQA 3P4YA 3W3AA 1QVRA 4FCWA 3WYGA 5CITA 4KAXA 1G7TA 1UM8A 2NO1A 1E3MA 2QNRA 1NLZA 3FHCB 4WAUA 4DDUA 3KB1A 4JLDA 1SXJB 1FP7A 4MGYR 1MO6A 2YOHA 1R0WA 2F9LA 3EWAA 1KK0A 2FH5B 4KCGA 2FSFA 1K8RA 2OXCA 4JYBA 4V03A 4P32A 4TMZA 2C8VA 4DLUA 4HLUC 3THYA 2BBSA 3GEIA 3VTKA 5JEEA 5L8VA 1AS2A 2FE4A 3A1TA 2A30A 2I1QA 4WBSA 3CX7A 1VCIA 3D7MA 2AFIE 3U6KA 2GZDA 2UZ3A 5FTNA 2HUPA 4DHEA 5KPJA 5FOUA 1G5RA 2BMFA 3V4FA 2AKAB 5E3HA 1XPOA 1E9EA 2OXRA 2CEAA 3BFVA 3T1VA 1Y63A 3O8BA 1S3GA 1MO3A 2H8KA 2V55B 3HU2A 3VR5A 1OXUA 4C30A 4D4JA 1I4TD 1KZGB 1N6NA 1YHNA 3AH8A 5FBQB 3RWMB 5P21A 4BEJA 4DSOA 5CJPA 3VR2A 2IXFA 3IDQA 2QSYA 5FL3A 2PCJA 1NMYA 2GF0A 3I72A 1Z07A 1U0JA 3KFVA 4FIDA 4HI0E 4AKHA 2ZRCA 4TWZA 5DGXA 2QENA 4YMUA 1UEIA 2IW3A 3DPUA 4W5WA 2CNWD 3THXB 2XAUA 3W6NA 2VHTA 1QHIA 3A6PC 1OV4A 2GETA 2PZEA 3A1SA 2HF8A 4JMPA 1IY1A 621PA 1BS1A 5B2ZA 5HZKA 1XEXA 4XH9B 1ZUIA 1FTNA 3TBKA 2YKGA 3K8YA 2HCBA 4BLPA 1NL3A 1P9WA 4US2R 2VBCA 3KQNA 2PH1A 1P72A 2C03A 1IY2A 1Z0KA 3L0IB 4JJZA
chains in the Genus database with same CATH superfamily
3G0CA 3HJFA 2O9JA 3ZHVA 3KYJB 4OHWA 5J1SB 3FBGA 2I99A 3QXJA 2NU9B 4WACA 3QTBA 2ACKA 2YUTA 3G59A 1ZSYA 3Q7PA 2PHZA 3IE0A 3D9QX 1T8UA 5K03A 4B82A 1HX7A 4H08A 4JR1A 1N9GB 3OJWA 3AZOA 5CAEB 4UVHA 4IHAA 3R3ZA 1D9XA 4HRVA 3UT5B 1KEVA 3OZXA 3U7QA 3BB1A 4RSHA 3DMFA 3PBKA 2I0FA 3ZJ4A 1EE1A 1RYNA 2EVWX 1PAUA 4HB2A 4RIIA 4C9BA 2J9GA 4DJTA 2WZQA 3GGSA 2ZYVX 1PWHA 2HRDA 2ZAGA 3B2EA 3ZS8A 4DA9A 4DLWA 2C7VA 1HPLA 2WEKA 3TVDA 1QK5A 1G3MA 3O1IC 5IWCA 3KT3A 2QYOA 4JGIA 5K4GA 2QKYA 3AUTA 2EKDA 2Q3LA 1PW5A 4A2WA 1YJQA 1HDRA 5AVJA 1O4VA 3OZVA 4XIIA 1TZJA 5CDSA 1G4AE 3N0TA 2WHRA 3AESB 4TKVB 1F7VA 5EGSA 1Y8QB 1QFXA 2P4HX 1FTQA 1Z2NX 2N1MA 2CUKA 4ZQEA 4R16A 2W70A 1FK8A 3D8SA 4FHZA 4RZSA 3IL2A 1OLXA 1XZPA 4QD3A 3OPMA 3SFZA 1TVKB 1N2EA 2Z3WA 1ZK1A 5GZ6A 1M76A 5EKSA 2J08A 4BMZA 2QTVB 2GUGA 1LBSA 3KE8A 1BYIA 2ECOA 4QYWA 1USIA 4CUKA 2XNDA 3S4YA 3W2TA 721PA 3TLMA 3MRTA 4XSHA 1JVSA 3LKZA 1L7EA 4UBJA 3RNLA 4BY9E 4FPXA 1SEVA 2ODTX 4DANA 3A3YA 1NR7A 1Q0HA 3BXFA 3FYDA 3SDBA 1RXWA 1CQWA 3UAWA 3UUGA 1RLTA 3QI2A 3ZKWA 2ST1A 1DG1G 3QH4A 2G9VA 2RG1A 3G2JA 5HE9A 4G0UA 1ZH4A 3M89A 5FNVA 1C0KA 3O3OB 4DM4A 4XDYA 1IFXA 1EFPA 1W8DA 5CM8B 3LYUA 1L5MA 1SJ9A 2OP0A 1DBWA 4ARBA 2P0AA 2WNHA 2NPFA 1YZKA 4IINA 3BL5A 2M32A 3K6SB 2O5EA 4MQBA 4P4LA 4POOA 2R5NA 2LD4A 2C78A 3GA7A 4LECA 4QREA 2WJPA 3M5WA 5NULA 5LA6B 3F5MA 3FZYA 1UP7A 3JVIA 5EIAA 5J3JA 4LYJA 3VISA 1B6RA 5HQTA 5ALTA 3QBEA 4DBZA 3K1AA 2BLLA 3LFUA 2AK3A 2BHNA 1HMYA 3GFOA 2XGMA 1TUIA 1J9ZA 1WXXA 2EW2A 3L7OA 5DNEA 2GZAA 1FUUA 3AGPA 3EHEA 3SYRA 3PQ3A 4URWR 2GWRA 1GAEO 2GPBA 2QIPA 3LBHA 4O2BB 4MA0A 2QG4A 5TY0A 3T3GA 2VCEA 1AK1A 1I8TA 1VB3A 5IVKA 2BC9A 3VR4A 1L1RA 2FSHA 3R9WA 2WMNB 1HFJA 3RG2A 4BYMA 5JS7A 3T5MA 4IFTA 2WF8A 3WGHA 5EJMA 3E1GA 5DNCA 4KQ6A 1VHJA 4C6HA 1SULA 3LQ4A 4MIYA 4Z1OA 5F3DA 5A9SA 3HYTA 1J97A 3TR6A 3ISVA 5CM2Z 3HKEA 1OASA 4O4HF 2V3VA 3HXQA 4Q15A 5D3MA 2IT1A 1FFCA 4XB2A 4LYEA 5CTJA 2B30A 1IDOA 4OL0A 1BX0A 1EP3B 1OREA 2CJWB 2EX1A 1XN4A 1QH8B 3HCDA 2H08A 2HJRA 1DKUA 2C8LA 5D1HA 3VOSA 1S3IA 3SBEA 5BQPA 1AQIA 4LVUA 5CPBA 1J70A 4TLMB 1QF7A 3OKFA 4MWBA 2OCXA 1PGPA 1T0HB 3G1WA 3DEHA 4JFRA 4FEYA 4F4UA 4XDHA 3F5SA 4MRRA 1ELOA 1F5SA 2CXTA 3NAZA 4MARA 2QU8A 2A88A 1BQ4A 1Y3IA 1AXEA 2RMKA 2XWPA 4EITA 2HDHA 3GLHE 5CVTA 4CQJA 1XU7A 1T8PA 2ZI4A 4IGIA 4PSVA 4MINA 4UMVA 2OWDA 2COKA 2E21A 1XLVA 1E79A 2CVFA 3GJ0A 3K0CC 2JPDA 1Q1ZA 2SBTA 1TO2E 4MJ7A 4N1AA 5H3LA 1WU8A 4LWOA 2FU5C 4OHKA 4Y2QA 3IIMA 4EGAA 5EHXA 5L3QA 3MWJA 4EI2A 1TM4E 4X65B 4MAAA 4MR9A 3N8IA 1I4LD 4CMKA 3PR3A 2ZDQA 4U5QA 1J07A 4EPYA 1OB2A 4GPTA 2YX1A 4YCLA 3A9VA 4L76A 2G08A 3P96A 2JFHA 3T0FA 1C0EA 1NQWA 3F4KA 1UQTA 2ETVA 3A1DA 2COEA 3FUWA 2Q99A 2J85A 2ERYA 2J3KA 2OQ2A 4Q48A 1CJTC 2VWHA 4HDNA 4FGLA 4XM2A 4DY6A 1F8XA 5LZ4A 4HDMA 2C5BA 1E62A 4MP6A 4JOCA 2FR1A 3SXUB 4Y7CA 3WQBA 5AW3A 3UAGA 3RYHB 4ARZA 2XMCA 3DM5A 3JQ7B 4FJ0A 4A23A 3ZXSA 1ISMA 4BHTA 3TEJA 4BP8A 1HYGA 2X6TA 2GRUA 2EIHA 3QOXA 4CLEA 1GSAA 2I80A 3M5DA 3FYUC 4LE2A 4NBRA 3QF7A 3PVSA 4TRMA 3WLKX 4F8EA 1JYFA 1Q95A 4DLVA 5CIYA 4L0CA 1XX6A 3CKYA 4CG2A 1QS0A 1RQGA 2RDMA 3GPCA 4AIIA 2ZJOA 1U0BB 1FFWA 2E49A 1WW3A 3L1JA 4IWNA 4K6GA 3ODGA 2GM9A 2CK3A 2GO7A 2JAUA 3CO5A 1VB5A 2BTOA 3HM2A 4G65A 4FXPA 3MTBA 4DL9A 1GPUA 5K5EA 3KTFA 2BI8A 3O3MB 2P27A 2P2SA 2OHIA 5K8IA 5IC4A 2RAPA 1YHZA 3KPJA 4S3MA 3C45A 1H4SA 1X9GA 4B75A 3KHKA 2G88A 2AOXA 2V7TA 3DEIA 2TMKA 5AKLA 3ZC3A 4FCTA 4OHMA 5DM1A 1X39A 1M75A 1D2EA 4IDDA 3ST7A 1ODCA 4JN6B 3WSVA 4R1MA 5TF0A 1EVJA 5EJ7A 3I61A 2ILTA 1EFHA 1ULSA 2IZ5A 1YZFA 3M4JA 3WQSB 3N28A 1ZH8A 4J2HA 2C3OA 4NCHA 3R24A 1DKMA 5AXCA 4L4YA 4D0NA 1B6TA 4QLOA 1K97A 4Q7LA 5E8RA 2WTNA 4EKIA 1JRLA 2QE6A 3LP5A 1B0ZA 2H2WA 3R5FA 4YDRA 2RHHA 3KJNA 2GARA 3L1IA 1X7WB 4F8YA 3PR2B 5A2GA 3HY6A 2WFMA 2HRCA 3E5RA 4YQEA 5EXPA 4X7BA 2FHSA 2I7DA 1HFEL 4RHXA 5F76A 3E9RA 3LX8A 3DLPX 4TROA 2RSLA 2A5DA 2IPLA 3B7GA 1VJCA 2BFBA 1WS6A 1XAHA 2GXSA 2DH5A 4UHFA 1O7JA 1ST3A 2MDTA 3NNDA 1OH5A 3VZQA 3OOEA 5MDHA 3V6MA 2QQEA 5A05A 1R0CA 1LTHR 4Q4AB 5AHXA 2R6CA 4ZVQA 4EFNA 5DX0A 1RHUA 1SEPA 2H65A 4OD0A 3ID6C 2YCBA 3GDFA 4G4GA 5GZ3A 3RS3A 1XDBA 4GVPA 1XU4A 3N76A 3O4HA 1KPIA 4C08A 4G0WA 2VT7A 1XCMA 4EFLA 3DONA 2XD9A 3V1YA 2VPXA 1OHHA 1GFSA 2DBRA 4HGRA 1L6IA 3DZGA 1TVMA 3FNGA 3NC1C 3QXSA 2JIZA 1WQ4A 3N3BC 1YA4A 3UY4A 4JI2B 4C0LA 4CM9D 1BMFA 3L6CA 1QCCA 1KSHA 1SR8A 4Z4FA 2REXB 4O8ZA 1SUWA 1YIOA 3U17A 1A76A 3IODA 2XNJA 4INAA 4PPNA 5MN4A 4GOMD 3IO5A 4MV3A 4NULA 4QEZA 4EL0A 1J5PA 3BFXA 4H3KB 4IIFA 4NICA 1GQYA 3K5HA 1K66A 4MQFA 4CL2A 1UF9A 2O2SA 3CWZA 3GLHA 4G2TA 3PV0A 2YQ4A 3ZWOA 1L8AA 2ODPA 1B76A 4TT8A 2O4UX 3L7KA 5CT5A 5AM0A 1IZZA 3JARA 3GEPA 4W8OA 2DQKA 5AP9A 3LY7A 1DTEA 1PZFA 1Y6ZA 5EWMA 2NVUB 4FI3C 4PG6A 4RQBA 4IQGA 4N49A 1FMFA 3D3EA 3TIXB 4D9BA 4KSBA 5DYWA 5JBQA 4FTWA 5FH9A 2I2CA 3OICA 2RB4A 3OIWA 1CJUC 2ZSAA 3NM6B 2JFWA 3A0RB 2WIFA 2ZJAA 3GAZA 3FNBA 5C81A 3B1XA 5ADVA 3ZV3A 1ZRSA 2B9VA 2CGEA 3N2LA 3O1JC 4UVEA 5SYAA 4I1SA 3M33A 1ENOA 3I5XA 1JIJA 1SQSA 4GXNA 1JXMA 1N77A 1KZ6A 4PQYA 4BRSA 4DGQA 4HXEB 3T3DA 2FZ4A 1SUCA 3BGWA 4GXQA 5B3JC 2OQIA 1EM6A 3LYHA 1EX6A 4Y0NA 3C3AA 1NBOA 4H6WA 4TMFA 1ZVVA 1YZYA 3H04A 4MQMA 3NHKA 2OBMA 3N0VA 3D0KA 5IP5A 4TMWA 1BE8A 3EXEA 2ZJ4A 4RY9A 5E4TA 5K51A 1JT9A 2EG5A 1HE4A 5LYYA 2C3YA 4C0QC 4YMTA 4BKUA 2OGTA 1CYDA 1DWPA 2C95A 4Q4LA 4F45A 1OLSA 2EBUA 1M34B 1VRWA 4B3RB 4X66B 1DU4A 1XEWY 1YZGA 1JQBA 2HLNA 4FFMA 4BWGA 1RJDA 3J81A 4KQIA 1KEPA 1U9YA 2QXTA 3ZY3A 2R2AA 2F1KA 1DLIA 3E6AA 3EB9A 2QNBA 2Z30A 3KQOA 1CJSA 2DSNA 3LY5A 3FFAA 3COPA 1K0UA 2B5OA 1A8SA 4L1KA 1UOEA 5LJIA 1RXSA 3OQHA 2FUCA 9MHTA 5JEDA 1IHOA 1JKFA 3PNLA 3W5DA 2W58A 3W5VA 1GNRA 4WMLA 2RFLA 1HQYE 1US8A 4G67A 4JC4A 4QC2A 5EUCA 5IVDA 2QQFA 1GUZA 2G6BA 4WCFA 3CLRC 1TCAA 4YCJA 1T4GA 2QN1A 1ZP6A 1DHTA 5JJCA 3CUSA 1G0OA 3I2KA 4KN6A 3OA0A 3TSCA 3PIIA 2G09A 5EZYA 4DCVA 4KAAA 4BKOA 5LVAA 1XP5A 1V45E 3K0KA 4Q4DA 3RS5A 3P2OA 2CVZA 3O90A 5CDGA 3O9ZA 3DNFA 1TCVA 1NN5A 1J7JA 3UEOA 4BTLA 3NBMA 4M38A 4QUJA 1JPNA 1SB9A 4KRXA 1PR1A 1ND6A 4MTLA 3IVRA 3R7WA 4A03A 1V2GA 1KPHA 2IYQA 4RM3A 2QL9A 3KWMA 4F2WA 4KNVA 4ZT5A 3AVOA 2I4LA 2QQGA 1VBNA 3L4BC 1JAYA 1WBDA 4BOYA 3QBTA 1KVRA 4R3NA 4IGFA 4JQZA 3PQ4A 3H99A 1CUUA 4RW0A 2H00A 4RVOA 1L5HA 3ZHXA 5LNK1 2RD2A 4AMVA 3OSZA 5BNZA 3UMRA 1T35A 3B1WA 2Q0QA 4RWZA 1GU7A 3RT9A 1PS8A 3DTTA 4FHEA 4OFZA 5COQA 3QEAZ 4XOUA 1S8OA 4NYMR 4ETNA 1K8XB 2PXHA 4OJKA 3A6KA 3ER9A 3AF4A 4RLSA 4RPGA 3I2FA 5BSEA 4JYAB 1RBZA 2EGGA 1VPTA 3MCTA 3V33A 4A0RA 5AUNB 4ID3A 4DR4B 2OHHA 5JI3E 1G8HA 2V1XA 2IBSA 4OAOA 1VBKA 4HAXA 1U99A 2I3BA 5FEMA 1T24A 3ANYB 4CQNA 3K09A 2ZYWX 2Q6VA 2XMQA 3PHHA 4P38A 3HHEA 5JNUA 1KQNA 1N34B 1CHNA 1KK1A 1OYYA 2I71A 1TKCA 4FILA 4JLNA 3R3YA 3DG9A 3FPKA 3ZXYA 2JD0A 1BAPA 2X9VA 5JTUA 4AWXA 3IMEA 2H0RA 4GOOD 3VR0A 4C5AA 4LYYA 3GQVA 1DEOA 1CWUA 2SNIE 1TQHA 2VT2A 4XQEA 8AT1A 2CEKA 4KIJA 1JG4A 1X1BA 2Q9AA 2YNMD 2V4ZA 1PR2A 2B83A 2DPLA 3EQ7A 2C2XA 3E05A 4GUDA 3W7AA 1WZNA 2CNKA 1R9GA 3ABIA 2DBVO 1Z4PX 2IXGA 2Y1EA 1P7WA 5JQGA 1QHNA 1M8KA 3LLVA 3TCXB 1DC8A 3WJAA 2VPWA 5D7BA 3E1SA 4C3ZA 1PL8A 4HN9A 4JZYA 3ZV5A 1PK7A 2XOKA 4UHHA 2XAAA 4NV1A 4CLXA 1IMJA 5LZ5A 5C5EA 3IAXA 4K3UA 4RVNA 4WLNA 4Q1EA 3K31A 2GJ9A 3IBTA 1DZ3A 1I13A 5EEGA 4KITB 3CZ9A 3ND7A 5IANA 1Q15A 3AFMA 2PUBA 2ZJ5A 4BGDA 4OQMA 4RJ2A 5C1BA 2IS2A 4PZEA 2B61A 3DT9A 3EK2A 1ZEMA 3DT6A 4NIMA 6PFKA 2WTXA 1V2HE 2ZWVA 5CMLA 2AI2A 3BVPA 3OEYA 2INGX 3CXRA 3PQ5A 3UAXA 1P2FA 1RP1A 2ODWA 3HE3A 2VBGA 5B6PA 4IIVA 1RI5A 2F3SA 2ZM6B 4ARAA 4MCJA 1SVOA 3AI1A 2FX3A 1GL7A 1MDBA 1XEWX 4NZMA 5AW2A 5KTOA 1JDBC 3WLPA 5H59A 1IOZA 3GLIE 1YQ9A 1CUXA 4RC9A 3VDMA 5IDVA 4BDSA 3PQ2A 4TVBA 1XP8A 3QLJA 2V3WA 2OGSA 2Q21A 2X9NA 3FDFA 4GP9A 1G17A 3BXPA 1LWNA 1Y8CA 4G9GA 1Z5NA 4EPTA 3ABOB 4EYEA 2NO7A 4G5QA 4EUHA 2WTMA 3PPWA 5B30A 4C2UA 2P9JA 4OMUA 4DQLA 3RKSA 4CIAA 4A36A 2EIXA 4E1BA 4MQEA 1IAVA 1RBQA 3L6RA 5CJJA 3ZUGA 2EP5A 4BO0A 4CLOA 3CVXA 2Y0PA 2E4VA 3FFWA 4YAUA 1PG5A 1Q83A 2KBEA 3HUEA 4MCHA 4XUDA 4BNKA 1ZUWA 4F3TA 3L8HA 3GK3A 3GC6A 2MYTA 3JD4A 2DUNA 2IELA 4INZA 2PMKA 1A97A 1V47A 3G9XA 2IOFA 1H9AA 1LBTA 4DYDA 2V7BA 1JAIA 1IHDA 5FFNA 4DIOA 3OIYA 2QE7D 4GC5A 1B3BA 4M1YA 2AMLA 4DR1B 4FSXA 5AW4A 1WNTA 2GSDA 4HJRA 2QTAA 2SKEA 1O97D 5LOVA 1BCRB 2B4QA 2X8AA 4FP9A 2NO6A 5JCZA 1PNTA 3KRTA 4WCFC 2LV8A 2VNSA 4LOKA 4EZIA 4LFCB 2C92A 4URZR 2YNMC 4R1TA 1JFRA 4YP7A 5K6RA 1E9CA 2VK1A 1OX4B 4IDCA 3LDUA 1CY6A 4JOSA 1AGNA 2VYVA 4ZAXA 4EHIA 4Z3OA 4MP8A 1HEIA 4R4JA 2C5LA 3P4UA 4PCUA 5KOJB 4L7VA 2QRZA 1QH0A 1LF0A 4LZJA 1D4AA 2QVGA 4C76A 2GF9A 1CY8A 1Y9AA 4L4UA 1BKYA 2REQB 4QUEA 2QX7A 3BULA 4X9XA 2ZIEA 4QO8A 3W5UA 1SC4A 5E38A 3E53A 2F4NA 1VLVA 5A5EA 2EFEB 3GVXA 4EPXA 2L82A 1ZJ6A 4PSAA 2PGJA 4FU0A 4KE6A 5FUYA 4D5EA 1MUUA 5CK5A 5DLQC 3TW8A 3FHTA 2ZYTX 4JLWA 5C51B 2QVBA 4FK8A 5AVOA 4K9PA 4QUAA 3ZD9A 2XODA 1JFTA 5EWJA 1X1TA 4A26A 1U7OA 4V3BA 1VGVA 4ARCA 5JAPA 1J4AA 5CT6A 3UHFA 3FVTA 3NMUF 3HB9A 4PNPA 3FVQA 1LZLA 4ZJPA 1E1CA 1HDZA 1PRYA 4HAIA 1G8MA 5GOZA 4CM8B 1MABB 3FPGA 4M53A 3ANXA 4BQSA 1VE1A 2VDLB 3LRTA 4Q1AA 4EQ6B 3TQCA 4UOZA 1JTFA 3W7BA 4EF6A 5A6SA 5F33A 4CM1A 1DUVG 5HIIA 1F4LA 3EXAA 3HZHA 1AS3A 3PGVA 3V46A 2VI5A 2XIJA 4TTRA 2IWHA 4AJNA 3HB5X 3KEFA 4ZDWA 4HYYA 3CGWA 1U81A 3PEEA 3GEGA 1MR3F 3T7KA 4Q34A 2R85A 3K09C 4NCNA 3GJSA 4RJJA 3ZOKA 2PX8A 3DNMA 3HKCA 2ZDHA 4J8PA 3OEED 4LSZA 1IDN1 3WV4A 3RVBA 5FNVF 1GSHA 4Z4HA 1HG1A 2CNDA 2PH7A 4BNWA 5L40A 4N9WA 3V1KA 4KBGA 1L8QA 3RPEA 3W05A 5IH7A 5IK2A 2CV2A 4RVSA 2ZI9A 2PAAA 3I76A 2M1XA 3DBOB 3HMKA 4K6HA 4NEGA 4O33A 1Z3CA 3ZJUA 1ZG3A 3I3SR 3QELA 1C14A 4P8RA 2WTAA 1EAMA 1O95A 3OM9A 1P0FA 1UUFA 4U5XA 3OE5A 5G4LA 2YYYA 4L6IA 4WNCA 2B8JA 2IZ7A 3LFHA 2JI8A 1FPMA 3NETA 4FLFA 3GVIA 4H3SA 1H3FA 4CGZA 1LU9A 1ORVA 2NT3A 3UW3A 5DHRA 1AD2A 2DECA 3GLIA 2HNBA 1DQRA 3GFPA 4N7BA 4QOSA 4CQMB 3OCZA 2NO5A 1KE2A 3JATA 3FZQA 2KHZA 4H17A 3M6IA 1XN1A 2W2KA 1H3EA 2Y68A 4MW4A 1ZXBA 5HXAA 3DKPA 2P2YA 1KS9A 1XWWA 2ATXA 5LMCA 4NS4A 5J9FA 2AFIB 1ANKA 3FJ1A 4W99A 1XR3A 5C8YB 4PLTA 1U80A 1GSIA 5IWAB 4FI3F 1T6BY 2AFRA 4BUZA 1U0TA 1E9FA 2ALJA 2BIFA 5EOVA 4YRKA 2FMUA 3I32A 4PQGA 4BNTA 3FJYA 2Q4RA 1GG2A 4E3WA 3K6KA 2HNKA 3HCOA 4MVYA 1M2OA 2IGBA 1HTTA 4Z0HO 2VOEA 3VXKA 4G9BA 1YQGA 4F46A 4B74A 1L1QA 3B6ZA 2QL5A 1ZIYA 4QUIA 4F0JA 5I7UA 5TDHA 4CNQA 3MBKA 1ENPA 1U98A 2WJYA 3G0GA 4DUGA 3I5MA 4PWZA 4I81A 4MS3B 1I3KA 1PL7A 3GEEA 4QG3A 2XBUA 4RFLA 3LVQE 4B17A 4QFBA 2AC4A 1KSGA 4M7PA 2A9KA 4Y30A 5ADUS 2E48A 2PSSA 4PICA 3HFGA 5DI9A 2WFZA 2PUHA 3TTVA 3L41A 2C00A 4HAOA 5KYXA 3UANA 3TG2A 1M5RA 3BZUA 2ZS8A 3CN7A 4PGHA 4PYIA 4WOBA 5B55A 1NE7A 3O84A 2OPHA 1IATA 3HNPA 1LSSA 3H17A 2AG6A 4EBFA 4WECA 1F6WA 2Q0XA 3LWNA 1LGYA 3BAZA 4GAEA 2HU8A 2R87A 4ZV7A 5AW5A 2CD9A 5LYJA 4LF9B 3ITEA 2J9FB 3UN1A 1G59A 4JLSA 3DXXA 2HL6A 5C80A 1OXKB 3ADPA 3QQPA 2IYAA 3B6IA 3UOWA 4K1XA 3UMYA 4RFVA 1CS0B 3LDAA 4G01B 1PFUA 2PXAA 2HREA 1NJ1A 3AERA 1L3BA 3FNHA 3I52A 3N05A 1GOTA 3QVUA 4OOEA 5HFAA 5BOVA 5HTOA 3CVUA 4MVJH 4ZV9A 5J4YA 2AF4C 2IX9A 5E2BA 5HBRA 1I2AA 3IUPA 2C0QA 1XHFA 1Y3HA 4LV5B 3RRMA 3AHFA 3G68A 5AW7A 4LNUA 5BQFA 3QX9A 4BNYA 5I7HA 4DCNA 4DSUA 3LY9A 3LFTA 5T8KA 2OL4A 4LZWA 4MVJM 5AH0A 2AC2A 3HO6A 2R4TA 2CVHA 4R1SA 2O3TA 2JH9A 5CB6A 4FZJA 4I4TB 3H1AA 1L7DA 3QBJA 2BP7B 2IZ0A 3AKYA 3LUDA 4LHYA 1C4OA 3X1DA 1OYWA 1ZOLA 1B4DA 1ZCZA 3LPDA 1XJ0A 4H6XA 3WMEA 5KQGA 5MHTA 1T5HX 1XNJA 2IUYA 4E70A 5ISMA 2R8PA 5C53B 3K1YA 5JAMA 4DLZA 3IVXA 1QWOA 1OGYA 3C8MA 4I9HA 1ARZA 2CE7A 4YJFB 5DCYA 4JVNA 1Z45A 2WPDA 3QX7A 2RARA 1ONNA 3U7JA 3ZY6A 4D8VA 2I2DA 2ZSBA 4X95A 2V6FA 5G0WA 5JCXA 2Y9MB 4X71A 4EWLA 2VDWA 2VA9A 4JVMA 4Y67A 5CAEA 1YS1X 1N9GA 3U3JA 4OY3A 3CR7A 3OCUA 3F2IA 4IEIA 3N86A 2VHQA 4BB5A 5ICCA 1I4DD 3UH0A 4G5OA 3D02A 4BX2A 4CNBA 4DMGA 5IKPA 2C1EA 2E7ZA 1ZGGA 3EH2A 3MGAA 5MGNA 1HE8B 5EMKA 2P5UA 1NXPA 2OVBA 4DAOA 1T36A 3O95A 4GWGA 4I7EA 4BLRA 1Q0LA 2BZGA 3F7TA 4CIXA 2V6JA 3IKLA 1FZQA 3EF1A 4B46A 3G9ZA 1WMEA 4ENUA 3IDFA 2ZAIA 2QBYB 1H8HA 1VGQA 3Q5DA 1R6UA 3IOCA 4S2EA 2XYVA 1PNQA 3NEJA 3NB0A 2BM9A 3THSA 3G02A 1QIHA 1IBCA 3QIVA 2GK3A 1I3LA 3UHOA 2PV7A 1NMZA 2QRJA 1M2EA 3B6MA 3RQSA 1ZCFA 2GX6A 4I9UA 4QDXA 4GKVA 1UWCA 4A91A 1A9XB 5EQJB 4DQVA 1V9SA 1QKJA 2PU5A 5FPHA 3WWDA 5BYJA 4BVAA 4R6WA 1X7ZB 3DF7A 4R9RA 1PUIA 2EYQA 2IOQA 3NAMA 3PYLA 1SN7A 1ZK3A 4UCFA 3VJKA 4NE7A 1IB6A 5ILGA 3NYWA 4Y2YA 1EXWA 1QAOA 1RLMA 2Y67A 2JB9A 2I3ZA 3FMIA 4PRZA 3SI7A 1K4KA 3JXEA 4MRMB 3MMZA 4BMPB 5F9HA 2V74B 3R3HA 2DKNA 2BBTA 4KEAA 3FRIA 3W2HA 2H1OA 2GPNA 3NEYA 3PGA1 2XDQB 4WFJA 3TXXA 4PZCA 3K9CA 5DK6A 1S4MA 3FVVA 1N6IA 1U65A 2QRQA 4D3XA 1U1CA 5F12A 5LR6A 1JMVA 1SH7A 4MDHA 3T15A 3EY9A 4KWCA 4X84A 3ZYCA 5ITZB 2VF5X 4BKMA 3K9BA 4BO1A 3OZBA 4XJTA 4UXHA 1NDUA 2FW1A 5KOHB 4G6ZA 4K2HA 3U4CA 1Z0DA 2D0PB 4AXBA 3Q88A 4BMOB 4HOYA 4AUNA 2JFZA 4EJSB 4PG4A 4N5IX 4RHCA 4IP0A 1P77A 3S2IA 3UW1A 3VH2A 2Q29A 2QD4A 3A6LA 2ZATA 1HFWA 1KNQA 3EDCA 3Q9NA 3C1OA 3OX1A 3EGXB 2XA9A 1DO0A 3CLUC 4UQPA 3ROTA 4O6VA 3DXZA 4FHDA 5TRTA 5IKEA 3GG9A 1T5LA 2I2WA 1AKTA 2GF2A 4KG7A 4JA2A 4C20A 1XAJA 5LXTA 5F1KA 5KO2A 4KODA 2P11A 2EZ9A 5JO9A 2LCQA 3VZDA 2DPXA 1C8BA 4PFQA 3BE4A 4O2BA 5T64A 3TOZA 3WIOA 2GN6A 5C3MA 1Y1SA 2HQ1A 3TOCA 1LS6A 4B9AA 4JLAA 5CW2A 3N74A 2CLMB 3V1NA 4ABTA 3PITA 3ZWNA 4LG1A 1A27A 1G7RA 4RJLA 3T9BA 4Y6OA 4BO9A 2EOAA 3TIGA 5J47A 3QUTA 2MT9A 3ROKA 5KQLA 1ECCA 1IXKA 4P1ZA 4O5AA 3TCNA 4YRMA 3QUAA 1K5DA 1QIIA 4YMVA 2BGMA 1M6VA 1F0NA 2QJWA 2YYAA 3GJYA 2W93A 1HC7A 2HWWA 3EYWA 4NFLA 3LRXA 1KL7A 1E2NA 3IJ5A 4KLAA 2P9CA 5DZSA 1XQYA 4BVJA 1ILWA 2W2OA 5DU2A 4D8YA 1AGXA 1Q1AA 4IF6A 2FLKA 2YMQA 4R8RA 6CHYA 1E60A 4WXRA 5D3QA 4YRJA 2BFDB 1SCBA 1SZJG 2YJ4A 3JASB 3TAUA 3KOMA 5K8UA 3OQJA 1LUAA 1XMQB 4YFVA 1CR6A 3UMFA 3KJFA 1S2DA 4B3JA 3PXEA 5G0SA 5EIHA 4UM9B 5T8KC 3UGTA 3A31A 1O9HA 4QJBA 1KR2A 2C3UA 1VZ3A 2B4RO 2VJAA 5EZYF 1RHJA 1T1JA 2A0YA 3IOEA 4KO8A 3LT0A 1ZW6A 2ZYDA 3EARA 3IR7A 1R8QA 3AINA 3D64A 1B8OA 1TECE 3NT5A 1UIMA 3H9EO 1PJ3A 2VZ0A 1NIPA 1A98A 3E84A 2WM2A 4FONA 1SCUB 3DEFA 3G8AA 2WQZA 1SBHA 3H2SA 1EHYA 1Y5LA 2QAGA 3DVLA 4FZRA 3HJHA 2A5GA 3UFBA 2QV7A 4ZCRA 4BMXA 1O77A 1ISHA 1GYQA 1TK9A 2OCDA 2B21A 1OGJA 5ALXA 1XCBA 1ZM7A 3SXUA 2O7VA 4AB1A 3WLJA 3OZAA 5CNIA 3TRIA 2JLBA 3JQ7A 3GV0A 1LX6A 2F00A 4Z7NB 2FPSA 3KE9A 3U80A 1DVRA 2I6TA 1N0IA 3IQWA 3OM0A 1GNQA 1E7SA 5JJIA 5BNTA 3EW7A 4D7AA 1MVLA 2QT9A 5AR1A 1X15A 3Q6IA 2VNAA 4KGZA 4RCYA 2WP0A 4OQ4A 4OQZA 3SIWA 4YV2A 5KJFA 2G04A 1M0SA 1CUIA 2B34A 2ET6A 3PXXA 2OCIA 1FSGA 3PNYA 1M34E 2G9RA 2WFLB 4FEEA 3NUZA 4DQXA 3KKQA 2OY0A 4G5HA 1MOZA 4F6CA 1E3EA 2D4AA 2CJXA 1RI4A 3CRW1 3E9CA 4R8LA 4UXIA 2OENG 3TLYA 3L4SO 3FCUB 4NOKA 4KWEA 1E59A 1PDWA 4NCKA 2IXEA 1QIMA 1VXRA 4IV8A 4MK4A 4P36A 1U8ZA 4CKYA 3FTQA 3SSAA 4E12A 4UQLA 5K8JB 1KEUA 1SVMA 1ZI8A 2HADA 3QHQA 1ZNWA 2J41A 5SZKB 4ZYYA 3HR8A 4YJ3A 4LVCA 3RS7A 1KEKA 3RC9A 3G2NA 3LQYA 4MW9A 2VNIA 3ZDYB 3C3DA 4BNGA 2JHFA 2OWEA 3HA2A 1RZVA 4MYTA 3WGVA 3QWAA 2ECQA 3TLCA 1UEXC 8OHMA 3GARA 1V6AA 2HHLA 2WJIA 3OIDA 5ES3A 5MF6A 1G64A 3QFSA 3I39X 2A6PA 4Z9AA 3H9JA 1BFDA 4E32A 2B1RA 3N2GA 4BFYA 3FKJA 1RMTA 5HDQA 2NAFA 3H1FA 1FE8A 3QU2A 4Q16A 3RO7A 2BYTA 2ZQYA 3H4MA 4D3DA 5JQGF 5AOCA 2W2VA 4LTDA 4F72A 1L7NA 4MXDA 4J0FA 3I58A 2AZDA 2RGDA 3P94A 3V55A 3RHZA 1ULZA 1OBCA 1ZYUA 1XDUA 1T6XA 1X7WA 3H65A 1TJ5A 3LT5A 3V4OA 1EK6A 4BNZA 4BXOB 3FYTA 4WVLA 3WQRA 1AS0A 1H5UA 5JANA 3BFJA 2BM8A 1Q12A 3ZE2B 4TLEA 4LF5B 2MCFA 1HDCA 2BF4A 1UBTS 3B53X 5EJ5A 2QTZA 1Z63A 4YWJA 4FNOA 1GUYA 3ROGA 1N78A 2HXSA 2OMEA 2FP3A 3BEDA 4UFPA 4Q4AA 5BYKA 3EPKA 4R81A 1ZM4A 3GELA 4DILA 3PFKA 4CIDA 2O52A 4OV6B 2F55A 4OAPA 2VDKB 2IL1A 2E4ZA 4GH5A 4O5OA 5C7LO 1CYEA 3BXEA 3R7DA 1V8BA 2QZPA 3C7KA 4LC9A 1QGED 2W11A 2YIVX 3D2CA 4M98A 4QO7A 3RHFA 3I28A 1RRPA 1KI2A 3P9CA 4O3MA 1D09A 2ZIXB 1F0PA 5ENVA 1BH2A 1C30A 2AGVA 3D59A 3SQDA 1ADYA 2WY2D 4AU1A 2XR1A 4RD1A 1TMOA 1U9ZA 4JX8A 1BTOA 1LVHA 4B73A 3EJ6A 1AO0A 2Q2WA 1TMYA 2KYRA 2VP3A 4LMBA 4G23A 5EHQA 2O0JA 4C29A 2TS1A 1CD5A 3KLNA 4PNHA 1UPAA 1XCOA 4FYKA 5G02A 1IRIA 2HEGA 3DBHB 1PS9A 4MUNA 4REQA 1XDSA 4J0HA 1Y8AA 5IZCA 2HKIA 1ML4A 2R7AA 3TQFA 4BLUA 3AJ9A 2JI4A 3CTMA 5IJ9A 2VXYA 1E2PA 1YOBA 2Q4TA 3CJTA 3IAS6 4EPWA 4JVSB 3KQHA 1G2IA 3ELUA 1ISFA 1H2YA 1XNQB 7MHTA 1O0BA 3PFFA 4YR9A 5E4JA 2QAJA 2GTPA 4R0NA 1ADGA 1J2JA 1F2UB 1I33A 1ZNQO 3HP1A 3HABA 4HNAA 4R5MA 1KXZA 2Q5QA 2ZE7A 2ZIVB 4BZPA 1U31A 1VC2A 2XJ9A 4ZVVA 1BROA 1Q3HA 5HKLA 4YRGA 4GQIA 3VUEA 2NP7A 4YMGA 1XA4A 4KMRA 4EKDA 2DKOA 2XUQA 3QJ5A 4G1CA 5M3BA 4B2PA 2W6ID 4XTCS 1M54A 1E77A 1EGQA 1L4GA 1N0VC 3H5AA 4QDZA 1YS6A 2WIDA 4BS9A 1D7OA 3VO2A 3U0VA 2GA9A 5ERGB 3VNRA 3HUUA 5CFMA 3RVPA 1E3JA 4ZODA 2H4JA 5FUQA 4TXJA 1MT0A 1WCIB 2IY8A 4LYFA 1MOPA 3W2EA 3CRQA 1W5EA 2IDKA 4FMCF 5KHOC 2R66A 1KZ9A 4OP3A 1RCFA 2VR1A 4TN5A 3EIOA 4OP1A 5CVJA 2AI3A 3DHYA 1Y8RA 1U2ZA 1EHIA 1ZJ5A 2GMWA 3QSYA 1EP9A 1M34A 1VKHA 1E1QA 1GM5A 1H2WA 1MENA 3SNKA 4DSAA 3M6WA 3L7CA 2H0QA 2GHTA 1H23A 2R6DA 5JZMA 1EX7A 2QAGC 1I1QB 1P1IA 3D0RA 1LBHA 5H3CA 3L6UA 1MX3A 4YAOA 5DGTA 4K6FA 4ZAVA 1OU0A 1ZHFA 5ALJA 1Z18A 3PFIA 2O8EA 2CY0A 3OIGA 2WSIA 3RUAA 1NVEA 4WWHA 4OLAA 1I4OA 2HT1A 2XUHA 4YHBA 1A5ZA 4F71A 3LHDA 5B4VA 1LQTA 1YZHA 2XRMA 4R7TA 2VJCA 4K6KA 1PN3A 2EXXA 2X0JA 3Q8XB 5FWNA 1YZUA 2IHKA 5E2AA 2X8JB 4NU6A 2DUUA 3JWJA 3FPEA 3G2MA 4OI0A 4Q7QA 5DCLA 1X8XA 4A8JB 2JCBA 5C8ZA 2RONA 4IJMA 3KU4A 2VTVA 1GILA 3DFUA 5B1HA 4DWVA 5JADA 2PYZA 4IOLA 1GKIA 1O5OA 4S12A 3JCZA 2F90A 2DG2A 3LBIA 1TPZA 4J3FA 2R47A 3J7TA 3E7PA 2G1KA 4NY1A 4RLHA 1T5DX 1MRZA 1NZFA 1X80A 3BMXA 4LHEA 2H0AA 1CP2A 3UFXB 6YASA 1KEWA 5F4ZA 3X2EA 1P5FA 3NNNA 3QW4B 3W6PA 3R20A 4LX0A 2OHGA 4RK7A 2V4UA 3SQMA 1P80A 4UFNA 3T3IA 4BEBA 2IP1A 4F3CA 1EFTA 1QG4A 1UANA 3FHOA 3GUVA 3U3XA 1WB9A 1GZ7A 1QGUA 4DJAA 1H4QA 2FUKA 2IQIA 1W5AA 3F9IA 3LCJA 1S7CA 3VJRA 2YHAA 1KKUA 5DI3B 3QG5A 3OZIA 4LSMA 1N1DA 1VLLA 4TZ6A 4FE3A 2XMPA 5M2QA