4UULA

Apo trichomonas vaginalis lactate dehydrogenase l91r
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
334
structure length
334
Chain Sequence
SEAAHVLITGAAGQIGYILSHWIASGELYGDRQVYLHLLDIPPAMNRLTALTMELEDCAFPHLAGFVATTDPKAAFKDIDCAFLVASMPRKPGQVRADLISSNSVIFKNTGEYLSKWAKPSVKVLVIGNPDNTNCEIAMLHAKNLKPENFSSLSMLDQNRAYYEVASKLGVDVKDVHDIIVWGNHGESMVADLTQATFTKEGKTQKVVDVLDHDYVFDTFFKKIGHRAWDILEHRGFTSAASPTKAAIQHMKAWLFGTAPGEVLSMGIPVPEGNPYGIKPGVVFSFPCNVDKEGKIHVVEGFKVNDWLREKLDFTEKDLFHEKEIALNHLAQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Gradual Neofunctionalization in the Convergent Evolution of Trichomonad Lactate and Malate Dehydrogenases.
pubmed doi rcsb
molecule keywords L-LACTATE DEHYDROGENASE
molecule tags Oxidoreductase
source organism Trichomonas vaginalis
total genus 114
structure length 334
sequence length 334
chains with identical sequence B
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4uulA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4uulA02
5BNFA 1Y6JA 2CDCA 3KVOA 2YY7A 1NR7A 4GSKA 3ITDA 4P4GA 3PJFA 3DBRA 5TQVA 1PR3A 2IXBA 4J1QA 2B4QA 4EI2A 4DC1A 1B3RA 4J4HA 1R6DA 4BIIA 3WMXA 2EW2A 3EW7A 4YRDA 3GEDA 4E5YA 3Q6IA 1SEPA 5DNAA 3S1LA 3I9OA 1E3IA 3FBGA 1F06A 2C20A 3K31A 7MDHA 2POQX 1YGYA 1LDYA 3KLMX 4FFOA 3HHPA 1PEDA 3AI2A 3ONDA 5A5FA 3TZHA 3A1NA 2NVUB 3I6QA 3B20A 1W6UA 4GAEA 1PZEA 2FSSA 2W2KA 4RCVA 5JFOA 3A4VA 3D3WB 1ZK2A 5T67A 3CMCO 3BYZA 2AEJA 2X0RA 1FXSA 1K6XA 4BO3A 4RVUA 4Z3DA 1H0KA 4FS3A 4QTZA 4H16A 4OIMA 3PZBA 3W6ZA 4YAGA 4UEKA 2B0JA 2P4HX 1E1KA 4HFNA 4RVFA 5CAEA 4DMMA 1G0NA 4RORA 1NNUA 5BSFA 3JQ8A 4CR7A 4PRKA 2DTDA 1EQUA 1D1TA 3JQ9C 3JD4A 3DHYA 3EZLA 1Z82A 4TWRA 3RIHA 5TX7A 1PQPA 5G0VA 2B37A 5H82A 4CMCA 1LI4A 2GERA 4BOYA 3W4KA 3DBHB 3DZKA 5CEEA 1NQTA 1DIHA 1K89A 4P8RA 4J9UE 3KHUA 2EP5A 4HWKA 1LDGA 4HBGA 4J91A 1ZK0A 4IMRA 1BHSA 3QWAA 1ZXBA 3GUYA 3HDQA 4U6SA 2FP4A 2IODA 3GDFA 2GD1O 2CSUA 4EJ6A 1A72A 2ZATA 4F6CA 1KEPA 3A28A 5T8KC 1BW9A 2W4QA 4LMRA 1VI2A 1J0XO 5IDWA 4IDDA 3CEAA 3H7AA 4A26A 5C7IO 2Q2VA 3BHJA 5FYDA 3OIDA 1HLPA 3ANMA 3UCFA 4B3HA 1P0CA 2CY0A 3QVOA 3KXDA 4LISA 3ETEA 5AOVA 3TDKA 3TL2A 3PDJA 2EXXA 4RLHA 3WNVA 5LDHA 4UVGA 1HDRA 4Y6PA 2EWMA 3R1IA 1QYWA 1XA0A 4J4BA 4O59O 4R41A 2TMDA 4IJKA 1X15A 3SEFA 2AQHA 1DLIA 4ND4A 3F46A 1BDBA 4J16A 1B3BA 2HRZA 1EFLA 5LDGA 3BTSA 3U5TA 1T2FA 4FR5A 2AG5A 1YE3A 3JYNA 4B3IA 3DHNA 3BA1A 1ISFA 1VRWA 8ADHA 3PJEA 3OFSA 2DTXA 2PD3A 4RO0A 1S7CA 2O3QA 4BB5A 1H93A 1OBFO 4DYVA 2Q46A 2V6FA 4J7CA 4MP8A 2VUSA 3DAGA 4YAIA 1YO6A 3V1TC 1Y8QA 2B4RO 3GEGA 2PH5A 3B70A 2CDBA 3FN4A 3RUCA 3HADA 1K6JA 2FY8A 4A03A 1D1SA 4I1IA 5TS3A 1FJHA 4BO7A 1I30A 1AXGA 2EEZA 4EEZA 1UDCA 1MG5A 3E1KA 3IMFA 1Y8RB 5F21A 1I32A 1MGOA 1DC6A 4PIVA 5HA5A 2FMUA 2PTGA 1HSZA 3ROMA 1UAGA 1I2ZA 1R4NB 1SEVA 1KVRA 3RAJA 3ZU3A 5EJ2A 1N9GB 5GY7A 4NG5A 5C3MA 2WJPA 3GMSA 3MEQA 1PSDA 5ITWA 5KKCA 3L0DA 1YXMA 1QG6A 2IEDA 2FSVA 2HUNA 1A9YA 4AJPA 2DKNA 4OM8A 2ZTUA 4HV4A 1CEQA 2QW8A 5AXBA 4WASA 5BSHA 1PGOA 1LDBA 1UXJA 1XLTA 2HAEA 3INTA 1Y1PA 1EUZA 2C2XA 3WQRA 4D44A 3PDUA 4BNYA 3COSA 3AY3A 4XR9A 4B4OA 2CF5A 4JBGA 4L74A 4R9RA 3K96A 1AE1A 5BR7A 1NYTA 5COBA 3GT0A 2OXIA 2VWPA 1O0SA 4ALNA 1GZ6A 5A06A 4AJLA 2P5YA 4D0RA 3D4NA 2BELA 5DOZA 1LRKA 4QEDA 3PQDA 1I5RA 2ZJ1A 3GZ4A 3H8VA 3D5QA 1D8AA 4CM4B 1ONPA 5G4LA 1ZIDA 5HM8A 1EEHA 1GPJA 2X1HA 3QA9A 2HMTA 1OC2A 1KOLA 3TWOA 3O38A 3W8FA 5G0UA 5U9CA 1SNYA 2QHXA 2I66A 1ISMA 4UULA 1PR9A 2PZLA 4ND5A 1A27A 2QG4A 3TNLA 5F3RA 3RC1A 1WZEA 4IJUA 3PHGA 1ONOA 2FRDA 3GDOA 3U4CA 1NAHA 4ALKA 1J6UA 3JQDA 2YFQA 1PJSA 1CRWG 4R5HA 3MCVA 4RVDA 3LC2O 4E4YA 6LDHA 4WLNA 5JBIA 3FF4A 3H3FA 4EUFA 3BMCB 5A3JA 1PIWA 2IXAA 1DEHA 5BT9A 4S3MA 2J6IA 2EJVA 1KIFA 4IM7A 1N1GA 3HB4X 4N5LA 3ZWVA 1WDLA 3LU1A 4W4TA 3FRJA 1JAXA 2GASA 3VH3A 2HQ1A 3S2GA 3TZKA 1YH3A 3UICA 4KP7A 3I9LA 4J0EA 3ZV5A 4E5NA 1I8TA 1GZ4A 3MJTA 3I3OA 4MVJF 1QYCA 2JFHA 1NFFA 3GA0A 2VRCD 3ABIA 4CMEC 1R0LA 4DIFA 4J1TA 1GCUA 4ALMA 3O8QB 4CMJA 3PXXA 4OSOA 1WAMA 2QQ5A 2NNLD 3JD3A 3QWBA 4K1LA 4AJOA 1XELA 5KVSA 3K2EA 4NK4A 1X0VA 3S55A 5JY6A 4M1QA 4W9NA 4WOJA 3KYDA 1HE5A 3AW9A 2VHYA 4DLBA 1GDHA 3FCOA 2EGHA 4IXTA 1PS0A 4DQUA 3ICCA 4RDHA 3ZHZA 3MTJA 1U8XX 3GRKA 1P1IA 2VYVD 1BTOA 4IPTA 4IQ8A 3I5MA 3U9LA 3GY0A 3ZNPA 1IY8A 3DMTC 1BXGB 3RI3A 3PJDA 1ZEJA 4E2ZA 3LT1A 3C8MA 2NU7A 2P2SA 3DOCA 2AQIA 4UVIA 1ZK4A 1Q1NA 4II3A 1PGPA 3EDMA 1DIAA 2WDZA 4UEJA 3G1UA 4FFNA 3TF5A 3G79A 1XDWA 5J23A 1JKIA 4J90A 3VVCA 3UXYA 3UH1A 4CPDA 2DBRA 1MLDA 1XG5A 1DFHA 4DQVA 1ZSYA 1E7RA 2QX7A 3GNQA 2P91A 3HUDA 1FDSA 1ADGA 3OEWA 4WLVA 4Q3DA 4BS9A 3NYWA 1Q7GA 2GN6A 3K2BA 4KWIA 5CG1A 1KEUA 3MJEA 2D4AA 1UZNA 4RDIA 3FHLA 3K9QO 3MZ0A 1OZAA 3C85A 3ZV4A 2OP1A 3HQ4O 2Q3EA 4BGEA 3M2PA 2A4KA 4CV3A 3NT5A 3WR5A 4QX6A 3DZFA 3PWKA 2D2IA 4YAEA 1ZVMA 3OIFA 1KVUA 4PLTA 4YPOA 3RFTA 2ZTMA 3ONFA 1WZIA 3PHLA 4GX1A 3DMYA 1XHLA 2VHWA 3JQBC 1U28A 2A94A 3QW2A 3SLGA 4DUPA 1EE2A 1AHIA 3I83A 3U3XA 5G0TA 4FOOA 1EDZA 1LTHR 3AUUA 3JTMA 4IMPA 1GAEO 2OBYA 1PJCA 3IDSA 3ZU4A 2Q1TA 1HDXA 4B4VA 4KMSA 2NTNA 4BMNA 4CQMA 4GKVA 3JD1A 2ZJ0A 2VNAA 4RZIA 1D4FA 3SLKA 1KETA 3TOXA 1I24A 1SZJG 4HFRA 2VYVA 1RM4A 2Q1WA 4PZCA 1NP3A 4UUMA 4ALJA 4J3FA 3NDRA 1PS9A 1N1EA 2YV3A 3L07A 2HJRA 1H6BA 1PWXA 3AFNA 1EVIA 5IXSA 4WLUA 1V3UA 4LCEA 5ER6A 4TRRA 3RUHA 3QHAA 3X2FA 2V6BA 4FJ0A 4U5QA 3WYBA 3DZIA 3LF1A 2QYTA 1E7YA 4FIZA 1ONNA 5HRUA 1TT5B 3WXBA 4RQUA 3JYQA 4MO2A 2X9GA 4UUOA 2A92A 2B69A 1NASA 3IIEA 3W1VA 3AOEC 1TLTA 4ESOA 1SCUA 4Y9DA 1LDEA 5G4KA 5TSDA 5JO0A 1NPDA 1QKIA 2ZB8A 4HY3A 4RF3A 4RVSA 2XPCA 1XWFA 3JSAA 4J43A 2BMAA 3OJOA 1V6AA 4JX8A 4OXNA 3I9KA 3ZDFA 4HUJA 4PFJA 5DF1A 5L4LA 4AG3A 4XA8A 3ENNA 3UW3A 4IJVA 1E92A 3W4IA 3BTVA 4Z9FA 4CODB 2JCYA 1HRDA 2OFPA 1PGJA 5JCJA 3CE6A 5IZCA 4LK3A 3ZWBA 4OO3A 3WX0A 3LZ6A 2E48A 4WK6A 3RBXA 6ADHA 4ZQEA 3UFXA 3ZWAA 1SB8A 1DOHA 2VRBA 4QO7A 2PH3A 2J3KA 4D0SA 1GQ2A 1P44A 1P1KA 4R1TA 1XSEA 3W4JA 5T6BA 4GX0A 4G5HA 2E49A 2D1YA 2VYNA 3I52A 4RF5A 4Z6KA 3CKYA 1X1EA 1BVUA 2WD7A 3AWDA 4K6FA 4CMHA 1U4OA 1SO8A 3MWEB 3QWIA 1B16A 4CQLA 3LQFA 2OGUA 4WJZA 2RAFA 4XX0A 3HFGA 3ZWMA 4D3SA 4BNTA 1E7MA 1IHYA 1KVTA 3L6OO 4W7HA 4YJHA 3RCBA 4BMVA 2LDBA 3KRTA 1V3VA 4AJHA 3KLPX 3KM0A 2YFHA 3LT2A 5TJ9A 1GYRA 4IXWA 1SB9A 1YB4A 2EV9A 3GFGA 3WIDA 3AY6A 5HWSA 4IDEA 4CM9D 4WCDA 1ULSA 3KEOA 3D64A 3OHSX 1B7GO 3L77A 4I8XA 4L4SA 4OMUA 5TGDA 5L40A 2Q2WA 4JQCA 3C1AA 4K6CA 1GD1O 3HN7A 4R5MA 1HWYA 1PJTA 4FPXA 5IG2A 1EUDA 4J2OA 4BGVA 2ILTA 3AM5A 5THQA 1P1HA 4R01A 3GQVA 4B79A 5TIIA 4GX5A 3D1LA 2I3GA 2IYPA 2DC1A 3ZHXA 2EKLA 3GVHA 5F1OA 1ZW1A 2QRJA 2OORA 2LDXA 4XGNA 5ADHA 1UP6A 3BMNA 3T7EA 3WGIA 3LVFO 4A2CA 1F12A 1Z6ZA 5THKA 1O94A 1XU9A 3VHRA 4BNUA 1MFZA 2P4QA 1JKFA 1ZO8A 1IULA 4NFHA 4OGWA 4TKLA 2PGJA 5DN9A 4EBFA 1U5AA 3S2IA 1O8CA 4CUJA 3DAPA 2NUAA 3PGXA 2JD2A 1E6WA 1MP0A 4U7WA 4NMHA 3OETA 1X7HA 1ORRA 3JYLA 2Y1OA 4CLOB 4JCOA 5L4NA 4B7XA 1DLJA 4WLEA 5AXCA 4ND3A 3DONA 2WYWA 2CD9A 1TEHA 1E7SA 2Q1SA 5G2OA 1HLDA 1DC3A 4R4JA 2IZ0A 2HRBA 3P2OA 1PJ4A 2X5KO 4ITUA 1HDGO 3PWZA 2V6MA 1NWHA 2EIHA 1U7HA 2DU8A 3CTMA 3GGOA 3TZQA 2AEFA 1T2DA 4M49A 1QORA 4IS3A 4FBGA 1JW9B 2FPPA 4CMBA 4Q3NA 2Z5LA 4HFJA 3F6YA 3JQAA 4D43A 4DXHA 3NTRA 1XQ6A 4ZICA 3ANLA 1PJ3A 4JN6B 1GL3A 3F4BA 4WCFA 3QJ5A 4FDAA 2C7GA 3Q0EA 5L7YA 4CJXA 2C07A 1A7AA 5TC4A 3DBLB 1LDMA 5FFFA 4GKBA 4MVJA 3GDGA 1GUFA 4EUHA 3KV3O 2UDPA 4JBHA 2BFPA 1LX6A 1EDOA 3RVDA 4ZA2A 1XR3A 4L76A 4OKNA 5KKAA 4XD2A 1V8BA 3ZGYA 3OBBA 3DB2A 3L6EA 4XJTA 1N7GA 1H2HA 3NDIA 7ADHA 3TRIA 1B15A 3KETA 2FR0A 1I36A 3PWSA 2NVBA 3ROPA 5DP2A 3JQGB 4BGIA 3FNHA 2G0TA 4LRTB 3EGOA 5CDTA 5L45A 2OP0A 1M75A 4PLYA 1V35A 4MIOA 4TMFA 4J1NA 2BLLA 2C29D 1ISIA 4GSLA 4KZPA 2QYSA 1YBVA 1UZMA 1DJNA 4IBOA 1LRJA 4KUHA 4CUKA 4BNXA 2GN8A 3F47A 4BB6A 2V6GA 3DZJA 3HG7A 4YJFA 1GFSA 2ET6A 3WJ7A 2HSDA 3STHA 3RFVA 3WFJA 2PFGA 1DB3A 4IQGA 3SX2A 3JQFA 3RD5A 5F5NA 5BSEA 2CUKA 3HDJA 4W7IA 1DPGA 4CMKA 2O7QA 1R37A 4GL4A 4JP2A 1X7GA 2X6TA 1ZJYA 1ENZA 1Y5MA 4ONEA 1M66A 3SC6A 4F6LA 3KEQA 1IHXA 2Y1FA 2YUTA 1E1MA 1XEAA 1EMDA 4R3NA 1G1AA 3Q2IA 1VL6A 4YDRA 3H5NA 1GTMA 1HEUA 1EVZA 1UXHA 2JAPA 4KUEA 4PRLA 4DREA 4H3VA 3GVIA 5IFLA 4XGKA 2BI8A 5JNLA 5CDSA 2OMEA 2FPGA 1HYHA 4YB8A 3WLEA 5I9LA 1ADFA 2GGSA 2JFGA 1NAIA 3V2HA 5JAIA 1YOVB 3U4DA 1HSOA 1CQJA 4MIEA 1UP4A 1XIVA 3N58A 4UUNA 1NM5A 1HYEA 3JD2A 1K6IA 5CG2A 2Q4BA 3DTTA 4B7UA 5GZ3A 1ADBA 2PY6A 3NV9A 2PGLA 5ENVA 4G81A 4NK5A 3WOHA 1OAAA 2X7HA 3V1UA 3NAQA 2JKVA 4CL8A 4BHTA 1HT0A 5ES3A 2C7VA 3ZWPA 3C7AA 1E5QA 1LC0A 4X54A 4U0JA 2HMSA 2X0JA 4IDCA 3GHHA 4DRYA 5JMWA 1AXEA 3G49A 4IUYA 4O63O 3ZWNA 4E3ZA 4EITA 1ZCJA 1HZJA 2XXJA 3MJVA 2ZQYA 4MVJM 4C4OA 3PFFA 4CMAA 3OA2A 1QSGA 4EJ0A 2VZ0A 3QVWA 3T4EA 4CV1A 2O23A 1Y5RA 4J6FA 4QFCA 3DZHA 4XQCA 1DC4A 3VZPA 3ADOA 4FFRA 3HNPA 4XEHA 4BO0A 5ITVA 1T25A 2NV6A 3FWZA 4JGBA 1V3TA 4BUCA 3DXFA 1I01A 4J49A 4E2WA 4YACA 1PZGA 1E3WB 4MOWA 5IDXA 8LDHA 4XQGA 3GK3A 1HZZA 2VT2A 2X9NA 4RL6A 2JHFA 3VZRA 3UUWA 4IDBA 4E5MA 3BMQB 1H9AA 1UDBA 1PTJA 4W9NC 1R16A 4DQXA 3GC6A 2DBVO 4MKZA 2JCVA 1NR1A 1D7OA 2NM0A 2AE2A 3Q1LA 3PYLA 5A1TA 2O2SA 4Y98A 4GGOA 3SXPA 4CLRB 4LRSB 3AI3A 1HXHA 3ZNOA 4QFDA 4BKOA 2DBZA 1VC2A 3CXRA 1Z7BA 1DJQA 3GG2A 4NPCA 4C7KA 3HB5X 4DBZA 3DL2A 4ZQFA 3DBVO 3W6UA 4WLFA 4IDAA 2GLXA 4CLXA 4FFMA 3PIDA 3GMDA 2CF6A 4G2NA 3ASVA 3DOJA 3BTUA 4GWGA 4C7JA 1UXKA 4QSMA 1DHTA 4XGIA 1YL6A 1WMBA 3E03A 5EERA 1B8UA 5TRTA 1E77A 2C54A 2HJSA 3CMMA 4LCJA 3WSWA 3WYEA 5L4SA 4U0KA 1WDKA 2JL1A 4HKTA 3NTOA 2H9IA 3HFSA 1FDTA 5EQDA 5CFZA 1NPYA 2DAPA 2UUPA 2YYYA 3ZV3A 1Q0QA 2R00C 3RSHA 5F1KA 3PTZA 1GY8A 3CSDA 1Y7TA 3JQ6A 2BRUA 3IP1A 2G5CA 2YHIB 2EKQA 2OL4A 4R1UA 3IJRA 1AUPA 4RPGA 4HNGA 5DDIP 3VH1A 4GLOA 1XKQA 4Q39A 4R16A 3RASA 1UJMA 4ZQBA 5A9SA 1QYXA 2X9VA 1Q0LA 4FJ2A 4FFPA 4Q3EA 1C1DB 3TSCA 4LVUA 3WQQA 4ZQHA 5EN4A 3GNSA 3MJ4A 5HS4A 4BL5A 1BXZA 4KQXA 4DVJA 4A5OA 4WKGA 4WEOA 2Y67A 3WBBA 1LSOA 2E82A 4XWYA 5JPIA 4OYRA 2O3UA 2D5CA 2O4UX 3KBOA 1A4IA 4E5PA 4UVEA 2IE0A 4N54A 4AFNA 3WFIA 4YEDA 3ZNNA 4I5DA 3GPDG 5IN5A 1Z73A 5EESA 3IUSA 3MTGA 5I8ZA 3C7DB 2J8ZA 3KSDO 1ML3A 4B8WA 3M1AA 3JD0A 4EDFA 3RKUA 3PEFA 3DDNA 3VKUA 1KY4A 1X13A 2ZTLA 3CH6A 3R6DA 1SOWA 1LJ8A 2W8ZA 1QLJA 4R1SA 1ZEMA 2PLAA 2ZYDA 5CDUA 5FF9A 3E82A 4YBZA 2WTBA 2RHCA 5L3ZA 3H4VA 2GZ3A 2Z1MA 4JROA 4D41A 2Z1NA 1ZZEA 3ZV6A 3OA0A 4YJGB 3WTBA 2Q2QA 3E5RA 4GBJA 1OC4A 2YV1A 2DM6A 1EK5A 1A71A 4D42A 3TOZA 5CDGA 5KJFA 1GUZA 4IQ0A 3F5QA 4URFA 2CMDA 2JCXA 5L9AA 5TT0A 3UOGA 3GGPA 3O9ZA 1G0OA 4AJ2A 4FOSA 1PQUA 1WNTA 3LT0A 1UXGA 4BO4A 3ZWOA 2W2LA 2VN8A 4BVAA 4K9DA 4PLWA 1YRLA 1R0KA 2J5QA 1O95A 3INRA 1T2EA 4B4UA 5IZCC 1DAOA 4QUKA 1DIGA 1PJQA 3PHIA 4NFSA 3FWNA 4QXMA 3E9NA 4GGPA 4I5GA 1F0YA 1H6DA 1DRVA 1F14A 2FZWA 3JQ7B 3E9MA 4RQTA 3V8BA 4R1NA 1ZK3A 3VAZA 4F46A 3EMKA 4ZN6A 5F5LA 3SJ7A 3FD8A 4BO5A 3DZGA 4EUEA 2HK8A 4JLWA 4Y6RA 4XDZA 4YQYA 1EVYA 4INAA 2J5RA 3UN1A 3ETGA 3ZCXA 3TQHA 1K2WA 3HDHA 1LQTA 3PK0A 3W8EA 1JTVA 3GR6A 2PWZA 2QIOA 3VH4A 3DFUA 4CM8B 3GEMA 1ZXLA 5JC1A 2YJZA 1C1XB 1PWZA 1Z75A 2YQ4A 3N74A 2GN9A 3HSKA 5KVCA 2C5AA 2IZZA 2VT3A 2NVUA 1DHRA 1DIRA 1GU7A 5KOIA 1KBZA 1KEWA 2CVZA 1GV1A 4Z9YA 3WGTA 5LCXA 1GCOA 4R68A 1ZH8A 5TLSA 4NU5A 3D3WA 1JWAB 2WWRA 3DC2A 4GX2A 1LSSA 3BMOB 4DLAA 4BQRA 1MB4A 2PNFA 5IXYA 2E4AA 1O89A 1GEEA 3JV7A 2PA3A 1M2WA 1LEHA 4CM7A 3GVCA 3T4XA 3JQ9A 1I10A 2CNBA 2NU8A 2XF8A 2VQ3A 1U2DA 4ZD6A 2VHVA 1DFIA 2DPGA 5B4UA 2OZPA 2X5OA 3FBTA 5IDYA 3HE3A 4CQMD 4BNFA 2HMVA 3ULKA 9LDBA 1QP8A 4DGSA 3AM3A 1EZ4A 1P74A 1TT7A 3K8ZA 1HE4A 4MINA 2O4CA 2Z95A 1U3UA 3DBHA 3JYOA 5KJ1A 4NNJA 3LLSA 4IZIA 1BWSA 4J7XA 5BQFA 3VPHA 2PV7A 1W0CA 1MC5A 3ZWCA 1FDUA 3FR8A 4WOKA 2B35A 4NIMA 3Q11A 4Z0HO 4DIOA 2HU2A 3I1JA 3GZNB 1E7WA 2GR9A 3NUGA 4PCVA 2Q4EA 4CV2A 1QV7A 4YA6A 3KUXA 3TL3A 2B4TO 5K9ZA 1CQIA 2GZ2A 4UUPA 1KC1A 5A05A 1H5QA 4NBTA 1NBOA 2NTJA 4TRMA 4JJFA 1LRLA 4IIUA 4IY1A 4WEQA 2WEKA 5EPOA 1MV8A 5KVVA 1PJLA 1XQ1A 3I6IA 4B4WA 1BSVA 4PZDA 4OAQA 3RJ5A 2GO1A 3ZW8A 4IGFA 4WGGA 1P77A 4YRBA 3DAFA 3VPSA 2BHLA 3WMWA 1F17A 4L9RA 3WNQA 4BNHA 3C24A 2AXQA 2Y1GA 3VC7A 3WGYA 5JCJD 2E37A 3H3JA 4NH4A 1P45A 4WCFC 3UF0A 4HADA 2DT5A 3WJAA 5FI3A 4CMIB 1CDOA 4XYBA 3FTPA 4AJIA 4GH5A 4IIVA 4BNKA 4Y67A 4UEOA 1GEGA 1HTBA 2PKQP 1CERA 5A3VA 4HP8A 2W90A 4YT2A 5FWNA 1ZKMA 1NQAO 2DPHA 1KVQA 2RHRA 1ZBQA 2VYND 3WYCA 2ZTVA 1WW8A 4YTEA 1NQOA 4TRJA 3SBOA 2CVOA 3K5PA 4A7PA 4IGEA 3H5AA 1M76A 1N8KA 1XGKA 3NT4A 2NLOA 3PLNA 4J9VA 1U2GA 1ENOA 3HN2A 3P5SA 1PU2A 3PI7A 4UREA 4D3DA 1A9ZA 3DO5A 5A5EA 3HDYA 3UKOA 1CWUA 2QZZA 4CR8A 4XRGA 1PZHA 1EBUA 4II2A 4ROSA 1SAYA 1R4MA 3M1LA 4NJMB 1FDWA 5F1PA 4XKJA 2UVDA 1GQQA 3O03A 1SOVA 5TT1A 1N5DA 4PLVA 5KIAA 4PLCA 1OFGA 3FPCA 1Y8RA 1Z45A 1L1FA 4CM1A 1EFKA 2JD1A 4PG4A 1GZ3A 3K30A 3GFBA 5HBRA 3LK7A 1SC6A 4QT0A 4BKPA 3RBVA 4F45A 1ZSVA 1H6AA 4D3FA 3QVXA 4N18A 1R4NA 2AG8A 3PP8A 1EK6A 1IPEA 2Q45A 2Y05A 3PYMA 4BNIA 3DBRB 1N9GA 2Y93A 1CYDA 3LYLA 5IJZA 2G76A 4L8VA 1E1LA 3ENKA 1IUKA 3EVNA 3PJGA 1JVSA 5BSGA 2RCYA 2P9CA 2GSDA 1ID1A 1SBYA 1UXIA 2BGMA 4DBVO 3GNTA 2VZ8A 3GPIA 1LU9A 2YDXA 4XB2A 1B14A 1UDAA 1U3WA 4CM6A 5BNIA 5I9MA 1QV6A 3OM9A 4FCCA 2I5PO 3K6JA 4J4TA 4GLLA 1I2BA 5A9RA 1W4ZA 4ND1A 2O7SA 4BNVA 4A10A 2W2KB 4PGFA 5I7SA 3AY7A 2G1UA 4BGUA 4E32A 2EKPA 4I9UA 5IN4A 4BKQA 2HMWA 1BGVA 4E31A 5KJCA 4CM4A 3C1OA 4E0BA 2PD4A 3PHHA 2H6EA 1SPXA 2OBNA 4XYMA 5A9TA 3A14A 4D79A 3N7UA 4YT8A 3EYWA 3JQ8B 1YWGO 4P22A 3JQAD 1EE9A 4DWVA 1IB6A 4MP3A 2D8AA 2PZJA 3G3EA 1P0FA 2GCGA 3ZWXA 3E8XA 3U09A 2VOJA 1MUUA 2HDHA 1MFPA 1TI7A 4OQZA 5C7OO 3I4FA 1C3VA 1M67A 2ZB7A 4MVJH 5JYEA 4CLHA 4MVJD 3GF4A 3BMCA 5EMHA 4WE3A 5JO9A 1MA0A 4PLGA 2AQKA 1U3TA 4PLZA 5LC1A 5KJ6A 1JWBB 4FC6A 3PQFA 4GVXA 3NGLA 3PGJA 4AJKA 1KEVA 4ND2A 3DZBA 1D3AA 5HS6A 1DO8A 5T57A 4I9HA 4ZRMA 3CIFA 1BW9B 3CINA 3LC1O 2YQ5A 3S8MA 4B7CA 1UUFA 4RV9A 2GUGA 2B5WA 3PRJA 1QYVA 4OKIA 4IINA 1LQUA 3RUDA 2OOSA 3ONEA 3RUIA 1ZSNA 4EEXA 4YVFA 4RF4A 4BNWA 3O8QA 5EIOA 1DRWA 2PD6A 3WQSB 3DWFA 2ZIZA 1VL0A 3IP3A 2O3SA 3OECA 3ZU5A 4MDHA 4J2HA 3TPCA 1MXHA 5B1YA 1P1RA 4I9NA 3DOOA 5DBIA 1YJQA 1QRRA 3ZHYA 2P5UA 2HK9A 1DXYA 4LSWA 3AJRA 4RPHA 3WBFA 3ASUA 5DT9A 3FNEA 4LMPA 1BXGA 4YCAA 4I08A 4PN3A 5G0WA 4YJDA 1PJBA 2X58A 1R0SA 1TA4A 5ER9A 4AJ4A 3MJCA 5DCYA 5CP8A 1DIBA 3E5MA 1PL7A 2NSDA 3L9XA 2W98A 4YT5A 4HFMA 2Y0DA 3OICA 4R9SA 4NJOA 2ZB4A 2OHXA 3VVBA 1B8VA 3A06A 3KTDA 3F9IA 3GAZA 4M86A 3OF2A 1A5ZA 3OJFA 3VTZA 4ALLA 3EC7A 4YAKA 4I5FA 1F8GA 3P2YA 1Y8QB 3WICA 1L7DA 1P3DA 1MG0A 1FF9A 2AW5A 2NU6A 4JJIA 1C0IA 1RM0A 3PLRA 1HE2A 1I0ZA 3NT2A 2J3IA 2RH4A 2FHSA 3BAZA 4UVDA 3RC9A 5I7EA 4TVOA 2C0CA 4OOFA 1I3LA 5U4QA 1E6EA 4FD3A 1VL8A 3RFXA 4XRRA 4N5NA 1E5LA 4NBUA 4FC7A 4M87A 2XOXA 2X0IA 1NHGA 1PGNA 3JQBA 2QRKA 4RF2A 1QLHA 4BNNA 4CV0A 3KYCA 1PL6A 4A73A 2E6UX 4YQZA 2XXBA 1SMKA 4Z9XA 3ADPA 5IAAA 4RZHA 2IEBA 4Q3AA 1T4BA 1EVJA 2BGLA 3ORFA 3PVZA 3ZI0A 5L53A 4H7PA 3VPFA 4FB5A 1CETA 2I3AA 3O26A 4WLOA 3F1KA 5AQ1A 3H2ZA 3TZCA 1FMCA 3AUAA 1WP4A 2V65A 1Q7BA 4KOAA 4E2XA 5A02A 4PZEA 4JBIA 3C7CB 4ALIA 3QVSA 5AVOA 5C37A 4NR0A 3D7LA 2ZQZA 4GMFA 3G17A 1J4AA 2I6TA 5KVQA 4YR9A 1CF2O 5COAA 4YRAA 1J5PA 3QSGA 4GPD1 1ZNQO 4FGWA 2NWQA 4L75A 4DA9A 1IPFA 1E3LA 3WTCA 2I99A 1A7KA 2I9PA 3FSRA 5DULA 4B8ZA 4EYEA 4XQEA 3IUPA 3E18A 4J1SA 4QQRA 3VTFA 1TT5A 3GN2A 3PFWO 4RGBA 4RLSA 5I8WA 1DAPA 2GNAA 1IE3A 5A03A 5JW6A 1VM6A 3VH2A 5CHEA 1LNQA 2WE8A 3GOHA 4JJGA 4E30A 3B1KA 3K73O 4BO1A 1K0UA 2BFOA 4P38A 4EW6A 2IRWA 1BXKA 3IQDB 1PJ2A 4MIYA 1I3NA 2P9GA 3E9QA 3L6DA 4BV9A 3TFOA 2ZYGA 4XJSA 4MKXA 3TJRA 3E48A 4WNIA 2WMDA 1RYEA 2I67A 3RC2A 1HDYA 4HXYA 3G0OA 5ICSA 3D5TA 3KSUA 3ZNQA 1ENYA 3OQBA 4BNLA 3HZZA 2VOEA 3R3SA 3C3XA 3OJ0A 2YHUA 2FR1A 1BRMA 2NADA 4NI5A 4S1VA 4XZ3A 4A0SA 3QP9A 4AJEA 2NVWA 5T5QA 3JQEA 1OI7A 2VUUA 3H9JA 3ROKA 3UVEA 2I65A 4ZQGA 3P19A 1BVRA 2R6JA 3TFQA 1MC4A 2BKAA 3Q2KA 4OOEA 5U1PA 3BZUA 1JAYA 3NRCA 3NEPX 4XYGA 2DTEA 1XCBA 3U62A 2VTDA 3KYDB 5MGBA 2EF1A 5ENDA 3PPIA 4YXFA 4CR6A 3NX4A 3ZWYA 2DFDA 1NVMB 4TROA 3WG9A 5ILOA 2WYVA 3OJEA 4TZTA 4MJLA 3LDHA 2JAHA 2C59A 1ULUA 2H1SA 4RPLA 1H9BA 3GVPA 4TSKA 5JMPA 3TN7A 1ZK1A 4DL9A 2A9FA 2O50A 4AL4A 3F4LA 1EUCA 1RKXA 4K28A 3RUFA 4E6PA 3ZW9A 1K3TA 5A04A 3BHIA 5EQFA 1HKUA 1AN9A 3LF2A 4NHEA 5DBFA 1N7HA 4PVDA 4CLDA 3H5RA 3CPSA 4OJNA 4FFLA 1PZFA 3H9GA 1LLUA 5DP1A 4UAGA 3ITKA 2GZ1A 1H6CA 1PX0A 4BV8A 5T64A 1LBEA 3B6ZA 4OXKA 2YV2A 1C0LA 1ZFNA 1XYGA 3M6IA 3U0BA 3ROQA 2DBQA 4E2YA 3WGQA 5AXDA 4XYEA 1ZMOA 1JKJA 1W73A 3I9MA 4MVJE 5JDIA 4DIBA 4PG7A 1R12A 4CLOA 2Y0EA 2GRAA 3VDRA 3PYXA 3GGGA 2FPIA 2IZ1A 3WGOA 3ZZNA 3WWZA 2GN4A 5JAZA 4YWJA 4GVLA 2W2LD 4PLFA 1E6UA 3GN1A 1VKNA 3ZHBA 1K5HA 1NHWA 1UZLA 2BFMA 2DUUA 1Q0HA 3Q9NA 4GMGA 4WUVA 4RVGA 4L0QA 5C7LO 4M8SA 3NJ4A 2AMFA 1P9LA 5KWEA 3UCXA 1M6WA 1KYQA 2VWQA 1UAYA 4J0FA 2O48X 2Y1DA 1T24A 1BDMA 2HO5A 2RH8A 3QE3A 4CQMB 5L7TA 2VWHA 1U1IA 4ZGWA 4DLLA 1R15A 4ILKA 2OUIA 5I7VA 3SJUA 1O6ZA 3AFMA 4XB1A 2ZK7A 4LN1A 1N2SA 1X14A 1UP7A 1YONA 4L4XA 3DBLA 3UCEA 2Y99A 1OOEA 2R2GA 5L51A 4LVCA 1LA2A 1XU7A 3RUAA 3AOGA 1ADCA 1E7QA 2EW8A 1R4MB 3H65A 4N7RA 5JCXA 3W8DA 3CZMA 2HKIA 4NDNE 2OO5A 1U9JA 1E3EA 5B4TA 4NFYA 3UAGA 3Q3CA 1FDVA 2D0IA 3D0OA 3QWHA 3BIOA 3SVTA 1LLCA 3JQGA 4HX5A 1VPDA 5G4KB 4XIYA 2PZKA 3PIIA 1YJ8A 2XAAA 3OH8A 3H2SA 1X0XA 1KC3A 2DFVA 3NJ8A 2J3JA 4YAJA 2VZ9A 1ISHA 1GPDG 4OQYA 5COQA 5JDCA 4KUGA 4IS2A 3VPGA 1HDZA 3PZRA 3RKRA 2C82A 5K6AA 3NTQA 5ILGA 1Z74A 5DOVA 3L4BA 1JDJA 4H15A 4MVJP 3TZ6A 4HNHA 3L4SO 2FZEA 3OIGA 1Q7CA 5H83A 4WNCA 1PS8A 2O3JA 4JP3A 5EINA 2DVMA 3VZQA 1PGQA 1Y81A 1YL5A 4CM3A 3MWDB 3RJ9A 1P31A 4F3YA 4DPMA 1YQDA 1QXSA 2ZCUA 4BO8A 2X23A 3OSUA 3ZWWA 4NBRA 2AHRA 4DTIA 2O3TA 1YDWA 4CMGA 3FTNA 4Q9NA 2WD7B 1JLLA 4GWKA 4D7AA 4M54A 2G82A 2QRLA 4CQLB 3IJPA 1VSUA 3D3EA 1T1SA 2PR2A 3MOGA 4YJHB 1WMAA 4E5KA 1VSVA 4D45A 2CVQA 1DBVO 5G0SA 1HL3A 2F1KA 4LGVA 3OQ6A 4IDGA 4PG5A 1YOVA 2CZCA 1IZ0A 2X8LA 2X86A 1WVGA 2Y1CA 1NVGA 2Q49A 5L95A 2Q1UA 1T2AA 2NTVA 2WE7A 3B1FA 4BKRA 1E3JA 2IYOA 4O6VA 1PL8A 3H9EO 4CM5A 2FR8A 3D4OA 1U4SA 3G1TA 3JQCA 1L7EA 1E0DA 2NACA 4BNMA 1E1NA 3V5NA 1T4DA 2FOIA 3VDQA 1YBMA 4CUZA 5A4DA 1I3MA 3FI9A 1T26A 5I7FA 1B0AA 3VOSA 4ZU3A 3KOUA 1AHHA 1A4UA 1VJTA 3KZVA 2B36A 1YBAA 3U4HA 1CIVA 3BMNB 3BHMA 3QLJA 3QVTA 4WECA 5GZ6A 1YS4A 1C0PA 1WDMA 4O5OA 4UVHA 3RU7A 3EZYA 3RUEA 3QQPA 3C1TA 3Q9UA 3P7MA 1DC5A 3I23A 1VJ1A 1QYDA 1T2CA 3OJLA 4TQGA 4BNZA 1YB5A 4FW8A 1YKFA 4Z3KA 4R3WA 1RJWA 1NX6A 1E3WA 2EERA 2UAGA 4KDFA 2BH9A 1MX3A 2EHDA 4Q3CA 2UV8A 4N5MA 5T8KA 2BI7A 1U8FO 1PQWA 3HJAA 1RM3A 3BMQA 4BNJA 4NZ9A 5JY1A 5JS6A 1JQBA 5JAMA 3DR3A 3S2EA 4BO9A 1G6KA 1P1JA 2X0NA 3I4CA 3EK2A 2V7PA 3ICPA 4TKMA 9LDTA 4NBVA 2A35A 4JK3A 1Y9AA 3HWRA 4CLRA 4IJWA 5DBGA 3JQAB 4Q3BA 1T1RA 3ETDA 1YVEI 4OSPA 1HETA 4WCFB 5AYVA 1HE3A 4MPDA 1I2CA 2P9EA 1GV0A 1LUAA 3O4RA 3GRPA 5C5IA 4YYZA 4MVJG 3IS3A 2VNSA 4BO2A 3IAHA 2R00A 3INGA 3GLQA 4Y8VA 1C0KA 2J5KA 4TZKA 5FI5A 3IC5A 1IOLA 1ZUD1 5IDQA 4JIGA 3AK4A 5KNLA 4QECA 2PKQO 4ZJUA 2PGDA 2EGGA 2X4GA 3FNGA 2DQ4A 4RPKA 3AU8A 4DMLA 1JN0A 2QZ9A 5MDHA 2JJYA 2ZYAA 4O0LA 1YL7A 2O2YA 4FN4A 2YHIA 2VRCA 2UYYA 3DFZA 4L4RA 4U8GA 1BG6A 3KO8A 3KYCB 4OL9A 1DRUA 4WPGA 1Y9EA 2D3TA 1H94A 4P4NA 3ON5A 5H81A 2WYUA 2O3RA 1YQGA 1F8FA 2NU9A 2CDAA 1C1DA 1Z7EA 4TRNA 1U5CA 1VE9A 2I76A 3KYBA 4YJFB 5DZSA 1H2BA 3QY9A 2YZ7A 4E21A 4AJ1A 3WGZA 1V9LA 3KSZO 3LSYA 3IKTA 3PQEA 3IL2A 3IOYA 4PLPA 5TF4A 2WM3A 3FR7A 1ISGA 1GADO 3GVXA 3QV1A 3V2GA 3JQFC 4OHUA 4E13A 1AGNA 3ZN2A 1IL0A 1NQ5A 4KQWA 3OEYA 5JSFA 1IYZA 2EP7A 3D4PA 1NFRA 4BMSA 4B3JA 2D59A 1Q2XA 2TMGA 3UHAA 4BO6A 4DC0A 5DCUA 4FSHA 2D5AA 1P33A 2SCUA 2CFCA 1B2LA 1MXFA 2YW9A 4XQ9A 3ANNA 3SC4A 4KTVE 3AM4A 3FNFA 5JC8A 1ISJA 3NKLA 2EG9A 1UR5A 1WWKA 1UH5A 5JXWA 3DTYA 4YJGA 4Y6SA 2BGKA 4DPKA 5KTKA 5BNTA 2FWMX 4JXKA 1R66A 1TVEA 2Y66A 5IZ4A 1W8DA 2VWGA 4MP6A 1DDOA 5I9NA 1ARZA 1I3KA 1JU9A 1HDCA 1LLDA 1LSUA 3QWFA 4YT4A 1NXQA 4OH1A 5KCZA 1NWCA 2AE1A 4RVHA 4JNKA 1J49A 3RQSA 1JVBA 2ZCVA 3QRWA 1KVSA 5K0ZA 3AU9A 4XDYA 3ZH2A 4KTTE 4J7UA 3L9WA 4U6QA 3JQ7A 1VKOA 5HTOA 3BXXA 1M6HA 1LSJA 1GR0A 4Z0TA 1B26A 4R51A 3CZRA 2H63A 2WSBA 3EAGA 3RROA 4QO8A 4RJTA 2JHGA 1IZ9A 1KERA 4ZHSA 1EBFA 5AXAA 1FK8A 4PLHA 1HYGA 3EVTA 3NDJA 3OMLA 3U4IA 3EY4A 3WLFA 4BQPA 2VUTA 2P68A 1S6YA 2J3HA 5DCWA 2PKRA 2ZB3A 3JYPA 3WWYA 3AUSA 5B4VA 3DEYX 2WD8A 1RM5A 4KWHA 4CM8A 3K92A 2Q50A 3U49A 4Z0PA 3V2UA 5CEJA 1C1XA 3X2EA 2VCYA 2GYYA 1HF3A 1GUYA 4E33A 2ZKLA 1LLQA 4G65A 4CMEA 4E12A 3M2TA 2Y0CA 5TJHA 3ST7A 4GQAA 4PG6A 3A9WA 1CJCA 5JE8A 4ZVVA 4GI2A 3BMOA 4LW8A 4A27A 4W6ZA 3GH3A 4ZRNA 2Y68A 4IZHA 4O1MA 5FEUA 3V1YA 5L7WA 2NQTA 2FN7A 3DHEA 1U7TA 1X7DA 2PZMA 1WPQA 3GUCA 3I9NA 3LC7O 2VHXA 4MKRA 3AI1A 4P4LA 2GDZA 2EJWA 3IKVA 2AEMA 4ID9A 3ZU2A 4NQZA 4NU6A 2DLDA 1O5IA 4AICA 3RU9A 3DMTA 1QMGA 4M89A 1GQYA 4I5EA 4EZBA 5GZ1A 2VHZA 3MOIA 2GF2A 4EJMA 2HLPA 4FJ1A 4KDEA 4LSMA 1QR6A 4OXYA 5EL0A 2BD0A 1DFGA 4FQ8A 1U3VA 3JCZA 2PK3A 1KS9A 3RWBA 2GPTA 1KY5A 5CEFA 5IF3A 4XCVA 5JAQA 5JDIC 3R0IA 1O9BA 4RPJA 3GZNA 1ZMTA 2VTEA 5CPBA 1YDEA 1NPTO 2AA3A 1TXGA 4BNGA 3OQ1A 5CDYA 3VZSA 1WXDA 3E6AA 3F3SA 1LXCA 3WSVA 2JFFA 1C14A 1NTOA 1NFQA 3EUWA 3WGHA 2HK7A 3VKVA 2H5LA 3AUTA 3GAFA 1N92A 1WLYA 4K26A 1ZJZA 2DUWA 3CUKA 3KB6A 4L73A 5TNXA 3WDSA 3T7CA 3F5SA 3WIEA 5A9SB 3VPXA 4R54A 4XR4A 1JA9A 3RBZA 3EHEA 3PHJA 3LLVA 1RPNA 2YDYA 4CM9A 2BFAA 4DYDA 5CPFA 3UGKA 4TVBA 3WGGA 4D46A 1GYPA 3LT4A 1E3SA 4XYLA 4W99A 4CMIA 4PG8A 1RWBA 1P1FA 1DSSG 4AJNA 1LC3A 1X1TA 3NGXA 4NBWA 4W82A 3MJSA 2C2YA 3QIVA 4AJJA 2G17A 4CL3A 1ENPA 1LDNA 2JD0A 4CLEA 2AQ8A 5JYDA 3H9QA 5KJEA 4M55A 5GMOA 3OP4A 4MVJI 4R69A 2X5JO 1RYDA 2RIRA 1BMDA 1I33A 4PVCA 3RC7A 2B83A 3H6KA 4BKUA 1YQXA 4FGSA 1VLLA 2IDZA 1VJ0A 2NQ8A 3S2FA 2F00A 2RBEA 2UUOA 4IDFA 4DPLA 3H9UA 5B12A 2BF7A 2Y1EA 1TB4A 2B5VA 4XIJA 2HMUA 2C5EA 2HCTA 1NVTA 3WB9A 5ICMA 5B37A 1B8PA 4AVYA 3DQPA 2X22A 3GHYA 1EQ2A 3WS7A 3BTOA 4NJMA 1HDOA 3F1LA 5JDCC 1GYQA 3GG9A 1YB1A 5K6AC 2Q99A 3AOEA 3FPLA 5JLAA 3R3JA 3L4BC 3B1JA 1V0JA 3I9JA 1OMOA 4EGFA
chains in the Genus database with same CATH superfamily
1QFMA 1XZFA 3QUAA 4G0ZA 3BUSA 4NAUA 2H59A 3D3KA 4EAQA 5KNBA 4G1MB 1TJ5A 1PUJA 5DYWA 1MEOA 5EIBD 1JDUA 4YGXB 1O97D 1ZGAA 3PJFA 2PZFA 1C30A 3GFTA 4QGGA 4J1QA 4EI2A 4CCWA 4Z8YA 3AL0C 4HTFA 4WJKB 2ERYA 3G2HA 4BEBA 1U11A 1WUIS 5L6LB 4JR0A 4X61A 1U0RA 4BIIA 1N5MA 1W76A 3DDCA 1A7JA 5D51S 4YRDA 1GGEA 1KIAA 1Z83A 2ECKA 1H3EA 4AUMA 5K8CA 5DNAA 5JYBA 2PUCA 2YCBA 4P58A 1B2RA 3I9OA 3MGAA 3ZQ6A 4QU0A 1E3IA 1QTQA 3HU3A 5A62A 1EQAA 3B9BA 2C20A 4G5YA 3K31A 2PCLA 4FEAA 2AVNA 2JGLA 2N0SA 1LDYA 4ZMRA 2UZIR 3KLMX 1MMFB 3LYHA 2NVUB 2EP8A 4O8CA 2CKMA 1J8MF 3P9XA 4P4SA 1W6UA 1L5KA 1ODKA 4GAEA 4X93A 4C0XA 1T9ZA 4RCVA 2FCAA 1BWPA 1ZK2A 2WG0A 5I7OA 1BHJA 2EVWX 4U3JA 3BYZA 1EGHA 1FXSA 3L93A 4FYPA 5K4HA 4RYLA 3BHNA 4Q7EA 4EYSA 4GDMA 4GUAA 4HH3C 1F4VA 3OPQA 4UEKA 3W6ZA 1EWKA 4HFNA 4DMMA 4RORA 1AK9A 4K3UA 4RQBA 4PHTA 1XVVA 4PRKA 5GQSA 4CR7A 1D1TA 2R2AA 5PNTA 1EZZA 1IN6A 3EZLA 1O87A 3FDZA 5TY0A 1SCQA 2H48A 5G0VA 5H82A 4QXQA 2VHJA 1YQWA 2RAPA 3SVLA 3A6EA 3DZKA 5CEEA 4RZQA 1GG5A 2BM0A 2YJ3A 1FX0B 1UT6A 3HVJA 1K89A 3CTPA 4JU9A 3W5UA 4P8RA 2AOTB 3KHUA 4HWKA 4U63A 4IH1A 1FLAA 1TTPB 4I66A 2WAMA 5AW3A 3HDQA 3NHZA 3TTTA 1MIHA 3C3PA 3V4RA 2IP2A 5EOVA 2X3YA 3K0CC 5MFPA 1NYQA 2IODA 1Z3IX 4IXNA 5AOBA 1A72A 1KEKA 1OREA 5LOVF 5MFZA 1KEPA 1ND5A 1RLTA 3QFRA 2BM9A 4LMRA 4QDOA 5T8KC 2ZIFA 3TBFA 5J4KA 1K7SN 2AF3C 3HI6A 4ZARA 1VIMA 1RWQA 4IP0A 4LRYA 3ESYA 1TJNA 3N6VA 1J1UA 2MINB 3BHJA 1JTFA 5SYMA 5FNVA 3D8NA 4DTCA 1U31A 1CR0A 5ALFA 2MOKA 4W1QA 5AJTA 5DGHA 2FW1A 1PW7A 2GTHA 1W5TA 1YDFA 4LISA 1L5HA 2VNHA 3O21A 2FPUA 2DHDA 4MQ6A 5DASA 4C2BA 4LHXA 3JQRA 3G2NA 5J40A 5LDHA 3WA7A 2WKPA 2Y9MB 1C2TA 4Y6PA 1FYDA 4YROA 5LA6B 3ADBA 1U2ZA 3QEJA 3R1IA 3P9CA 1KOGA 1XZBA 4QDJA 1KFEB 1T6XA 3FMIA 4R41A 4ZQCB 1UBSB 2JFQA 2VPWA 3TLEA 1FTWA 2ODQA 4ND4A 1SG0A 1KQFA 1ZNZA 3DGFC 1BDBA 4J16A 1B3BA 1P4RA 1RVDA 1VPEA 2OBMA 3F2VA 5H02A 4Q48A 4UUAA 3UWKA 3EN0A 1L8XA 2P6MA 2GPYA 2HWKA 2YNMA 3AG5A 1X9IA 3BFXA 2AG5A 1YE3A 5CVCA 1JSCA 1KAEA 2ACKA 3NPMA 2CFTA 3BA1A 1VRWA 2WAXA 3NG1A 3PWTA 8ADHA 5KQGA 1RLIA 4G8JA 4ZAZA 3H04A 3PGA1 1X74A 2QROA 4OB7A 1Z28A 2VYCA 4JLAA 5JIBA 1S7CA 3QXSA 1U7DA 4TKZA 2W0SA 1UFOA 4KE7A 4O29A 1F2UA 5EP1A 5KOYA 4MP8A 3LIIA 2ST1A 3HMKA 2VUSA 3DAGA 1BMFD 1CB7A 1RI1A 4U7FA 1Y8QA 5EIXA 5C8XA 3B70A 1EX7A 2CDBA 5P8WA 3TSOA 3DD1A 1Z35A 3FN4A 2IU0A 5LQNA 1ZH4A 3RUCA 1FFDA 3HADA 3UATA 2HM7A 4RMNA 2VH1A 4WQMA 3QX8A 1D1SA 4RD0A 3EC1A 4JL6A 5FBQB 1FJHA 1SIBE 2G4LA 4E2FA 3VI3B 1YJXA 1COWA 3PNQA 1E60A 1H2AS 3JVVA 3QPVA 4ZO9A 4X65B 1FVXA 1JV2B 2GI4A 1KDPA 3LPLA 1OLSB 4FSDA 4NYMR 4I50B 3WLPA 2PRIA 5F21A 2UYCA 1Z8FA 4QPNA 1IXKA 2IXTA 1JS1X 1J2UA 4KMRA 5EJIA 3IELA 1DC6A 4PIVA 2ZWVA 1LS1A 5HA5A 2G80A 1T3TA 2PTGA 1Z06A 4IVPA 1UAGA 1I2ZA 1CLEA 1KVRA 3EFBA 3EIWA 3MRSA 5AUPB 3OTWA 5EJ2A 5ICEA 3PUJA 3LQ4A 1I7PA 4I4IA 3EDQA 3O1HB 3DQZA 2OAGA 3GMSA 5DI3A 5C3MA 4RZSA 5IJ0A 1JMKC 1G8GA 3HA3A 4H4EA 3R9WA 4M21A 4EVIA 1JFFA 3L0DA 5AKZA 1XOIA 5FUBA 3H2KA 1ECGA 1YXMA 2IEDA 2WABA 3GRYA 5BOVA 4CGYA 1HTWA 1AF4A 3GFFA 3CW2A 2XUJA 2VS1A 5C4IA 4F93B 1R8QA 2PUJA 3DT6A 2O0LA 4KKXB 3L6CA 1TK3A 3GJQA 1AA6A 1O5TA 2FEAA 2QW8A 4UDYX 3IX7A 4FHFA 3RFUA 5BSHA 3QI7A 3OUTA 1NLMA 1DQYA 4FHEA 2VTBB 4RD1A 3ZIUA 2L82A 2FTKE 4L8WB 2QWXA 1GR1A 3HKCB 3HZRA 5I4CA 1B6SA 3KR1A 4KLZA 3T9EA 4AO7A 5B7GA 1NE7A 1Z56C 2YOFA 3MMPA 5AHWA 1RU3A 3K96A 4AZ3A 2JGEA 4AN1A 5LLDA 4HGOA 2I6QA 3C6XA 3IPXA 3BCHA 3GT0A 3SY8A 4RY8A 3I6MA 5KYYB 5CCXA 4AZSA 5K3FB 1D2GA 4S1OA 5A06A 4D0RA 4BMZA 1YC2A 2PL1A 3IAS1 1KE2A 3C43A 3ILSA 1J25A 1I5RA 1ZBDA 2A0KA 2ZJ1A 3IE0A 1ZIDA 4I3HA 3LW7A 2HUPA 4MWCA 1Z29A 1WVMA 1AH2A 5HRCA 4JEIA 3B6IA 1OXTA 1QLWA 3STVA 2ALJA 4FUQA 3WLJA 3BM5A 2DKOA 4RTOA 3SSOA 2QX4A 1PR9A 1BC5A 4JIMA 1A27A 4BWVA 3BORA 5KHLB 3L6BA 3RC1A 1Z62A 2OM2A 3UYKA 1ONOA 4R7GA 4ALKA 2CHGA 1I7DA 2H1VA 1J8VA 2YFQA 3TXAA 2NZUG 2P9FA 1CQWA 4FEGA 4RVDA 5FPQA 1FUKA 4CIAA 3LC2O 4E4YA 3KD3A 3LUGA 3FF4A 1MA3A 2VHCA 1GG8A 2HIMA 2MYTA 3BMCB 3H3FA 2DSNA 3RV4A 5I5EA 4ZTUB 1GAWA 5BT9A 2IT1A 2FOXA 2J6IA 4S3MA 1CK4A 1C3OB 1W5BA 3RAGA 3FPFA 1CZLA 4H17A 4YO8A 5EJ6A 2LCFA 4UHEA 1KIFA 9GPBA 2WWIA 3KLBA 4N5LA 4NECA 3TLYA 4HRXA 1IN7A 4IJMA 1A8PA 1WDLA 2HX1A 3FRJA 2PWAA 1JAXA 1T2VA 2WU8A 1SXIA 5ERXA 5IVKA 1YH3A 3UICA 3AR3A 3HEAA 2ZJZA 1JMVA 1L4KA 4I81A 3FMFA 3MTEA 3RYTC 3CX8A 3OTOB 1MB0A 2P0AA 1M73E 5FFNA 2PLRA 2WWGA 4J0DA 1AQJA 1HNZB 3AHJA 4CMEC 3K32A 4YV1A 3EPJA 1GCUA 5FL3A 5CBKA 1JXAA 2ID4A 3LHIA 4PQFA 5E4YA 5AVWA 5IUJC 4OSOA 1WAMA 2CNKA 4O1IA 5C46F 4AJOA 1Z0UA 1KDVA 1ESDA 5IEJA 3F6PA 2WSSA 1X0VA 1RMTA 3SYRA 3AQIA 2Z6VA 4WOJA 5A5DA 5CM8B 1H0SA 2WFLB 1IVSA 2XCSB 4Z99A 4UHBA 1QAQA 1YZUA 2EFYA 3LUCA 3ZVLA 3KQNA 3NYIA 1G9TA 1PS0A 2ZROA 1VL2A 4G1VA 3RVJA 1I14A 4DQUA 4PM4A 4F21A 2HBZA 1U8XX 4N41A 1GNLA 4H0FA 3NOXA 4IPTA 2P8JA 1P0MA 3GY0A 4EFMA 1EFTA 1KSJA 4S0XA 3JS5A 3RI3A 3DBOB 1U2TA 2IV7A 3C8MA 2CJWA 4G5OA 2PQ2A 3URKA 2IE8A 4UVIA 1ZK4A 3IBFA 4N5IX 3VYRB 4II3A 5ADVA 3EDMA 4HRAA 3BGSA 4RM3A 4UEJA 2I7DA 1MKYA 4MV1A 3H5WA 3ZR4B 5J23A 1FJXA 4DDKA 4H7KA 3AR6A 1FFYA 4A82A 3PUWA 1XB2A 2XB4A 2H54A 2O0HA 5H4GA 3UH1A 1H1LB 2ZOSA 3O3MB 2A5YB 5ETJA 4TKUA 3GLIA 1Q1GA 3K1JA 3O8DA 4UD6A 1WHTA 1LPSA 4Y2PA 2EJUA 1M2GA 1T1JA 4MGEA 3NYWA 5JJ5A 1K5PA 5KYTA 3I4LA 5BN5A 1JEQB 1QVAA 4K2HA 2Q3JA 2YZKA 2R8YA 3S7ZA 5TGZA 3LIPA 1K27A 2DFKB 5CURA 4RDIA 4TTSA 3V4SA 1Q19A 3R9XA 1KP2A 3FHLA 4ID3A 1V39A 2Q07A 5CK4A 2OP1A 1WHSB 3HQ4O 4JGIA 1O54A 2IS2A 4CV3A 3NT5A 3UWSA 4EHAA 1XZLA 3DZFA 1WKBA 4YAEA 1YKGA 1ZVMA 2BWJA 5EG5A 3UIEA 3P4XA 3I0NA 4GO1A 1FYWA 3H5LA 3R7SA 1R5JA 2PO5A 3OOYA 4M0CA 3OZUA 1SCAA 3DF7A 2HK6A 3NWEA 3O2NA 4RAOA 3WL4A 5EXSA 1XHLA 5DU2A 5LSAA 4N6GA 2GM5A 3T94A 1H9CA 2A94A 3EIFA 3HK2A 2OSVA 1AHIA 2EL9A 3GCWA 3I83A 5G0TA 1QU3A 1EDZA 2C9YA 3QKWA 1KRWA 1VXOA 3LKBA 1XAHA 2OBYA 3IDSA 1GZ7A 2WP8J 4IILA 3IERA 3EF0A 1CS4C 2GDJA 1FOEB 4BMNA 4CQMA 5HQ3B 3KTFA 2FPSA 2ZJ0A 2VNAA 1EBBA 1D4FA 8AT1A 4FZVA 1I24A 2C1EA 1CG6A 4EDHA 3FKQA 3EVAA 1HYQA 1NP3A 2G6BA 4M1OA 3AF2A 4J3FA 1Z4PX 2QMHA 4DDTA 3HYNA 2J9RA 5KYUA 3E05A 2ZPUA 3A6LA 4EUKA 2YV3A 3L07A 4KBFA 4ZYZA 5E0OA 4B17A 1PWXA 1OB2A 2ZE5A 3IXMA 5ADHA 4HQ6A 2ZLBA 5ER6A 1QP4A 2V6BA 3TLGA 4FJ0A 5DXFA 2P3SA 3WYBA 3RTEA 3NHMA 1SHLA 5GIOE 4WAUA 1E7YA 4FIZA 3TNYA 1DXHA 1DE0A 2R7NA 2O5RA 5HRUA 3ISVA 4IUBS 4MYUA 1LLFA 2RARA 4HS9A 2Q4OA 2B69A 1ONBA 1NASA 1S89A 1P4SA 3LXXA 4UUOA 2CHVA 5DXJA 4Y9DA 4ESOA 4IRUB 2R1UA 5TSDA 3MPOA 5JO0A 1NPDA 4YRMA 1IOZA 3OLQA 2J67A 4RVSA 4Y2RA 3MCWA 3BZWA 1XLUA 1EAMA 5FTJA 4F11A 3PDIB 1V6AA 4OXNA 4PYLA 5DMXA 4HUJA 1EXNA 2CMKA 4MR8A 2LVBA 4MYDA 1NXTA 1LNZA 5DF1A 1G6Q1 5IVIA 4AG3A 2O5VA 2JZNA 4P98A 2V03A 1K0FA 4G2TA 5E3HA 3AR7A 4GEKA 5HK8A 5KEIA 2JCYA 4PPGA 5DYIA 1HRDA 2OFPA 2LD4A 4MVCA 3R74A 5ERYA 3U1VA 5C8YB 3KV1A 2V7TA 2GT1A 1W94A 2YYZA 3ELUA 1VYHA 2E48A 4ZEWA 1HFWA 6ADHA 3KAJA 4KK3A 3ZWAA 1DOHA 4QYXA 4NEQA 5EQFA 4LFAB 2P2ZA 1CY1A 4XI9A 3T1QA 1TK2A 1HTTA 3ZH9B 3W4JA 1AD2A 1O4VA 5HRAA 1VJ5A 3S5JA 4GX0A 1QK5A 1SIOA 2D1YA 2FQXA 4HDMA 1NUAA 4XW2A 1OVGA 4MGKR 5EGNA 1MJGA 2OV2A 3CKYA 4GP9A 4DIMA 1U4OA 5HOEA 3MWEB 2H1FA 4RADA 3LQFA 4WJZA 1GUAA 1SA0B 4PQRA 1TTHA 3JX9A 3IR5A 3PDCA 4QBFA 1E7MA 1IHYA 1KVTA 3NYRA 3ESCA 3KKMA 3G6WA 2Z4TA 2LDBA 3IALA 1CRPA 2R6CA 3MM4A 4LTNA 1NJGA 3KLPX 3DP7A 3KM0A 6ABPA 3LT2A 1GRNA 5TJ9A 1DAMA 2CEAA 3LX4A 4G6ZA 3VOTA 4CXMA 3IOCA 3ASYA 1CVLA 5CNMA 4R2MA 5AJXA 1B7GO 4Z8XA 2Q6IA 3USCS 4OMUA 2HU5A 1V37A 4B85A 4PAQA 3TW0A 1T6BY 4K6CA 1ZGJA 2CLHB 1BEZA 2HU8A 4JEHA 4UCFA 3W04A 3WLAA 3MD0A 4FPXA 5A3QA 5HJEA 5IG2A 3HKBA 2BEJA 1GVHA 5EZYF 2ZULA 4FNOA 2B6HA 2Y71A 5JRZA 3Q9SA 4FUTA 4M0KA 1J09A 1KOFA 4QJIA 1AKYA 1PHPA 1BCSB 2HIAA 3DSRA 2HBRA 1EUCB 4OGGA 3V34A 2ONYA 4IIBA 2EKLA 4A3SA 4DR6B 3UAWA 4OM7A 2JAUA 2OORA 2QRJA 3DXXA 1Y80A 1U6JA 3BMNA 3FWPA 4HYQA 4XGNA 4XE5A 3AINA 2QX8A 5THKA 4CFYA 4BNUA 2ROQA 3MELA 1I7NA 5KHOC 1MFZA 1N7IA 1QHGA 4B09A 1IULA 4YP9A 1L4BA 1OH5A 5CGZA 3FW1A 3N28A 4MQMA 5FA6A 4JXZA 4LYHA 4EBFA 1THTA 1U5AA 3S2IA 4AN0A 1O8CA 2GO7A 4CUJA 4F06A 3PGXA 4YR7A 5B6IA 3IIMA 1E6WA 1UWKA 5EXXA 5FR1A 3OETA 5DYTA 5CM2Z 1X7HA 1RFGE 4HF7A 5C32A 2FSGA 2Y1OA 2AW3A 3KT6A 5JCOA 3CWCA 5HG0A 4HLUA 3GA7A 3CG0A 5CNJA 4BUJA 1U63A 1TUIA 4B7XA 1UPUA 5AXCA 4ND3A 5C31A 1G7CA 3DMDA 2CD9A 1TEHA 3EXIB 3P27A 2G40A 2HHLA 5G2OA 1HLDA 2YFKA 2HF2A 1DC3A 4ZT2A 5TGTA 3W90A 2A14A 3BBLA 3GLFE 1AX9A 2AHOA 4TYPA 2HWWA 4X8MA 3QX3A 3ZJYA 4HRYA 1M6VB 3I30X 1FFWA 4JOQA 2DH6A 3VZCA 1OX4B 3ABRB 4LA4A 1NG1A 5F77A 2VYFA 2ORIA 5CX4A 1VHTA 4W8OA 5INTA 2EIHA 3GGOA 1H5NA 3FCSB 4U7TB 1TKCA 1M1YE 4RV4A 2J9YB 2FPPA 3LP5A 4DMCA 2J9ZB 4HLDA 3LE8A 2K4MA 1JPJA 2XY4A 4UPVA 4E6EA 2RHJA 1QCYA 3PI6A 3B7PA 4HD8A 3PENA 4JN6B 2YNMC 3NANA 4WCFA 2OB1A 4FDAA 4GM0A 5D6OA 4Y2TA 4ENWA 3Q0EA 1XRSB 4P7KA 3VGJA 1LTKA 4EB0A 5EUMA 5FTLA 4NV1A 3CPEA 5LXTB 4PINA 4M8KA 4OYHA 4OXIA 3U3RA 4A2PA 3SG0A 3O0DA 1Y6ZA 4WCDA 1N0IA 1JEAA 3EFHA 3IQZA 1EINA 2PS1A 2QV0A 1EDOA 2WHPB 4KO2S 3DLCA 4ZA2A 4L76A 5I47A 1GRRA 3T38A 4BX8A 3ZGYA 2ZW9A 3OBBA 3L6EA 2P3QA 5FB3A 1M5RA 4XJTA 1JHXA 2ZRBA 4S2UA 3WWCA 1GGJA 4TWJA 3KPYA 1B15A 1Z2EA 3X3HA 3PEYA 2H7VA 3V6LA 4BTVA 3Q9LA 4Z49A 1I36A 1N9ZA 2C9OA 2FLWA 2PL3A 4XTRA 2PX0A 2ZRKA 5DP2A 3MMZA 3N2ZB 4M9SA 2OCAA 2FZLA 2GJKA 3EGOA 4LRTB 5FUWA 2BJVA 5CDTA 4XM0A 1PQYA 2CHEA 2E9SA 1MNQA 3BE4A 3BL6A 4LCBA 3SNHA 3TRKA 3ZDDA 2C29D 3A4IA 1MJNA 4NCHA 1NRWA 4KZPA 2QZ4A 3VVMA 1CF9A 4GBED 4C20A 3HYTA 4BAUA 1DJNA 5A0VA 4IBOA 1LRJA 4KUHA 2Q3FA 2GN8A 2VPYA 4OHOA 3F47A 4U7DA 3DAHA 4ZMBA 3KVRA 3EDOA 1GFSA 4RETA 5BP7A 1BFUA 2ET6A 4JT2A 4YJ3A 1EK0A 3E22A 3STHA 4QVGA 4A0GA 2PFGA 4FMPA 2QUKA 1ZD9A 1QKJA 1UM8A 3Q3VA 5CJJA 3RD5A 4Q16A 1YZ3A 2BISA 4X1KA 5AI9A 5F5NA 2KS6A 3V3TA 4PO3X 1VOTA 1F6WA 1KI2A 3R3HA 2CUKA 1DPGA 2LE0A 3QVJA 1WEKA 3EQ9A 4IJ5A 1P91A 4KE8A 4L5AA 1JDTA 1Y9ZA 1ZC3A 3PKIA 1ENZA 4DCNA 2DSTA 3SC6A 1M66A 1EJBA 4AZ3B 1GTVA 4X60A 4DLXA 2Y1FA 2J6HA 4WZAA 4Q02A 1Z2PX 5JS7A 1HMPA 1JLLB 1V7ZA 5EGSA 1ZPDA 3QSYA 1T0IA 2JIOA 2XE4A 4ARCA 1G1AA 1GNVA 3IMGA 3MFYA 3URMA 4CF5A 2J4DA 2RI1A 3AMVA 4YDRA 3DYIA 2KHZA 3SS8A 2QPTA 1R6VA 2CNDA 2JAPA 2BHNA 4KREA 2BI8A 2P78A 2HRQA 1N2CE 3K09A 5ANRB 5T3YA 5AW2A 2B20A 2JFGA 3FB1A 3V2HA 4DLTA 5B30A 3U4DA 1HSOA 1CQJA 3VAYA 1UP4A 2V7EA 3K35A 3NGMA 4MR9B 2PUVA 4WMLA 3T95A 3A0UA 3TDMA 1HYEA 5H80A 3BWDD 1TM2A 4X64B 4DFDA 1TJPB 2HR1A 4CEHA 4DZZA 1W4LA 5ENVA 2A3RA 4A6PA 2YVUA 4NK5A 3PQ8A 4H1VA 2O2HA 1V48A 4DT1B 1BXRB 5CFMA 3Q6MA 5IT0A 1GQOA 2E1RA 2VSXA 1HT0A 4MI9A 5IAEA 2UZ1A 4QHYA 4NY1A 3OWOA 1DBQA 2WYHA 3C7AA 3FOBA 3FOEC 3ACBA 4DILA 2ARKA 3NM6B 4D5GA 3UTDA 2NZJA 1PL0A 4DRYA 5JMWA 1AXEA 2C4UA 4I2NA 3U13A 4EITA 1ULBA 3PRYA 3BAFA 1X39A 2ZQYA 5LA6F 1K4YA 1M8KA 5FUYA 5JJCA 2B7CA 4AS3A 1X8KA 1MR3F 3TRDA 3ZLVA 3KC2A 4MVXA 4YC7A 1EVKA 3QVWA 5KYXA 4ZCMA 4MMZB 2O23A 4K9RA 3OD1A 2C2BA 4XQCA 4Q00A 1AQUA 2ORYA 3DM9B 1ECBA 3L4EA 3PBKA 3ADOA 1RYYA 4R0NA 2QIPA 1R6AA 3I8SA 3GJTA 4RHXA 1H4QA 2XXAA 3CRW1 2FV8A 2D0PB 3JXEA 3W5HA 1TQHA 1NE2A 2G8LA 1BRTA 2EZ4A 4WA7A 1CEEA 1VPLA 1I01A 1V1MB 4Q3KA 5IAGA 3BERA 5KTYA 1E3WB 4A91A 3UJ9A 4HJRA 4KJZA 1IWBB 5HR5A 4OMCA 2BZ0A 3QELB 4K6GA 5E4TA 8LDHA 1HZZA 2VT2A 2X9NA 2RHOA 2A5JA 2FLVA 4LI3X 3T12A 4A6DA 4UM9B 2V4UA 3VOAA 2D74A 4D8XA 1I9GA 4DQXA 1PTJA 5A1JA 1AV6A 4ZALA 1I2AA 5CW1A 3E7WA 5JI2E 1G20B 5KDDA 1B1AA 4Y2YA 5H3LA 4V39A 4HZUA 1BD3A 3M82A 1KMHB 1TIKA 1KE1A 4HEJA 4KIUA 1JE0A 5A1TA 4K9MA 1ZMRA 5F2EA 4TSRA 2ISCA 4Y98A 2XITA 4D9GA 4KSYA 3WK4A 4CLRB 3OO0A 3P94A 3C7TA 2LGJA 5CCEA 3CXRA 4BNDB 4B34A 3TD2A 3HABA 2PX8A 3HB5X 3NHBA 4JVMA 3DL2A 3PVSA 4ZQFA 3TUZC 4KNWA 2UVPA 1SVMA 2WLSA 4XXHA 1R8JA 4IDAA 2JJ2D 3CONA 4H08A 3WGLA 3NHWA 4ER5A 1K6MA 2WG1A 2MR5A 4F6RA 1IDOA 5IJXA 1BDJA 3KOYA 4I50F 1A1SA 2H2FA 4G2NA 5E7MA 4GWGA 3DOJA 3BTUA 4YALA 1QO0D 2JH8A 5LYYA 4AYXA 4C7JA 4ZJPA 1DHTA 5REQA 1YL6A 1DKLA 4DLZA 5IBCA 3I8XA 5FEMA 3HXOA 5JJLA 2G4VA 4Q3OA 4XWGA 2HJSA 5JLJA 1CBUA 1P0IA 1WDKA 2YWCA 3REQA 1USKA 1KDTA 2CNOA 2JL1A 2VRNA 1IXRC 3ACCA 3GCGA 3GJYA 2JEYA 2H9IA 3EASA 1X77A 2A78A 3HFSA 3IAS6 4HNQA 2DAPA 2QM7A 5B7PA 3LFTA 2FGJA 4ZCTA 4DDVA 2RHLA 1Q0QA 3W5SA 4B6SA 2VBGA 3MK31 2PUTA 1FSPA 1SXPA 1H2ZA 3M3HA 1GY8A 2D1SA 4AYWA 2F43B 2B30A 3ZXIA 4LJKA 3JQ6A 4IIFA 1RCFA 4MPTA 4A6XA 1MB9A 2ZVPX 4UHFA 1Q84A 4OHCA 2UYGA 3O74A 3RVMA 2OL4A 2P6RA 3CNLA 3S2YA 2I62A 1AUPA 4OI2A 4RPGA 1YZYA 3BEDA 5DDIP 4KN6A 7YASA 3CSSA 4F8EA 2CCKA 4I6JA 3HTXA 3GEBA 4QD3A 2Q5OA 3RASA 2O8BA 4JQSA 4ZQBA 2BR3A 2YS7A 4L0DA 2X9VA 1T4MA 3P45A 1Q0LA 3TSCA 4DDHA 2PSDA 4Z54A 2Q0QA 1L7BA 5FWXB 5FLEX 2VCHA 1VIYA 1YE5A 5EN4A 3TH5A 1QHSA 2OHIA 1U0FA 3MJ4A 3KLNA 3C74A 5HS4A 2ICAA 1RJDA 3A4YA 1C41A 1EX9A 4TGLA 2WNHA 1DEOA 4UTNA 1LSOA 1D2HA 5CBPA 1DBPA 4YLYA 5EPUA 3BCRA 2WU4A 2XE8A 2A9KA 2D5CA 4LZZA 5AKXA 1YA6A 4RE6A 3AEYA 3AUKA 3MWJA 2W6NA 4PAGA 3WWEA 2RAVA 1HM5A 4C22A 1ZL0A 3PXBA 1SCNE 1ZD5A 3WWPA 4CE6A 3GPDG 4N7MA 5EESA 3H11B 3OZBA 1U7XA 5I8ZA 5BUSA 2FKAA 3IP6A 3KSDO 1ML3A 4YY3B 5CH3A 2IOQA 1SWVA 3K2IA 3EA0A 3RKUA 1L5QA 3TKLA 3GO4A 1R00A 1HFKA 1X13A 3DTNA 3CH6A 4OUDB 5E6SA 2BBSA 1JR3D 2EOAA 4K6MA 2SCUB 4DB2A 1WG8A 3HVIA 3KOOA 4O02B 1TZMA 4R1SA 5IVDA 1DWUA 4AKHA 3MC1A 4KFSA 4ODIA 2FE4A 3EXHA 4HAYA 3E82A 1ZM4A 4BYGA 4ZAWA 2PVCA 3H4VA 2GZ3A 4JROA 5DSZA 3AJEA 3ICEA 2ZDQA 4QOJA 1RJ9A 2XZDA 1PYDA 1GNTA 1G8SA 4GBJA 5B3JA 2D2FA 2DM6A 1JEEA 2JHCA 2Y4OA 5CDGA 4B3DA 3CVYA 3F5QA 4PSKA 4LBVA 4BPBA 2QTVA 3IJ5A 3WLMA 1KMCA 1PP4A 3TR0A 1E99A 4O2BA 5TT0A 1RABA 3L8CA 3GGPA 5J9FA 3R20A 4AJ2A 3SNKA 5JXGA 4D9IA 1UKYA 1WNTA 4D1YA 4XPIB 3EULA 3LTEA 5CYOA 3ZWOA 3OQVA 5DTMA 2XTAA 3HRKA 1QV9A 4BVAA 4DQLA 3FGNA 1YRLA 1RHQA 2J5QA 1O95A 5JUWA 1UC8A 3OFVA 1O4WA 4G86A 1RMYA 3CHYA 5KOJA 1I51A 2CUTA 3MD9A 4NFSA 4QXMA 3VHLB 5K8VA 1MX9A 1YK1A 2FSHA 3JQ7B 4GLJA 4TWZA 3E9MA 3BK2A 3INYA 4UU0A 4NNOA 3VAZA 2AKEA 4CQNA 1UEJA 1V47A 5F5LA 2E4WA 2XMSA 1VXRA 2ZIXB 2VPTA 4KAAA 3SHTA 2HA2A 1YGPA 1V43A 5KOHA 1GQRA 4KH1A 3FDFA 2N47A 2R48A 1P60A 1FNDA 3NOVA 4INAA 1CNEA 3JR7A 3LVQE 3IP8A 3O1JC 3TQHA 3ZCXA 5JT1A 4RFVA 2JIQA 3PK0A 3GR6A 4RSHA 3VH4A 3CO5A 3L8HA 2ORWA 4DV1B 3RRXA 1CY8A 1RRKA 3GEMA 2JJQA 3L8YA 3FUTA 4M88A 4X6UA 4YCCA 5JC1A 2QTTA 4OGLA 1I4LD 1PHRA 2C5AA 2C8VA 2DEUA 1GU7A 3Q7QA 4PHCA 5E1BA 3OE5A 2EZUA 4BLTA 1GV1A 4EX7A 4YJ2A 5LCXA 1GCOA 2VDWA 1E2BA 1ZH8A 3I61A 2PUDA 1JWAB 1NJ8A 2WWRA 3WAJA 1G17A 4MQLA 2JLZA 1UBTS 3D6AA 1MQ8B 2PNFA 1JLSA 2H00A 3FDJA 3NTVA 4BQRA 2BZGA 1T6ZA 1O89A 1GEEA 2VNKA 4PGAA 3DMPA 1TUEA 1FTGA 5JCZA 2J31A 2JARA 1Z7YA 2GPWA 3JQ9A 4QASA 3H2JA 1CZHA 3PFCA 2XF8A 3IUNA 4L7VA 4L28A 4YBRA 5FPPA 3T9FA 4EA6A 1U2DA 1UOQA 2OV6A 4LPSA 4FE7A 2YWEA 3G2OA 1W47A 3OZ7A 2CSXA 2OAQ1 2GBPA 2ACWA 5B4UA 1IXSB 1K4KA 3B7WA 2X5OA 2ZDHA 1L3CA 5DYGA 3WYDA 2HMVA 2WAYA 3ZHTA 3OIVA 1A5BB 3DWGA 1TT7A 2BM1A 3VFDA 2EATA 5FBZA 1OE0A 4PPYA 1SD5A 1GPMA 1Q3KA 3DBHA 5DHQA 3UUGA 1DKOA 1RBMA 4CETA 2A0FA 5KJ1A 4J7XA 5EE0A 4MV7A 2GUWA 1FFHA 1E18A 1KYVA 3K9CA 4YNBA 5GPBA 5LJIA 3LKVA 2X0EA 2HPZA 4HLQB 3WYCA 5HJ2A 4GP6A 4U02A 1PN3A 1FDUA 1STOA 3ZWCA 1MIOB 2W11A 4PYRA 3QYAA 2B35A 3EFOB 3IRUA 3Q11A 2A2ZA 3AESB 4Z0HO 2QAJA 3I1JA 4DIOA 2Q5JA 5JCOC 3PEWA 4HLUC 3T99A 5HX7A 2WB2A 1WY5A 3HVHA 3VR2A 2O14A 3WGNA 1TZKA 3GGSA 3KUXA 3LRPA 3DG9A 5KQRA 1SUSA 1KJNA 5KPDA 5K6TA 2GQ0A 2X8JA 3FCEA 2QVBA 3I2GA 3RSOA 3TSYA 1D9ZA 2GA9A 2HN9A 2Z2YA 1QOPB 2QAGB 4JJFA 3VSEA 3PTAA 3N7AA 4IIUA 4MHOA 4WEQA 2JC3A 3OO1A 3ZZMA 1CUUA 2VF8A 3D8HA 5AW1A 4PZDA 4MS3B 2QAGC 3RJ5A 2GO1A 3QI2A 2V97A 4WI1A 3EPKA 4MH0R 1KNQA 5CVVA 2F6RA 2QPAA 3RHFA 1AQIA 1P77A 2B2CA 4WCVA 3VPSA 3BDVA 4PANA 2BHLA 4F7DA 2CE2X 4BNHA 3ZKWA 1FLNA 1TX4B 2G5GX 4V0SA 2XYHA 1RYFA 4TL6A 2VZLA 5LBUA 1TYBE 2HB6A 3I72A 5JCJD 2F64A 1P45A 4WCFC 3LY9A 5FI3A 1CIJA 4CMIB 1YDHA 4LDZA 4IIVA 2CMHA 4AP9A 5KYWB 1H8EA 1Q2UA 1R74A 1LPBB 2MSEB 1NULA 1T9GR 3WB1A 1O1YA 2B8TA 2VIIA 3BH6A 1H4TA 3LAWA 3IQIX 2PKQP 3DV2A 4BBPA 5ISMA 4RULA 5A3VA 3FPSA 4C4TA 4F9TA 4C4SA 3AKZA 4U9IS 3KX2A 4GLBA 3TMAA 5B2EA 1KVQA 2MSWA 5IKOA 1MC8A 1E1CB 4UBJA 1NOJA 4K40A 4TRJA 4C4XA 3FYSA 5ECWA 4HGPA 1U3CA 4IGEA 2O8EA 3CNHA 3KJIA 3ZDQA 4V38A 4MDFA 3IIIA 1N8KA 3OKAA 1XKXA 4QUJA 3A2LA 2FPLA 3DVRX 5JNVA 3CH4B 2HFKA 3HN2A 2HV8A 2H3EA 2XSZA 2RGCA 1GSOA 3P26A 2ACEA 2XEDA 2PX4A 5A5EA 3HDYA 4XUGB 1HNXB 3V4VB 1X7WA 2JCSA 1II8B 2NZVG 1P80A 1SAYA 3TLBA 3AJDA 2RHGB 4V3CA 4IO1A 4XKJA 1IN5A 4LK2A 4LJAA 4ZGBA 1N5DA 1MGPA 5G1PA 2OZLA 1YHNA 1IH8A 4XVCA 2WIAA 2TS1A 4MRPA 4N3AA 3FPCA 1IRIA 3B7GA 4QXOA 1X1SA 2PRKA 1XPOA 1EFKA 2JD1A 1SD2A 3ZHRA 2B1JA 1S8NA 1W36D 1F6BA 3OE7D 4ON9A 1G21E 4HWTA 4QT0A 5ELMA 5ALLA 4ZEOA 3WLTA 5BVHA 5JZMA 1RZRA 1IFXA 3CH5A 1DWOA 2AG8A 2Z5FA 4C5CA 3CJTA 3GV0A 2VSYA 3H5IA 3VU3A 2ZI7A 4BRSA 2Y93A 1CYDA 5IJZA 1FQOA 1FNMA 1O94D 1VPTA 1YDGA 2KYRA 2YINC 3FCUB 4P54A 4YXWA 1FFEA 4AULA 3P9RA 3UJBA 1E1LA 5IW8A 3ENKA 5BYAA 1IUKA 1JKMA 3BD9A 3FGOA 4I1UA 1DUVG 5ALRA 2CUNA 3K71B 2RCYA 2GSDA 3QU9A 1MOPA 2X8BA 4S1NA 5P21A 2BGMA 2PEYA 3RM3A 2VZ8A 3PE3A 3W9BA 4CTNA 4XB2A 3ZKAA 1B14A 3PS9A 4A0QA 2BGNA 1W2HA 1U3WA 3SQLA 2JLSA 3OM9A 1TCAA 5CFOA 3ZHCA 1CQJB 3K09C 3BIXA 1QPZA 3DE1X 2PSSA 2OB2A 3LX5A 4TN5A 5C53B 4GNKA 4ND1A 1K92A 2RJNA 2O7SA 5CB4A 1O3YA 4A10A 5JBQA 3CF6R 2IBSA 4J75A 4L0CA 2QGFA 1NBHA 1TM7E 3NWOA 4BGUA 2AN9A 4E32A 1DADA 2EKPA 3CYFA 4I9UA 2FJPA 4BKQA 1DDIA 3O4GA 1N78A 3IV7A 1OLUA 1IY0A 1ZLYA 4MW2A 3W06A 4BYMA 1LW6E 1K7CA 2YWXA 3TM5A 4DA8A 4H3HB 2DQKA 3G2LA 4CM4A 3R5XA 4E0BA 1W30A 5K0NA 2ZM6B 2XBLA 4DBLC 1SPXA 4XYMA 2V55B 5A9TA 1DEXA 4D79A 4QBGB 4MQEA 1BS2A 4ZAYA 3GZTB 4O2LA 1SZCA 2AG6A 3JQAD 5EIHA 4CHTA 3U6KA 4JX9A 4DWVA 1YQTA 4WH0A 4KAJA 1NVKA 2AJDA 1UMDA 2F48A 2YZNA 4C0QC 1F60A 2VF5X 1P0FA 2FJUA 3LLUA 3GRVA 1Q6YA 2FAXA 3U09A 4MS4A 1C7FA 3EUAA 1ZJJA 4ZVSA 4YQEA 4A8PA 4OQZA 1PR1A 4Q1VA 3UGJA 2VP3A 4TYYA 1C3VA 1M67A 2XVZA 1KZYC 1O6GA 1SC9A 4RX1A 1OLOA 3L6RA 3RVLA 1MA0A 4PLGA 4ZO6A 5JZOA 5C52B 3A9VA 1JWBB 1NVDA 4FC6A 1RXIA 3PQFA 1OGIA 1D09A 3PGJA 1T10A 4AJKA 5JXJA 4UHJA 5BMVA 3DGEC 3DDSA 3EARA 1RSZA 4C5BA 1CW2B 1DO8A 4B35A 4I9HA 2A5DA 3P4UA 2GK3A 3ZCPA 1HZZC 4QYIA 4GEGA 5C18A 1ODJA 5IRCD 4TLAA 4KRFA 4TWBA 2Z2KA 2GUGA 3T8YA 5LXTF 3HFRA 4HNVA 1CPYA 1IHDA 2K7FA 2J3DA 2OY0A 1GAJA 3CR7A 2E21A 1DQSA 1VCMA 3JZAA 4LC9A 1TF5A 1H5UA 1X3SA 2MDTA 3DWFA 3U61B 2A0WA 2C7BA 1WV0A 2FPXA 5K0LA 5K5EA 3LP8A 1ESEA 2BONA 2G3YA 3KPUA 2UVPB 1GG9A 2PS3A 2ZWIA 1OPRA 4HDKB 3TPCA 5B1YA 4JVOA 4I9NA 4JC0A 3AQ4A 4NOMA 3T5DA 4AWXA 3DOOA 2DERA 1GFZA 3A0RB 2RHBA 1THGA 3O8LA 1F4PA 3P9SA 4OX9B 3ZHYA 2P5UA 4OJMX 4E14A 3U7IA 1P2TA 4LSWA 1VA5A 2C5GA 2RBGA 4RPHA 3WBFA 3WAGA 1ZJ4A 2FRXA 1EDEA 3FNEA 3UG6A 5SZKB 4Y2JA 1JRLA 1M8JA 3QKTA 4DSNA 2HF7A 2W2XA 3CNOA 4PN3A 4JJAA 4PQGA 5KINB 4YJDA 3C5WP 3U3OA 4GLFA 1R0SA 1TA4A 2NVOA 2QD2A 3O6VA 4KMOA 4M0MA 4ZVKA 3CGWA 4N4AA 1LVGA 1ZRSA 2NSDA 2WKRA 3E5MA 5EKSA 4XVUA 1WD5A 4YRSA 3LBHA 4R9SA 2BE7A 2J09A 1AHPA 2AN1A 2B82A 3CF4A 5TQ2B 4D9BA 3S99A 2OHXA 3VVBA 4KLAA 1B8VA 4LHWA 1OT3A 4IOLA 3IUBA 3DZ8A 5J2TB 1FS5A 3F9IA 3GAZA 2I4RA 1A5ZA 1WDTA 4B6JA 2X4DA 2VAXA 4JP8A 2XNHA 4GZ6A 2OXTA 4WGFA 3STYA 2WWHA 4C88A 1YRQA 1P3DA 2AZMA 1FF9A 2VXOA 4LNAA 4TV9A 4ZDWA 3EZ7A 3B2EA 5BUZA 4LY3A 1D7AA 1ZITA 3BRCA 1L6IA 4IO0A 4JJIA 5H1YA 1HE2A 1HFJA 1I0ZA 4K87A 2XWPA 4M46A 3OOJA 1XT6A 2GA8A 2HA7A 3HKEA 4OOFA 2ZIVB 3A2MA 4ZO7A 1ZC4A 4GI1A