4UUMA

Apo trichomonas vaginalis lactate dehydrogenase
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
334
structure length
334
Chain Sequence
SEAAHVLITGAAGQIGYILSHWIASGELYGDRQVYLHLLDIPPAMNRLTALTMELEDCAFPHLAGFVATTDPKAAFKDIDCAFLVASMPLKPGQVRADLISSNSVIFKNTGEYLSKWAKPSVKVLVIGNPDNTNCEIAMLHAKNLKPENFSSLSMLDQNRAYYEVASKLGVDVKDVHDIIVWGNHGESMVADLTQATFTKEGKTQKVVDVLDHDYVFDTFFKKIGHRAWDILEHRGFTSAASPTKAAIQHMKAWLFGTAPGEVLSMGIPVPEGNPYGIKPGVVFSFPCNVDKEGKIHVVEGFKVNDWLREKLDFTEKDLFHEKEIALNHLAQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Gradual Neofunctionalization in the Convergent Evolution of Trichomonad Lactate and Malate Dehydrogenases.
pubmed doi rcsb
molecule keywords L-LACTATE DEHYDROGENASE
molecule tags Oxidoreductase
source organism Trichomonas vaginalis
total genus 113
structure length 334
sequence length 334
chains with identical sequence B
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4uumA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4uumA02
3OH8A 3JQAD 1PWXA 4DIOA 4GLLA 4WLOA 2VWQA 4WKGA 1W73A 3ROMA 2Q2VA 1HYHA 1OZAA 3GRKA 4EYEA 2JFHA 4Z3KA 3WBBA 3AOEA 1WAMA 1MXFA 3UFXA 4LSMA 3IS3A 2X9NA 4XR9A 4AG3A 1K6JA 1S7CA 1HSZA 3BMOB 3HUDA 3JYPA 2FR1A 4Q3DA 5I7SA 3AFNA 1NX6A 3W8FA 5DBGA 1C1XB 2PTGA 1KEWA 3HADA 4K26A 4RJTA 4OJNA 5A5FA 4BO8A 1BWSA 1NR1A 2O50A 3O8QA 2BELA 1U9JA 4CLOA 1PJ4A 3MTJA 1VL6A 4I5EA 4FOOA 4CQLA 3B20A 1TT7A 1NHWA 1XSEA 1QYXA 4RL6A 1N1GA 2GDZA 1E7SA 2PZJA 5KIAA 2EF1A 1LA2A 4N54A 4OAQA 4LVUA 3JV7A 1VI2A 3KUXA 4YCAA 2O4UX 4IDGA 4A03A 1V3TA 4IZIA 2GD1O 2GSDA 2UUOA 3TN7A 1UAYA 3I9OA 4IDAA 2CF6A 5TRTA 4RORA 5I9MA 1WDLA 4BHTA 3PTZA 5C7IO 1Q0QA 3VZSA 5G4LA 2UYYA 2OMEA 2X5KO 3KYCB 4YA6A 2A94A 2JHGA 1PS8A 3M1LA 2GPTA 3C85A 2Q1SA 1GYRA 3DO5A 3SJ7A 2ZTMA 4H16A 1O6ZA 1H2BA 2X1HA 2UDPA 2FY8A 4NBUA 3WIDA 2YDYA 3PXXA 3DHNA 3IL2A 2UVDA 1Q1NA 2O23A 2Q2WA 5U4QA 1U5AA 4EZBA 4CLDA 3RSHA 3W6UA 5L4LA 2G0TA 4JN6B 1DIGA 3CKYA 4JQCA 4R1SA 4FC6A 1RYDA 5JCXA 3UN1A 2FHSA 3WFJA 2CUKA 3RUAA 1ZCJA 3DZFA 4CV0A 5L9AA 5DCUA 1FDTA 1RJWA 3QVSA 1KVSA 1E7WA 4YJFA 2O3RA 1NWCA 4CLXA 3QSGA 2AMFA 3F4LA 4Q39A 4PLGA 2EKPA 2CY0A 3S2GA 4IJVA 2FZWA 3OM9A 4JK3A 1QYDA 5ER9A 4MDHA 1K6IA 5JBIA 3QW2A 4UEKA 5TT0A 4IDCA 4B7UA 2PY6A 3NJ8A 4ROSA 3FPCA 3DOCA 2O3JA 4P4GA 3IJPA 3DBHB 4CQMA 3I83A 3GMSA 3NAQA 5JMPA 2VNAA 4FBGA 1C1XA 1MFZA 3OFSA 4N5LA 4BO7A 1ZBQA 1N2SA 3UKOA 2NVBA 5JO9A 3HDYA 3I4CA 2Z1MA 1Y9EA 3FTNA 3WGGA 4B3JA 3JQBA 2BF7A 1HZJA 4BGUA 1ZK4A 4I5DA 1K6XA 4NNJA 5IDXA 3AM5A 3TL3A 1C0KA 2VYND 3QJ5A 3ENNA 1EDOA 3DMYA 2ZCVA 4JP2A 2ZYDA 5CP8A 5I8WA 2FOIA 3L77A 1YO6A 5MGBA 3H9JA 1H6DA 2NM0A 1JDJA 3PZRA 1IZ9A 3OETA 4QFCA 4TRMA 2RAFA 4XQ9A 4KUGA 1ENOA 1I2ZA 3QQPA 1XEAA 4YT5A 1N7GA 2HMWA 2VUTA 3RUFA 4CL8A 5ITWA 3JCZA 3RUHA 3JQGB 3TFOA 1X13A 1NPYA 3PK0A 4K9DA 3KB6A 1E3JA 4CMAA 1LNQA 2P91A 4F46A 4FCCA 3ZI0A 4CMBA 5HBRA 2Q49A 1ML3A 4HNHA 4LISA 4ZRMA 3WWYA 4L76A 3NTRA 1HDOA 1P74A 2I66A 2JL1A 4WCFA 3GPDG 2RCYA 4MIOA 1YBMA 2ZTVA 3UCEA 4JXKA 1W4ZA 4NJMB 4L9RA 5TNXA 2CZCA 3IUPA 4KOAA 1PEDA 2PGJA 1KC3A 1X1TA 2D0IA 4CUZA 1YKFA 4Z0TA 2Q4EA 5G2OA 1EQUA 4Z0HO 1R16A 2GERA 5DT9A 4ND5A 4QQRA 2Q46A 4TRNA 2DBQA 1DAPA 4BNZA 4RPJA 1B14A 4D46A 4EUFA 1VC2A 3LT2A 1CJCA 2ZIZA 4GSLA 4PFJA 4E31A 2Q1TA 4M55A 4XZ3A 4MIEA 1DSSG 2DQ4A 3I52A 3I9MA 1UXKA 1XA0A 2CVZA 3BTUA 2HK7A 4P22A 1QP8A 5JDIC 3I6QA 2O3UA 1IE3A 3FI9A 1V6AA 5CHEA 1EVJA 4PG8A 1I0ZA 1QLHA 3UCFA 2TMDA 5C3MA 4W4TA 4E5NA 5F5NA 1LDNA 1H6AA 4DGSA 1EBFA 3ZU5A 3HDHA 3OECA 2JFFA 3HSKA 5AXDA 4OGWA 1U3VA 3BMNB 2JD2A 1QYVA 3G1TA 5JDCA 2JD1A 3NJ4A 3ZGYA 3VPGA 5JCJA 2DFVA 2P68A 1RM5A 4F45A 3TPCA 1NQAO 2YHIA 2HUNA 4BGVA 4U0JA 4O1MA 4WNCA 3FNGA 1PJ3A 1T25A 5U9CA 1AXGA 1OBFO 4O59O 3QE3A 1B16A 2JAHA 3JYOA 1H94A 3PP8A 5H81A 3T7CA 3VOSA 3DWFA 3VAZA 4GBJA 5KVCA 4PG7A 1Q2XA 3NDRA 5LDGA 3C7AA 3VHRA 3VH3A 1HYEA 1I8TA 2O2YA 1UAGA 4CLHA 1X7HA 4NQZA 3FTPA 3ROPA 2H9IA 1E3WB 3T4EA 1EQ2A 2X4GA 1N7HA 2VYVD 4OH1A 2HU2A 3WOHA 1A4UA 1V3UA 2HSDA 3C8MA 4XCVA 1NAIA 4J1TA 1FDSA 1ZJZA 3TRIA 2JD0A 1JWBB 4C7JA 3Q2KA 4W9NC 4PLVA 4CM1A 1XGKA 3AJRA 4CM9A 5KOIA 1QKIA 2QQ5A 1H6CA 4ND2A 1EUCA 4GLOA 2XXJA 3FNHA 4M89A 4NZ9A 4QFDA 5GZ6A 4D41A 3RFXA 2SCUA 4LMRA 5LDHA 1LSSA 3ZV6A 3S2FA 4YQYA 1ZEJA 3GG2A 4HFJA 4YAGA 1JA9A 1RM3A 4B7CA 1EFKA 1GAEO 1JAYA 3D1LA 2JCVA 4WNIA 4O63O 2C59A 1NBOA 4ZQEA 3F1LA 5DN9A 2NU9A 3CPSA 5KJCA 2VHXA 4D0SA 3INRA 3HHPA 3ASVA 1DJNA 3EGOA 1A72A 1JLLA 3BHIA 4R69A 3HB5X 4IQ8A 2CF5A 5ER6A 4CMCA 2V6MA 3NKLA 3WQRA 4DUPA 4PCVA 5IJZA 5TF4A 4D44A 3ROKA 4EUHA 4ZD6A 1U7TA 3N7UA 3VZQA 1Q7CA 1X1EA 3GNTA 3D4OA 3L6OO 4BB6A 3PWKA 1OFGA 3T4XA 4B8WA 1C0LA 4YVFA 3UF0A 3WJ7A 3BMNA 3QWHA 4LCEA 4I9UA 3Q2IA 3JD0A 4IPTA 2FN7A 1A71A 2DFDA 1G1AA 3DQPA 1AXEA 3IAHA 4NPCA 2DTDA 4J3FA 3IKTA 3WYBA 4MVJF 4RVGA 1ZVMA 3FN4A 4LK3A 3SVTA 2NTJA 4DL9A 3BMQB 5AOVA 3L9WA 3H8VA 4BUCA 4PG5A 2X0NA 5A3JA 1LDEA 4Y6PA 5I8ZA 1LJ8A 1GL3A 1I30A 1LQUA 1YGYA 3M2TA 4WOJA 3ZU2A 2PZMA 2BLLA 4HKTA 1YJQA 2NSDA 1DOHA 3W6ZA 4YT2A 3MJCA 8ADHA 3WSWA 1ZMTA 1T2AA 4L4SA 4EJ6A 3FR8A 4IJWA 4MINA 1E92A 1HE5A 4G81A 2YDXA 3WBFA 3EC7A 2Q50A 4Y6SA 4BNIA 4R9SA 1XDWA 2AEJA 1F06A 1Y1PA 2OL4A 4JBGA 3WMXA 5BT9A 2QRJA 3K8ZA 3PI7A 1DXYA 1JKFA 1HLDA 1YDEA 5JDIA 4J9VA 1EK5A 2EJWA 4J49A 1YL6A 5G0SA 2YZ7A 4K6FA 4TRRA 5DCWA 4KWHA 2NU8A 4MOWA 2GRAA 2FPIA 2PKQO 3NDIA 5C5IA 2F1KA 2HMSA 4ZQGA 4ZHSA 1E7MA 3JYLA 3W8DA 2RHCA 4I5GA 3JTMA 3MCVA 4KTVE 1MG5A 1YRLA 4IS2A 1PGQA 4BVAA 2G82A 3Q9NA 1R37A 2VRCA 4GX0A 3BHJA 4BV8A 4YRAA 4YT4A 3DBVO 3F5QA 2G1UA 1FDWA 4FSHA 1PIWA 4MVJM 1BXZA 1MC4A 2GN4A 3EW7A 5IDWA 4YJDA 4BNYA 5JPIA 2YQ4A 4OIMA 3WICA 2P4HX 2IYPA 3ZWVA 2WJPA 3D5TA 1E7QA 3QVTA 3ZNNA 3E48A 1I3NA 1LEHA 3GNQA 1P44A 4RPKA 1VRWA 4E5PA 1PQWA 4JBHA 4PIVA 4FFLA 2X7HA 3AM3A 1K3TA 1CIVA 1QG6A 3F46A 3HN7A 4L4XA 4NK4A 5HS4A 4KUEA 1XU9A 3BHMA 3FHLA 1SPXA 3RAJA 2Y0DA 1RYEA 5ENDA 1OAAA 4NI5A 3DZKA 3ANLA 4FS3A 3E5RA 3BMQA 1GCOA 1HETA 3KM0A 4FGWA 3E8XA 2D8AA 1GPDG 2PNFA 3ZHXA 1YOVB 2Q99A 4FFNA 4PLPA 5C7OO 2AQ8A 1VJTA 4H3VA 2ZYAA 2EJVA 4J1NA 2NVUB 4YRBA 3WWZA 5CDGA 5I7EA 3RFVA 4FJ0A 2DU8A 1B2LA 3AI2A 4DVJA 3F6YA 4XYBA 4E2ZA 3NRCA 3FWNA 3K2EA 3RUCA 3TDKA 1VPDA 2AEFA 4R1NA 5JFOA 3OEWA 3WYCA 5IXYA 1P45A 2EEZA 2UV8A 3DBLA 3ETGA 4HFNA 4ALJA 1NNUA 1HDXA 1HXHA 3GPIA 4RVFA 5LC1A 4BNLA 4ILKA 3P7MA 4RVHA 3MJVA 2R2GA 3PHIA 1SNYA 5AXCA 5HWSA 4MVJP 4W6ZA 4MP8A 4ZRNA 1BG6A 1O5IA 1HKUA 2C54A 1HSOA 4OQYA 4WUVA 1PQUA 2EGHA 4BKRA 3ZNQA 1LUAA 2BGKA 3UUWA 4BQRA 3GEGA 3VPHA 2B0JA 1D1SA 2NU7A 4BO3A 4INAA 5DP2A 4AJ1A 1ARZA 4J1SA 4E2WA 3C1AA 3GAFA 2E82A 3IJRA 2BHLA 4D79A 1D7OA 3G17A 3G0OA 3SLGA 2G17A 1HYGA 4BO0A 1AE1A 3OEYA 1XELA 2POQX 2RH4A 3ONEA 1VSVA 2QHXA 5I9LA 2H5LA 2DAPA 3IQDB 3UICA 1GUYA 4RO0A 4KMSA 2ZKLA 3HN2A 1LRJA 1Y9AA 2IXBA 3KSDO 1HDCA 3GEMA 3OIFA 4D3SA 4A2CA 1TEHA 4XA8A 2AG8A 4F6CA 4RPGA 2IZZA 1IL0A 2ZYGA 3H2ZA 4BNMA 1E5LA 1NM5A 3RROA 5GZ3A 5KTKA 2X58A 1PS0A 3RBXA 3WGHA 3KLPX 2NTNA 4R5MA 1H93A 2BKAA 4CV1A 1M6WA 3AUUA 3I5MA 4OKIA 3O38A 4UUMA 1F12A 5EJ2A 3TWOA 1CRWG 4J16A 4OO3A 5THKA 3EVNA 3DTTA 4IBOA 1GCUA 4EEZA 4Q3CA 4GX2A 1VSUA 5A9TA 2QYSA 3VZPA 5A03A 1XU7A 3JSAA 4CM4B 3WXBA 4Q3NA 5MDHA 1P1FA 1QXSA 3OICA 1UH5A 1KVRA 3V1YA 2WD7B 3GFGA 1BVUA 1MUUA 4OOEA 1N9GA 1FK8A 1P3DA 1CETA 2XOXA 5CPFA 5GMOA 3WNQA 1R0KA 5JYDA 1EZ4A 2QRKA 2QW8A 3JQ8B 4H15A 2GYYA 1PL7A 3ITDA 3OQBA 2C5EA 2VTDA 1SOWA 2C2YA 3GHHA 4ND3A 4XJTA 5B12A 1EK6A 2P2SA 4BO2A 1XLTA 2HKIA 3CINA 5AQ1A 1GY8A 3A1NA 3LT4A 3PJEA 2Y0EA 3EY4A 3RUIA 2C2XA 3PLRA 1U4OA 1H9BA 4YRDA 2QIOA 3GGOA 4J4TA 1WLYA 2Y68A 3GN1A 2PK3A 4TRJA 5JE8A 4D42A 3U09A 2B5WA 2NVWA 4YJHB 3ZHZA 3FNFA 4J9UE 2I5PO 4QX6A 2X22A 5BSHA 3V2UA 5A04A 1SZJG 4B3IA 3TQHA 4JGBA 4PG6A 3KOUA 2BD0A 3DOJA 3V2GA 3RC1A 3VH2A 1O89A 2VWPA 2DC1A 5KJ6A 4W82A 3KLMX 4JCOA 5F21A 4OQZA 3FNEA 3DOOA 3LC7O 4UEOA 4E33A 2YV2A 4E0BA 4XDYA 2P5UA 1VM6A 2GASA 4ND1A 3LSYA 4ID9A 4PZCA 3QVWA 1T1SA 4LW8A 4BO6A 4PLCA 4OYRA 4R1TA 2P5YA 4GH5A 2ZB7A 4FFPA 4LMPA 4MKRA 5ILOA 1DIHA 2XXBA 1SCUA 2JFGA 3RKUA 4DPLA 4BKUA 3ITKA 4D43A 1DIRA 4HX5A 1Z7BA 1B8UA 1H9AA 4DREA 3UH1A 1NPTO 1E5QA 2J3KA 2J6IA 1WVGA 4R1UA 2I6TA 2Y1EA 3WQQA 4JNKA 1V0JA 4D3FA 5EPOA 2PLAA 4E2YA 3NGXA 1ADFA 2AW5A 4XWYA 4DXHA 4TVOA 4L74A 1D1TA 4CQMD 3CSDA 3OJEA 2Y1FA 4DMMA 3P5SA 2ZTLA 4BO9A 2Y1OA 1YH3A 3C24A 5IXSA 1MB4A 5G0WA 4NFHA 1GUZA 2VT2A 3HB4X 1GQ2A 2ZB4A 1MC5A 2I3GA 4FN4A 1P1IA 3ORFA 2AHRA 1JTVA 4GVLA 4Z0PA 3ONFA 1ZK1A 5CEFA 3LVFO 1F0YA 3JQAB 3FPLA 1X7DA 4ZQBA 1PZEA 1FDUA 3UXYA 4ONEA 3AFMA 1HRDA 2EV9A 3TF5A 3KZVA 1CYDA 3H6KA 2IZ1A 4AJHA 3KO8A 3ZWAA 4XGIA 4AJLA 4MKZA 3ETEA 2Q4BA 1K5HA 2VUSA 5TX7A 3RC9A 3F5SA 4YAIA 1RM4A 1K0UA 3NV9A 4J90A 2YUTA 5DBIA 4WK6A 3VZRA 3W1VA 3AM4A 3X2EA 4CLRB 2Y05A 1LRKA 1LLQA 1H0KA 4AJ4A 1CDOA 1N1EA 3U62A 2YHUA 3ROQA 1DBVO 3INGA 1PGOA 4FGSA 4EJ0A 3QHAA 4M49A 4UVGA 3ZWBA 3CZMA 3L4BC 4NG5A 3WFIA 4R68A 4GMGA 3FWZA 8LDHA 1VKNA 2OUIA 1DB3A 4BNGA 1GYPA 2YQ5A 4XYGA 1KIFA 4QTZA 1UZNA 5AXAA 4EUEA 3Q1LA 5IAAA 4NBRA 4A0SA 4E32A 1BVRA 4NIMA 2DKNA 4Q3AA 3LT0A 3TZHA 1DC4A 1BXKA 1P1HA 3SX2A 4EI2A 1UP6A 1RWBA 2BI8A 1IZ0A 3JD2A 4DRYA 3PGXA 2DTXA 2ZJ0A 1Q7GA 3I23A 3B1KA 3FBTA 4I5FA 3OP4A 1V3VA 3AWDA 1ZMOA 2XAAA 3TOXA 3H5RA 2A35A 3ANNA 2B69A 3H7AA 3I9NA 3RVDA 1ZK2A 4EBFA 3JQ7B 2Q2QA 4IGFA 3OMLA 3KETA 3GR6A 2VOJA 4RZHA 4ZA2A 1T2DA 2HLPA 3BMOA 2FPGA 4XYEA 3WMWA 5JCJD 3OA0A 5DZSA 1GU7A 2P9GA 4RLHA 2HMTA 2IE0A 2BMAA 2Y1DA 5A06A 3WTBA 1EVIA 3SXPA 3IC5A 4H7PA 5F1OA 3QA9A 1DFIA 3IDSA 4NFYA 4UUPA 4RLSA 1B8VA 5IF3A 3PFFA 1U4SA 4G5HA 4WASA 4AFNA 4YBZA 2HMVA 2R00A 1VKOA 1U8FO 3OSUA 4MVJH 3KYBA 1HTBA 3JQFC 1XWFA 3N74A 4QO8A 2Y1CA 1EDZA 1GZ6A 4QT0A 1NP3A 1P31A 1NVMB 1EEHA 2P4QA 5K9ZA 1X15A 5A9SB 4IM7A 5A3VA 4B8ZA 3A14A 1XG5A 4JJFA 4WE3A 5CEEA 4B4VA 3LQFA 1WMAA 4L4RA 1C14A 5BNTA 3PHLA 1EFLA 3KYCA 3BTVA 4XB1A 5ENVA 3JQ9C 4L75A 1DO8A 4CM9D 4ALMA 1O94A 5TC4A 3ZWCA 1BDMA 2YY7A 4J91A 1R4MB 1UXJA 2DBRA 2VZ9A 2YFQA 4IIUA 1CEQA 4KWIA 3G3EA 2QZ9A 4DLBA 1ZXLA 2NQTA 2ILTA 4A26A 4AL4A 1E3IA 1DPGA 1R6DA 1A9YA 4BO1A 2BFMA 2DLDA 3FBGA 2DBVO 3VDRA 5U1PA 1QYCA 1ENZA 3LF2A 4YJGB 3RUEA 2VHYA 3AK4A 4PRKA 4QSMA 3HFSA 1W0CA 4IQGA 2V6GA 1UXIA 3NTQA 4HADA 4WOKA 5KWEA 3BYZA 3H65A 2BGLA 3RI3A 2C0CA 2VZ0A 4U7WA 4DWVA 1UP7A 4ZICA 1DLJA 4DTIA 1T2EA 2V6FA 3BTOA 2NADA 2O3QA 5DOZA 1LLCA 3UOGA 4TWRA 2BH9A 1X0VA 4XDZA 1GEGA 1XQ6A 2JHFA 4I9NA 4CMIB 4DLLA 5A4DA 1HL3A 3DBHA 1ID1A 3KVOA 3DONA 4IGEA 4BGIA 4YXFA 4F6LA 1FF9A 1U2DA 2PD6A 2WYWA 3TZKA 4DYDA 1Q0LA 3GMDA 1A9ZA 1JVSA 3GF4A 3WQSB 4DA9A 5T8KC 2RIRA 5KJ1A 3HQ4O 4XR4A 3O03A 1KEVA 2B5VA 1UDCA 3ZWPA 4XQCA 1B3RA 4RF4A 3X2FA 5B4VA 3SC6A 4UAGA 4IMRA 2PD3A 5HA5A 1QMGA 1V9LA 2GZ2A 1A27A 5F3RA 1ISMA 4ZU3A 3K6JA 1FDVA 1T4DA 2FSSA 4OOFA 3V5NA 5A9SA 1U7HA 2DPGA 1A7KA 1KVQA 4U6QA 1KVUA 1LTHR 4CPDA 1YBVA 3V1TC 1PL8A 1UDBA 5I7FA 2YJZA 1NFQA 1UUFA 4XEHA 1M66A 2I99A 3JQGA 1JKJA 1R0LA 1YB4A 3F47A 4I9HA 3D3EA 1LRLA 5TSDA 3GNSA 1IULA 3H5NA 4S1VA 2JAPA 5EERA 5IZCC 5DNAA 5JC8A 1Z7EA 3TFQA 2B36A 1UZLA 3VC7A 2IDZA 1D4FA 1TI7A 4OKNA 3MEQA 4MJLA 1ZUD1 1DDOA 3KRTA 1SOVA 2FR0A 1GV0A 4NJMA 3UVEA 4CMJA 4XQGA 3ONDA 3GK3A 2OFPA 3MOIA 2AXQA 1I33A 4LRSB 3ZW8A 4CMKA 3E9QA 3TOZA 4XYLA 3H9UA 2VRCD 2P9CA 4B79A 2HJRA 4BNNA 3OHSX 5I7VA 4NMHA 1GQYA 2WM3A 2ZB8A 3S2IA 2OBYA 3WGZA 1B15A 3LYLA 1GEEA 4U8GA 1NFRA 6LDHA 1NPDA 1SB8A 4FFMA 2PZLA 4A7PA 3ETDA 3KSZO 4YACA 2I67A 1F8FA 2VNSA 3GRPA 1HF3A 4G2NA 4DYVA 1ISHA 3WIEA 1KY4A 1P1RA 4HBGA 5JY6A 4U0KA 3BZUA 2YYYA 1KOLA 5G4KB 3K92A 2J3HA 3UAGA 2CVOA 1DAOA 5KCZA 4O5OA 4E12A 2W2KB 4CR7A 4KQWA 4TQGA 2IEDA 2X6TA 3DZJA 4PZDA 1QYWA 3UGKA 5IDYA 4BQPA 1Y6JA 2C29D 2D1YA 3VTFA 1KBZA 1ZW1A 1AHIA 4HXYA 2DTEA 3I9JA 3W4JA 5IN5A 1VJ1A 3DMTC 3WG9A 1A7AA 1R4NB 1KEPA 2CDAA 1WW8A 2O4CA 5G0TA 5L45A 1NXQA 4AJOA 1Z75A 2B37A 2VHVA 3INTA 4R16A 5F1PA 1M67A 1E3WA 1WZEA 4PN3A 3BMCB 4R41A 1ZH8A 4LRTB 4X54A 1QR6A 4RGBA 1V8BA 2IEBA 3R6DA 1BXGB 5K6AC 4ALLA 1HZZA 1ADGA 3GA0A 4XQEA 1ISFA 4PGFA 3R1IA 2YFHA 1EVYA 3GH3A 4OSOA 4R9RA 1FMCA 1CWUA 4GL4A 4L73A 3RJ9A 1JW9B 3GDOA 4BNVA 1O0SA 2FSVA 2O2SA 3O4RA 2ZQYA 1EE2A 5IDQA 1UR5A 1ULSA 3ZWWA 4JLWA 4QEDA 4EITA 4R51A 5L95A 3C7CB 2NACA 2TMGA 1HEUA 1J49A 4HUJA 1PGJA 4Z9FA 1FJHA 1U3WA 4RZIA 5JAMA 2C5AA 3K31A 3GDFA 5L7YA 4DPMA 1LDMA 4LCJA 4UUNA 3RCBA 3WLFA 3VH4A 1YB5A 1I2CA 4TKMA 3A4VA 5CDUA 3ZWYA 4CM7A 3OBBA 1DEHA 2F00A 3D64A 4UULA 3QWAA 1GD1O 5JO0A 1R12A 5BSFA 5DBFA 3L07A 4EGFA 2AQIA 5HRUA 3L6DA 2HRBA 4GX5A 3D3WB 5J23A 1QRRA 2NU6A 5FI5A 1NHGA 1Y7TA 1BW9B 4MKXA 2DUUA 2EKQA 2IYOA 1WPQA 3KSUA 1ISGA 4CM6A 2W4QA 1PJQA 3DBRB 3HDJA 1RKXA 1Y81A 3ZNPA 4CR8A 3GGGA 9LDTA 3QWIA 4PLFA 1E3EA 1LLDA 3VKVA 3AU9A 3EZYA 3KHUA 5JYEA 4NDNE 2HAEA 1NTOA 2GCGA 4HNGA 5L7TA 2CSUA 1MFPA 4R5HA 4W9NA 3LLSA 3LF1A 4Y6RA 2W8ZA 1U8XX 4IJUA 4Y67A 5BR7A 5IZCA 2DVMA 1IB6A 3RC2A 1R4NA 4FQ8A 3LDHA 4K1LA 3TNLA 1I36A 1E6UA 3U49A 1MP0A 1LQTA 2H1SA 3O9ZA 4YYZA 1TXGA 4Z3DA 3Q11A 3AW9A 3GZNB 1YQDA 5COAA 4YEDA 1L1FA 3OIGA 1KY5A 3JYNA 1A4IA 1YL7A 3CTMA 3ZCXA 1HWYA 1XIVA 4I8XA 4UVEA 2O3SA 4GGPA 3OIDA 3WGTA 2X5JO 1OC4A 1YQGA 5TGDA 5B4UA 1LC3A 2D4AA 3OJFA 3MJ4A 4O0LA 1TVEA 4FDAA 3CIFA 4CM5A 3U5TA 3N58A 2ZCUA 2AQKA 1MX3A 5A5EA 4E30A 4HFMA 1CQIA 5B4TA 4NR0A 5KKCA 4MPDA 3ON5A 2G5CA 2WTBA 2Z1NA 3K96A 3IMFA 4RVUA 4GSKA 2PR2A 4ALIA 1DRVA 3OJ0A 3DR3A 2Z5LA 2P9EA 2AG5A 2ZTUA 3FSRA 1XHLA 3K30A 4S3MA 3D4NA 3W4KA 4A5OA 4CMEC 2OOSA 4GAEA 4W7HA 4YAKA 2WD8A 5CDSA 1JU9A 1Y5RA 2E49A 3TZQA 3AOEC 1FXSA 2NQ8A 5KVSA 3CUKA 4XIYA 3AY3A 3WNVA 1I3MA 2VQ3A 2WEKA 3PGJA 1IOLA 4Y8VA 3CH6A 4BNTA 1AGNA 1V35A 4M54A 4TSKA 3SJUA 3UCXA 3ZNOA 3ABIA 1ISIA 3DMTA 4R3WA 3VVCA 1GYQA 1T2CA 2IRWA 1R66A 1ONOA 4NU6A 2BI7A 2I65A 2OXIA 2EHDA 3KV3O 3DBRA 4ZN6A 3GGPA 3BXXA 2OBNA 5JS6A 4B4WA 2Y0CA 4IJKA 3PJFA 4E2XA 1I3KA 1N5DA 3AUAA 1ENPA 3ZV5A 3F4BA 3FCOA 4GPD1 2QYTA 1PSDA 3NX4A 1U28A 4BNJA 1AN9A 4P4NA 7ADHA 2OHXA 5FWNA 4E5MA 2GN6A 1VLLA 4ZGWA 2CDCA 3HNPA 5FYDA 3DL2A 3ADOA 1Z45A 4BNKA 2VT3A 1PJ2A 4JJIA 3WB9A 1YOVA 3H3FA 3BTSA 2UAGA 3GVXA 4GQAA 3C1OA 4Z9XA 1Y8QB 1HE4A 3E9NA 2NVUA 5DCYA 1G0OA 3V8BA 1G6KA 3KXDA 3CEAA 3V2HA 3IIEA 2BFAA 3VVBA 4MP3A 1Z6ZA 1W8DA 2PKRA 1BTOA 3IUSA 1L7DA 4IUYA 5HM8A 4MO2A 4GKVA 5AVOA 3MOGA 4HFRA 1DHTA 4DPKA 4BL5A 2W2LA 4NJOA 2B83A 4XJSA 4W99A 4II2A 3JD1A 1H2HA 5CG1A 4D0RA 4DLAA 2Z95A 3G49A 1AHHA 3WX0A 4HV4A 3AI1A 1LI4A 3PIIA 1Z82A 1S6YA 3DAGA 1IHXA 1PZGA 1GPJA 4AICA 1DLIA 1X0XA 3ZU3A 1EUZA 2GLXA 4CLOB 5TJ9A 3UHAA 3F3SA 4CQLB 3MZ0A 3E18A 1ADBA 2PD4A 4FW8A 3JQ6A 3RUDA 4E3ZA 5C37A 1E77A 3DHYA 4MVJA 1TB4A 4CUJA 4RQUA 4BO4A 2NWQA 2DPHA 3VH1A 1U3UA 3PHJA 4AJEA 4DQXA 2JKVA 1GFSA 1PU2A 3GG9A 3T7EA 3WR5A 3KYDB 5IFLA 5TJHA 4URFA 2GN8A 5L7WA 3DB2A 3OJOA 5A1TA 3EZLA 4R01A 4KZPA 3EYWA 4WCDA 2FRDA 4K28A 5L53A 4EW6A 3JQBC 2HMUA 1R0SA 4FJ1A 5K0ZA 5EL0A 4BMNA 1U2GA 4E6PA 2CDBA 5BSEA 3AU8A 4TZKA 4BKPA 4AJJA 5H82A 5IZ4A 2HK8A 3VKUA 5KJEA 2GO1A 1MV8A 3CZRA 3GHYA 1KERA 4WEOA 5DP1A 2B35A 1T1RA 1ZFNA 3WSVA 2V6BA 4LN1A 1WNTA 3OF2A 4OMUA 4P4LA 2VUUA 1SEPA 2AA3A 1N8KA 2VWHA 4U5QA 5HTOA 4FFRA 2Y67A 4RDHA 2EXXA 5DF1A 3JQDA 1BMDA 4IXTA 3D4PA 2A92A 4J1QA 2XPCA 4IDBA 3VDQA 1OMOA 3LC1O 4IS3A 1Y8QA 2GN9A 4CM4A 2C82A 1DC6A 3ICCA 4YJFB 4R54A 2W98A 2WWRA 4JJGA 2JJYA 2WD7A 3FRJA 4ZVVA 4RPLA 2HK9A 4RF3A 1IPFA 3BAZA 4WCFC 5T57A 4CMEA 2UUPA 3JQ8A 1IHYA 3PJGA 3PWSA 3JYQA 5JLAA 2A9FA 2J5QA 4QO7A 4ITUA 3ZV4A 3HG7A 3PYLA 3SC4A 3K2BA 5EQFA 4GWGA 4AJKA 5CDTA 4R4JA 2DBZA 5CDYA 3QVOA 4CQMB 5T6BA 2PGDA 3C1TA 4C4OA 2IZ0A 2PFGA 2CD9A 1K89A 3PRJA 4OSPA 5JY1A 2GF2A 3MWDB 2QZZA 4BO5A 3GVIA 1NVTA 1PZFA 1MLDA 4YJHA 3U4DA 4W7IA 4WLEA 3C7DB 3ZHYA 2Q1UA 2EW2A 2C7VA 2D5AA 2GNAA 3DAPA 3GC6A 5L4SA 1Y8RB 3GVCA 4YAEA 1XCBA 4CR6A 2ZATA 4ESOA 1CF2O 4AJ2A 1I3LA 5JDCC 3KYDA 1BRMA 2Q3EA 3Q9UA 1WXDA 4PLZA 5AXBA 1X7GA 4AJIA 4NH4A 3PYMA 3OQ6A 4BGEA 4YWJA 1EMDA 1OOEA 2FR8A 4YAJA 3PDUA 2FMUA 4EDFA 3CE6A 3CMCO 3HZZA 3KEQA 3QP9A 1DIAA 2VHWA 1J5PA 1UZMA 3W8EA 4KTTE 2IXAA 1ZIDA 4WCFB 1D8AA 3LK7A 1LDBA 2VRBA 2FPPA 1ULUA 1VL8A 2HDHA 1Z74A 3PWZA 2YV3A 4G65A 1YB1A 2E4AA 2Y99A 3QY9A 3DZIA 3M1AA 2QX7A 4UVDA 4CL3A 1DHRA 3RD5A 2WYUA 4XRRA 3RIHA 4BIIA 1BHSA 4OM8A 2AQHA 1E1NA 5B37A 5L40A 1NYTA 1M75A 2XF8A 6ADHA 3KTDA 5COBA 1YDWA 1SMKA 1NAHA 1YBAA 1SBYA 1VL0A 4KUHA 1YJ8A 2PH3A 3QWBA 4NBTA 2JCXA 3PFWO 4XIJA 2B4RO 3EVTA 3JQAA 4YTEA 3ZHBA 1E1MA 1QORA 5DOVA 3FF4A 4OXKA 1SC6A 2AEMA 2H6EA 4I1IA 2BGMA 3DXFA 5FFFA 5BNIA 2ZQZA 4KDEA 4OXYA 4F3YA 3GOHA 3ZH2A 1GTMA 1E3SA 3EMKA 5CPBA 3ZU4A 3LC2O 1YVEI 2YHIB 1I01A 2BRUA 2GZ3A 3WGQA 4J2HA 3GN2A 4M8SA 3JD3A 3GDGA 3S1LA 5C7LO 1NWHA 3NT2A 1HLPA 4CLRA 3K73O 1QV6A 3ZWMA 4TKLA 4Y9DA 1LBEA 4PVDA 3JQCA 2J5KA 1AUPA 3DAFA 2YW9A 4FFOA 5JSFA 4YQZA 5AYVA 4NBVA 1Y5MA 5EIOA 1ZK0A 5GZ1A 2GUGA 1M76A 1Y8RA 4CUKA 3AUTA 3RKRA 2AE2A 2PKQP 2Q45A 3PLNA 4Q9NA 4FR5A 2VHZA 1PTJA 4GMFA 2WE7A 4N7RA 7MDHA 4QECA 2HJSA 5BSGA 1NQTA 2E48A 1ZKMA 4WJZA 2FZEA 4N5NA 1A5ZA 3IOYA 4U6SA 3I9LA 4ND4A 3D0OA 3DTYA 4Z6KA 4J7CA 1JVBA 1Q0HA 1NQOA 3HE3A 4IDFA 2WMDA 4YR9A 5L4NA 4B7XA 3WYEA 1YL5A 4FD3A 4BNFA 5KVVA 3D7LA 3EHEA 3MWEB 1PGNA 2RHRA 1YS4A 4RPHA 5EINA 1U3TA 4XKJA 1IUKA 4YPOA 5JMWA 1PX0A 3ZWNA 3L4SO 3OA2A 3PHGA 5KVQA 5IG2A 1DC3A 1YXMA 3JQ7A 3PYXA 3A9WA 4Y98A 1ORRA 3FR7A 1PJBA 4J0FA 1DIBA 3H4VA 4WECA 3PZBA 3S8MA 3ZDFA 5BNFA 3L9XA 4KDFA 4A27A 2X9VA 4J2OA 2BFPA 4J7XA 3H9QA 1NR7A 3MJTA 2VWGA 2YV1A 3DHEA 1ZK3A 4UREA 1T24A 3FD8A 5KJFA 4GVXA 2HO5A 4RCVA 2QRLA 5TLSA 1B26A 2C7GA 1E0DA 3DZGA 4IINA 2O48X 1JKIA 1C1DB 1NFFA 4PLYA 3WJAA 4D3DA 1T26A 3HFGA 2D3TA 4N18A 3L4BA 4DQUA 5I9NA 4ALKA 2GZ1A 5ADHA 4BV9A 4D45A 4MVJE 1LDGA 4XGKA 1W6UA 1PL6A 2Y93A 3EAGA 1UXHA 4RF5A 1SEVA 3P19A 3K9QO 2O7QA 1TLTA 2X9GA 3AUSA 3V1UA 4DQVA 5ITVA 1M6HA 4J43A 4OL9A 5COQA 1MA0A 1R4MA 2I76A 1ADCA 3D5QA 3PQEA 4QXMA 4YB8A 1TA4A 2ZJ1A 1Z73A 2VYNA 4E5KA 2EWMA 1ZEMA 2ZK7A 2PGLA 1RPNA 2EP7A 2D2IA 3B6ZA 1MXHA 1BSVA 1N92A 3ASUA 3OQ1A 1F17A 1LSUA 5DULA 3F9IA 4FC7A 1WDMA 4YJGA 5TT1A 1LSOA 4DC1A 2Q1WA 3CMMA 3EUWA 4XD2A 1DFHA 3O26A 1RM0A 3PQDA 1E6WA 4BNHA 4BNUA 2DUWA 3RU9A 1KETA 3NEPX 1UJMA 1B7GO 5T5QA 3WDSA 3ZV3A 2HRZA 2VOEA 2PH5A 3TZCA 1MG0A 1C0PA 3Q3CA 1ZO8A 3TJRA 4KQXA 3E6AA 1R15A 3QRWA 1ZSVA 4WGGA 4P8RA 3RFTA 3EK2A 4JBIA 5FEUA 4A10A 3MJEA 3U4IA 4XYMA 2X0IA 1ENYA 4WEQA 3WGOA 2BFOA 3JQFA 4MVJG 3ZZNA 4NU5A 1GV1A 1WDKA 2J8ZA 4WLVA 3KBOA 3H5AA 5B1YA 4IXWA 3HDQA 2NUAA 1ZXBA 4IDEA 4CMIA 1I24A 3M2PA 4GWKA 2EW8A 4RVDA 4DBVO 4A73A 4Q3BA 1PGPA 1SO8A 3H9EO 3QWFA 1X14A 5F5LA 1T2FA 4AVYA 4CMHA 2VN8A 3JQEA 1L7EA 2OP0A 2RH8A 3JQ9A 4TZTA 3ZW9A 5CEJA 3VTZA 5CAEA 3SEFA 3PDJA 5A9RA 4HY3A 2OO5A 1XYGA 1C1DA 3A06A 2E6UX 1YONA 3RJ5A 1M2WA 4CV3A 4WPGA 1Q7BA 5CFZA 1LDYA 3OJLA 4E5YA 1LU9A 4WLNA 4ZJUA 1KS9A 4PZEA 1IPEA 3AI3A 4MVJI 4LGVA 1ONPA 4GGOA 1GADO 1DRWA 1DC5A 2FP4A 1HE2A 2VTEA 4PLHA 3P2OA 4PVCA 1ISJA 5IN4A 5A05A 1YQXA 5EQDA 1NASA 5JAZA 1J6UA 1F14A 1OI7A 3PVZA 2QG4A 4GKBA 3PQFA 4GI2A 3H9GA 1D3AA 1O9BA 2AE1A 3U3XA 3UW3A 3DC2A 3GAZA 3G79A 5ICMA 3A28A 3GVHA 4J4HA 5JAQA 4DMLA 1DFGA 3DDNA 1PJSA 4BS9A 2EKLA 2PWZA 2VYVA 1CERA 4UVHA 1QV7A 4PRLA 4RDIA 1WMBA 3SLKA 3BIOA 3DBLB 1JQBA 1PZHA 1E1KA 1DRUA 3COSA 3JD4A 5THQA 3BA1A 4NBWA 1KVTA 2RBEA 1E7RA 2A4KA 1BGVA 1NVGA 1ZZEA 2X86A 5T8KA 5A02A 2EGGA 3ICPA 4JROA 4IMPA 3ST7A 1EVZA 3DFUA 3TSCA 3KEOA 2DT5A 4CODB 4DC0A 1VE9A 4UVIA 5LCXA 4ZQHA 2X8LA 2J3JA 2PV7A 3ULKA 1I2BA 2J3IA 3M6IA 2GGSA 3NYWA 3R3JA 4LVCA 3ANMA 5G4KA 1CQJA 3R3SA 4L8VA 4FPXA 3PJDA 2X5OA 2NTVA 2W2KA 1TT5B 3EDMA 4K6CA 4KP7A 3R0IA 3I1JA 4P38A 3RASA 2C07A 4FIZA 3GLQA 1WP4A 1T4BA 4CMGA 2W90A 1QSGA 5HS6A 4TROA 3K5PA 5KKAA 2FWMX 1YWGO 4B4UA 4HWKA 4DIFA 2EP5A 3GEDA 5FI3A 2EIHA 2V7PA 4BMSA 3I9KA 1ONNA 4L0QA 3U4HA 1J4AA 1I32A 3GZ4A 1LC0A 3VPFA 2OZPA 1E6EA 1G0NA 1UP4A 1O95A 1HE3A 3VPXA 1YE3A 4B3HA 3BMCA 3E5MA 1OC2A 3SBOA 3AY6A 1H6BA 2I3AA 3QIVA 3F1KA 1BXGA 4M86A 3I6IA 2Y66A 3B1FA 2DM6A 5G0UA 4DBZA 1IY8A 1F8GA 2W2LD 4YDRA 5JW6A 4XX0A 1LSJA 3E03A 2R6JA 4AJNA 1I10A 1XQ1A 4NK5A 4CV2A 1MGOA 1HDYA 5ES3A 4RVSA 1C0IA 3DFZA 3QVXA 4IY1A 5T67A 3DEYX 3I4FA 1VJ0A 2I9PA 2GR9A 3VPSA 3U4CA 4BNWA 3WGIA 1GZ4A 4PLWA 1P0FA 1N9GB 2NNLD 3ZWOA 4ZQFA 4JIGA 3E9MA 1H5QA 3MJSA 3TL2A 3ZN2A 4MVJD 3E1KA 1B0AA 1U5CA 3HWRA 3PIDA 3ADPA 4RF2A 2HCTA 1LLUA 3PEFA 2JCYA 2B4TO 5ILGA 3GY0A 1ZSNA 4HP8A 1PR9A 1P1KA 4FB5A 2ET6A 3H3JA 3RBVA 1WWKA 2LDXA 5FF9A 2V65A 3NTOA 4MP6A 4YT8A 4IIVA 5GY7A 1KEUA 1NQ5A 3D3WA 1P33A 3S2EA 2O3TA 4D7AA 3NT4A 1BW9A 4XGNA 2LDBA 1C3VA 2WE8A 2WYVA 3H2SA 1PWZA 1UXGA 5EMHA 1LX6A 1HDZA 1XR3A 3DZBA 1PJCA 3B70A 3E82A 3AOGA 4OXNA 5K6AA 1TT5A 1HT0A 4PG4A 1PJTA 1GZ3A 2D59A 3LZ6A 1HDGO 2CMDA 2O7SA 1E1LA 1K2WA 1PJLA 3WLEA 2OGUA 4O6VA 4MIYA 1P9LA 5KNLA 1PQPA 1XKQA 4M1QA 3GUCA 1SAYA 1IYZA 3QV1A 5TQVA 2B4QA 3QLJA 4RQTA 3IP1A 4UUOA 3PHHA 4QUKA 1JWAB 3CXRA 1PR3A 5DDIP 4CM8B 3GZNA 5H83A 3WGYA 4Z9YA 2OORA 3GQVA 4CJXA 3WS7A 3G1UA 4J6FA 3RQSA 2NV6A 1UDAA 1U1IA 5CG2A 2OP1A 3LLVA 3MTGA 1WZIA 2E37A 4N5MA 3HJAA 1LXCA 2IODA 2VZ8A 4NHEA 5JC1A 4B4OA 4UEJA 4WLUA 2CFCA 3Q0EA 4BKOA 2X0JA 3TZ6A 4XB2A 1O8CA 4J0EA 4BB5A 5TS3A 4M87A 4JX8A 3RU7A 1EUDA 3P2YA 4CLEA 3L6EA 1QLJA 2WSBA 3RC7A 5BQFA 3O8QB 1P0CA 4Q3EA 4BNXA 3GFBA 1J0XO 3ZWXA 4WLFA 4IZHA 1JN0A 2CNBA 4PLTA 1HDRA 4LSWA 4TVBA 4GX1A 3W4IA 1EE9A 3I3OA 4FOSA 3U0BA 5G0VA 2WDZA 5JXWA 4IQ0A 2ZB3A 2H63A 5L3ZA 4J4BA 1B3BA 3C3XA 4OHUA 4II3A 3NUGA 4C7KA 4E21A 9LDBA 3NT5A 5JAIA 2X0RA 3IP3A 1PS9A 1E3LA 3NGLA 1BDBA 1GUFA 2PZKA 3ENKA 4AJPA 4IDDA 1ZNQO 1ZJYA 5T64A 4RV9A 1EBUA 2EG9A 3AY7A 1GQQA 4FJ2A 1P1JA 2J5RA 1KC1A 4BKQA 3RBZA 4DIBA 2X23A 4JP3A 2EERA 2R00C 3LT1A 4I08A 3RWBA 5EESA 5JNLA 1E7YA 3GVPA 3WTCA 2VCYA 3S55A 5L51A 2Y1GA 3U9LA 4EJMA 3GT0A 3GUYA 5EN4A 5TIIA 4NFSA 4CM3A 4EEXA 1B8PA 2PA3A 5F1KA 4ALNA 4E4YA 4BMVA 5ICSA 1JAXA 1SB9A 1P77A 2C20A 3NDJA 4R3NA 4XRGA 4E13A 2HQ1A 1I5RA 1ZSYA 2D5CA 3DZHA 4TMFA 3L0DA 1KYQA 3LU1A 1GDHA 2NLOA 2CVQA 1DJQA 3IKVA 4BOYA 4CM8A 4J7UA 1GR0A 3Q6IA 3PPIA 2G76A 3B1JA 3STHA
chains in the Genus database with same CATH superfamily
1RWXA 1R3UA 3OH8A 5SICE 3AUJB 2WAXA 3IFSA 2ECFA 2IPAB 3NHUA 3NORA 3U37A 4WLOA 2WQ7A 1Y3BE 2HQBA 2VPPA 2PBLA 4GMDA 2I3DA 4OLFA 4UAVA 3GRKA 1UFVA 2RGNC 4JLNA 2OECA 5IKPA 1DG1G 1CG6A 3PL5A 1MXFA 1NJ6A 1RNLA 2PG3A 3GPLA 2I1LA 1XWIA 2X9NA 4XR9A 4AG3A 2IH2A 3HUDA 5CJJA 5JHGB 4BBPA 1YS9A 4R2HA 2J0SA 1TE2A 2ZRCA 3AFNA 3DEHA 4HDSA 1TM2A 2YWJA 3AIMA 3VYRB 2B8JA 5IP5A 1R0BA 3T7KA 2H5JA 3CLRD 1YBFA 1RTKA 3CZPA 3PT5A 1RAHA 4BEVA 2PTGA 4IKPA 3MAAC 3R7DA 2X8BA 5A5FA 4BO8A 1BWSA 2QM7A 3HB0A 2HYDA 4FFSA 1PJ4A 4XWAA 4ABTA 1VL6A 4K9PA 2IV3A 4D9MA 3N0WA 3ZD9A 1YR3A 5CIYA 3PNPA 5DGCA 4RL6A 5KIAA 1E5TA 3X1YA 1Y3CE 2OBXA 4RIEA 1X3LA 3K72B 4LVUA 5BN4A 1KYVA 1OYOA 1AQJA 1FTYA 3EBOA 2CUNA 1KGSA 2QTNA 5IKEA 1SUFA 2JAWA 4IDGA 5KVAA 4FXOA 4IZIA 4ZOAA 2GSDA 2VNKA 3TN7A 3BE8A 3C5HA 3IKJA 2Y27A 1C8LA 2R8PA 3OO0A 1WDLA 5DM2A 4YMWA 2ZJ5A 4RUKA 1GNSA 2IIPA 2QEQA 2HFJA 1PX2A 3KS9A 1JMYA 3VZSA 1TM1E 3KYCB 4YA6A 3M6MD 3ZD7A 2JHGA 2V9PA 3ND7A 4RIGA 4BYGA 1M5TA 5EJIA 5MN6A 2H2AA 4YYEA 3BJIC 2Q1SA 1GYRA 5JIBA 1YR6A 2ID8A 3DM9B 4H16A 4IFTA 1H65A 1TQ2A 3K9LA 3ODPA 4BRWA 1O6ZA 3BRWA 3HPQA 4LBVA 2UDPA 5JJ5A 2TMKA 1JF8A 3F6EX 4NBUA 1AKRA 3TDMA 1MN6A 3TLEA 3U0VA 3TQCA 4FKMA 2QZ4A 1E1QD 1NVWQ 3GEPA 2O23A 2OLEA 2Q2WA 4TZ6A 3IUJA 1HL7A 4W5RA 1U5AA 2VHJA 4RTMA 4DZZA 4CLDA 1KDRA 4HLDA 1I1NA 4JQSA 1Y7LA 1ORIA 1DDGA 2G0TA 1TKCA 1DIGA 3E61A 4GZ3A 4PSAA 4KQIA 4R1SA 1VCOA 3T1OA 3OPQA 3RTEA 4BY9E 1CJMA 2PZBA 2FHSA 1N6OA 1Z5OA 3ET4A 4JUAA 3WFJA 5BVHB 3BXOA 4Y7DA 5TF0A 3RUAA 2F8TA 1ZCJA 2A8YA 1SXGA 2A1UA 2FFAA 2W2NA 3LK6A 3IDQA 4JLAA 4N01A 1W2HA 2C4HA 2WW8A 3FKSA 4K9LA 2P8JA 2EJBA 1RJWA 4WSOA 1CZRA 2JRLA 5DCUA 1E7WA 2E85A 1PDVA 1M8FA 1X7WA 2UYGA 1S3GA 3OURA 1GGKA 3IUNA 1S2DA 4Q39A 4EH1A 3S2GA 5TQ2A 2FVYA 3FDIA 2N3ZA 3Q5DA 1IN4A 2W2MA 3OZRA 2QQEA 3PC2A 2BR4A 5DX8A 5TT0A 2A3NA 3DVAB 1G20E 2J32A 10MHA 1AVTA 4TV8B 3FPCA 4P4GA 5FFNA 4G3XA 3U9TA 3RYFB 4P84A 2MSWA 1AG9A 2WJYA 4FGJA 5LWHA 4D6XA 1H23A 4A5SA 3AKEA 4FBGA 1C1XA 3OFSA 1YI1A 4N5LA 2PBRA 1UBMS 1UK8A 3ESAA 5JO9A 5HEKA 1Y9EA 3V3TA 2PCLA 2W8BA 4L0DA 4NYMR 4EF4A 5FWDA 1F8YA 2GMWA 4OLJA 1HZJA 2MIIA 3Q87B 4I5DA 4R1PA 3AM5A 2GFQA 4K81B 1GFWA 1WB4A 3QUAA 4BQQA 4K87A 3WKDA 2FZVA 4HS9A 1NTRA 4R1QA 1Q1AA 1KJJA 1EDOA 2PSSA 4JP2A 2G4CA 1UKBA 3WVNA 3L77A 5MGBA 5C5CA 1M1UA 2WUFA 3C6BA 3I64A 1EM6A 3QKRB 3T6KA 2WHRA 4X91A 3FPAA 1IZ9A 2QYHA 2W48A 1X38A 3OETA 2H2FA 2RAFA 4MS1B 4XQ9A 3QYAA 2EQAA 1YA4A 2WTNA 4M0DA 3VI4B 3J7AC 2QWXA 3MGAA 4V38A 4YT5A 4A2PA 5I9IA 2VTVA 4Q48A 3LECA 5HUQA 4G0XA 5ITWA 5JASA 3RUHA 1A8SA 3KEFA 2FWIA 1RYNA 1SXJA 2EFYA 3E0XA 5AI5A 3KB6A 4CMAA 4DABA 2GKSA 1LNQA 2OV2A 4M9SA 4R05A 2QZPA 5EFOA 3CLSD 4KPYA 4QTXA 3IHWA 2Q49A 1ML3A 3VZCA 3SYTA 4ZRMA 3GJTA 4UPEA 3L6BA 2EKBA 1P74A 1HE8B 1UKAA 1Y3AA 1MVLA 4QJBA 1O8BA 5KQLA 2B8TA 4PXYA 3K6SB 1VIYA 2CZQA 2H00A 3VJMA 1M5UA 1FNCA 5AESA 5G40A 1HG0A 1GAXA 2GWRA 4D8YA 1SVLA 4TVKA 1PEDA 1SHJA 2AUMA 4FFDA 1UPTA 2BPOA 4UTOA 2BWJA 2JH9A 5JXJA 1K7CA 1JR3A 1HX7A 1LBSA 1RLUA 1EQUA 1II0A 3R9KA 4D9BA 3WA7A 2GERA 4ND5A 3R3WA 1L5YA 2G06A 1R9NA 3BXHA 5E4JA 4TRNA 4BNZA 1DAPA 2H8KA 2ZWMA 4EUFA 2ADMA 1C9YA 3GCXA 4GSLA 1AC5A 4PFJA 2QIPA 5HSGA 4MIEA 2DQ4A 4JL8A 3I9MA 3UJ8A 3BDVA 3K0BA 4MW0A 2K87A 1VYTA 1GXSB 4HS4A 5KI6A 1KR5A 4QBFA 5JFTA 5F73A 2CLFB 3GP5A 3ZD6A 1WZCA 2QPTA 2PBFA 4FVTA 2FFHA 1JA0A 3DB1A 1QLHA 1RYBA 3M4JA 3VVLA 4Q21A 4W4TA 1P2GA 4BB0A 2J9RA 5FO0A 1N2CA 2G40A 3FYDA 3RS4A 1B00A 2IFTA 1SKYE 2BR5A 2IHTA 3FY4A 1XDZA 2XQFA 3AF4A 1RHUA 5JNRA 1JE1A 3A6LA 3BMNB 2JD2A 1QYVA 2FFJA 3FRHA 5JDCA 2JD1A 3NJ4A 1H4SA 3WDLA 4MWZA 3BDAA 1RM5A 1CUHA 3TPCA 3WQHA 4BGVA 4C2UA 2IEGA 4U0JA 2FOXA 4ISCA 5DRTA 5TB5A 4KGDA 2PJRA 1N78A 5AKIA 2J4FA 1EQAA 3E9DA 4FEGA 1BFUA 4DR6B 2C95A 4P33A 4UTPA 3KPJA 6YASA 1DXHA 4H4EA 5H81A 4LZZA 4CKWA 1V7QA 1E0AA 4B3CA 4GBJA 5KVCA 3BB3A 2DHCA 1IUPA 4ENUA 2RHDA 1ZA2A 2Q2OA 1NN3A 4MV1A 2XZLA 2W6ID 3QBTA 5FIUA 1MABA 3KZKA 4QYTA 3ZTYA 2DXIA 5FTWA 3GLVA 3UV7A 5CUQA 1NZJA 1EAMA 4NQZA 3T61A 3T7AA 4ZMRA 3ROPA 4TKUB 4ZYVA 1E3WB 4EF6A 2P6RA 4PWYA 5HIIA 2A1IA 2FQYA 1UK6A 1XCMA 2VYVD 4OH1A 5GOZA 1U63A 5KSOA 3SM9A 1II8B 1V3UA 2IY7A 1J0AA 1PUXA 5CVJA 2XQJA 4L5AA 1ZJZA 2X2EA 3B53X 1JWBB 1SELA 5EPUA 1A5AB 4C7JA 3Q2KA 4W9NC 1XGKA 2AUTA 3UMRA 1CQWA 3KAKA 1OLUA 3W1EA 3V4LA 3NNNA 2BR3A 2ZWPA 4ARZA 4K03A 2QQ5A 4GG1A 5HFAA 2LKDA 2G9RA 4GLOA 4M89A 4NZ9A 4D41A 1UWVA 3RFXA 2SCUA 4LMRA 5HPYB 5JBQA 5K09A 2BP7A 3IOEA 1ZEJA 5E0OA 5BN1A 1J00A 5AJWA 2WOOA 4F5EA 4FHCA 2OLJA 3BM5A 1EFKA 1GAEO 1ZC3A 2ORIA 3QF4B 2JCVA 5LOVB 3IBTA 4O63O 5DBEX 1KORA 1EWTA 1RQXA 1KMHA 2EC5A 2R751 1T0IA 2VHXA 3QXXA 4KIJA 4KKXB 5DRYA 4C4AA 4D57A 4EFMA 3HHPA 4C01A 2HIHA 2PL9A 3A9SA 2HC9A 2O19A 1A72A 1YHNA 3ILXA 4K6HA 3GUHA 2WR8A 3BH6A 3HB5X 4IQ8A 4S1TA 1I0IA 2CF5A 4JBYA 3KSRA 3ESCA 2JJMA 4PR0A 5E38A 3SX0A 5JANA 4QOIA 4WBXC 2V6MA 4L08A 1RYFA 5IJZA 4DUPA 2ZBEA 3ILYA 4HXEB 5TF4A 4EUHA 2GHTA 1V4NA 2JVJA 4GSYA 4MXDA 4AX8A 1UF9A 1X1EA 3D4OA 3GNTA 3OBIA 1NGSA 4BB6A 3WNCA 4X41A 4WT7A 1UJ5A 4EB6A 4M9UA 1OFGA 2FG5A 5EE5B 2EVWX 4TLBA 3CF6R 3H6HA 3UF0A 3WJ7A 3QWHA 1PKEA 4RQAA 1JLSA 2FX3A 2JBWA 3Q2IA 3PDWA 2VDUE 4IPTA 2HA4A 2FN7A 4BP1A 3EYAA 5D84A 1AQ6A 4W8OA 1AXEA 4NPCA 4BDSA 3OJCA 5JZMA 3PUZA 3WGVA 1Z0AA 2PMDA 1HOXA 4J3FA 3RSQA 1L4FA 4AXXA 2IHNA 4OUDB 3TLXA 4KGZA 2WMNB 1BD4A 4JI8B 3BK2A 2P3SA 2NTJA 4JB8A 4EPVA 3L9WA 4LOJA 2A4MA 5F2OA 4BZPA 4TLDA 3QNMA 3V8EA 4BUCA 4PG5A 5FNZA 3C39A 4AP6A 2ECQA 1XMIA 2OAP1 1NI5A 2JH3A 4NCXA 3M2TA 1GL3A 2VZLA 1EESA 3AEKB 3DP9A 2D06A 1CDZA 3P2KA 4K9QA 2PZMA 3KG2A 4JVSB 1E2BA 2R1TA 4ACBA 4MR7A 4OI2A 2OTCA 1DOHA 1ZH4A 3BRCA 5F12A 2HWYA 2R97A 3RVKA 4JSTA 1YE5A 1H4TA 2IYAA 1QWOA 4DBLE 5JS8A 2RC5A 4MINA 4MWEA 2B8NA 2A5JA 1I4DD 3KAJA 1BQ4A 2WD9A 3OE7D 1IM5A 2CYBA 1NONA 3EC7A 5ARBA 2Q0HA 1WV1A 1SUIA 3T9CA 1K3UB 5KYXB 3MB5A 1JEYA 2CHEA 2GZHA 3RVMA 2QU7A 3TKAA 2PRZA 3IEKA 5JDIA 3PFGA 1L1EA 4EG8A 4XDGA 5LM3A 3BFPA 1XZMA 5J47A 1FSZA 2YVKA 4I55B 2N46A 1ZA1A 5FL3A 3VU0A 4MOWA 2GRAA 1T91A 3ZJTA 3L8HA 3NDIA 5FOTA 5C5IA 1IJFA 3QYFA 2W22A 3JAWB 4DC9A 1T5HX 3DAOA 1JIKA 1MG5A 1OASA 1M0TA 3E1SA 4GC9A 4PIPA 1CUYA 2ECKA 1N5IA 3G2HA 4UCFA 2O2HA 4YT4A 4KX3A 3DBVO 3KE8A 4FSHA 1T8UA 1PIWA 4EIWA 5IDWA 3N39C 3EW7A 3NIBA 2REXB 4PSKA 3AP1A 1KJYA 2YQ4A 5JPIA 4JT2A 3WICA 4M1EA 3AVTA 2CD7A 3H2YA 2M6SA 3I37X 2IYPA 1L3BA 3NTVA 5EKDA 3ZNNA 1E7QA 3JARA 5AHKA 7MHTA 4C14A 4KSCA 3GNQA 4RK1A 4M9ZA 3T34A 1NOIA 2A30A 1E3QA 4RACA 1BKDR 4E5PA 1PQWA 2FUKA 2GJKA 3L6CA 1USIA 2X7HA 3HN7A 3NC1C 1CIVA 4FFLA 2F8MA 4NHOA 1FA9A 5TGZA 4ZVNA 3WQBA 2H16A 2PUVA 1Z33A 2CCJA 4QUHA 5K3DA 4U7PB 3IAM1 3WNDA 5JU6A 1NUPA 4L8YA 2QTVB 4J0JA 5HS4A 2GPYA 1CZNA 5CT9A 4EM6A 2Z5GA 3AM1A 4RTJA 4N5IX 3KQTA 1S2IA 1RYEA 2I7VA 4JQOA 1OAAA 1P62B 2Q5EA 3EOBI 3FPHA 3NPMA 3QVGB 4IV8A 3DZKA 3ANLA 4PHGA 5LMCA 1ECCA 3BMQA 4ZVMA 2ZZMA 1L7NA 2VJQA 4FGWA 4H31A 2IITA 4G0OA 4ZT7A 4PYJA 1S5PA 3ZHXA 1CUVA 1E64A 5EMMA 3T0GA 1U9IC 1XZFA 3UA3A 3ZY6A 3BZBA 3L82B 5EIFA 2XDAA 4QASA 1I7LA 2Z0MA 3AHCA 3NHKA 4FJ0A 3WWZA 2DU8A 5CYFA 1LPSA 3AI2A 1YDHA 1KQFA 3F6YA 5JQGA 2IYNA 4ZOLB 4DMCA 4Z4CA 1RMTA 4BLQA 5HOQA 5AKXA 1UC4B 2H1IA 1W5AA 2EHJA 2YN4A 2UZ3A 1PZXA 2H7XA 1TL7C 3K2EA 3L4KA 4N8DA 5JFOA 4R1NA 3OEWA 1ZNXA 1YFZA 5D51S 1F0KA 2ZIUB 3FNQA 5JAHA 2LZ0A 1P45A 3P9SA 5IXYA 4KOEC 3BL8A 3VU9B 3N0XA 2ODBA 4ALJA 1W4AA 5ISMA 1C41A 3PEYA 2GNOA 1YZNA 4TTPA 1DAKA 3GPIA 2DH6A 2NO0A 4I81A 4KLZA 1F38A 2P6UA 1N32B 4NX2A 5JJCA 3WBKA 3X1JA 3QLEA 3E9YA 2GVZC 1SQ0A 3HSYA 2K2QB 2R2GA 1SH7A 2ZIXB 4DCVA 5HWSA 3COWA 2AKAB 1O97C 4ZRNA 3FZGA 1BG6A 1HSOA 1WZUA 1ADYA 1QNFA 4WUVA 1PQUA 3CONA 4WXYB 5ALTA 2FWPA 5E6SA 3SG0A 4BKRA 4L3VA 4EF5A 3UANA 2BGKA 1E2IA 2ZYSA 1OF1A 3UUWA 4BQRA 4U2DA 2V0CA 3R77A 3M6LA 4HAXA 5EJ6A 1U65A 3PGLA 3SZUA 4LJ4A 4U2KA 3MG9A 3VTAA 3C16C 1ARZA 2IDKA 3EW9A 4RZUA 2EX4A 2E82A 3IJRA 3P8ZA 4Q1DA 2FLVA 1D7OA 1US8A 3AXSA 4AMUA 4P9NA 5EPEA 3SLGA 2G17A 4DLSA 1HYGA 4E1AA 1Z0DA 3BILA 2POQX 1KYIA 1E69A 1SKBA 1J07A 4XWOA 2H5LA 2DAPA 4RO0A 4HH1A 1RLJA 5F2NA 1ONBA 2ZR8A 1LRJA 1YVPA 1FMLA 2Y2UA 1YR9A 1E2DA 3GX1A 3ND8A 3GZJA 3OIFA 4PTYA 3QPWA 4QD3A 1VG1A 1VMAA 4GP6A 4XA8A 3ESDA 4D3SA 5K0CA 2AG8A 3CCFA 3EF3A 5KHOC 1QIDA 1BDHA 5TEWA 3WK9A 3H2ZA 2PV0A 3F7TA 1NM5A 2H29A 2P75A 3RROA 5GZ3A 1YVRA 4B6SA 1PS0A 3V7WA 2BCJQ 5IJWA 3FAZA 3O4GA 1KU0A 1OGJA 4WK2B 4DZTA 3RYCB 1H93A 1CUEA 2BKAA 2QI9C 3D6FA 3L7BA 2LXNA 2WPNA 2LNDA 3DE2X 4S1NA 4UUMA 4WBNA 2F8SA 4J16A 1BOFA 4LKOA 2BFDB 2C2BA 4OO3A 4Y1GA 3SDSA 1TMOA 4YMHA 3ZPXA 1CNEA 2C9ZA 2E18A 3EVNA 4IBOA 4Q82A 3S44A 4I50B 4EEZA 5A0VA 2UVQA 3DMGA 3L1KA 3VZPA 1DKRA 2HH9A 1JNYA 3ETJA 3PCTA 1JFTA 1QGED 4O4JF 5DHUA 5BQ3A 4P58A 4Q3NA 1P1FA 1BNCA 4CFYA 1UH5A 3HKEB 3JASA 3UC9A 2HA5A 2V3CC 1KVRA 2JKYA 4G1EB 1MQAA 3V1YA 1QTQA 2V97A 2WD7B 3STUA 5E9AA 3T3NA 3I39X 4GL2A 1VSTA 1BE6A 4LRWA 2JJ8A 1MUUA 4OOEA 5DTMA 1L7AA 5DCLA 4CEJB 1CETA 4P7KA 4XPIB 2QUHA 5ESRA 2QRKA 2QW8A 2XT6A 4OHKA 2V54A 3ZE9A 5CDFA 5HILA 1PL7A 4EJSA 3OQBA 5M29A 4U1RA 4HQKA 4Q7MB 4XLLA 4ND3A 4XJTA 3O8RA 4P0PB 1EK6A 1V39A 1OPXA 1EA7A 2HNKA 2P2SA 4K8OA 4MUAA 1L4MA 3EWSA 5AQ1A 5KTRA 1BXRA 1GY8A 1I4LD 3AX6A 3KVRA 3DDHA 3LT4A 3HYCA 3NETA 4R0MA 3F3MA 3GA5A 2IGTA 4U5XA 3AEQA 2B3TA 5DU2A 5LUAA 2QIOA 3GGOA 5DI9A 1KSHA 3CE9A 4UBJA 3G5AA 3EPKA 2JA1A 3LKVA 1U98A 3DMNA 4YCJA 4EGCB 4JYPA 5JWHA 4TRJA 3U7QA 3UYLA 4YJHB 3S7ZA 1OWOA 5HCIA 3WWDA 3BRWD 2I5PO 1TLFA 4QOGA 1V5GA 3V2UA 4OHZA 3SU8A 1ZD5A 1EVEA 1KARA 2VNHA 4IQFA 5F3DA 3SDBA 5BPHA 1NSTA 5FBVB 2XT0A 3RG2A 2QAJA 3ZCRA 5KJ6A 1N57A 4LXYA 2QLNA 3VYVA 3KLMX 3D2AA 4JCOA 5F21A 2BHSA 2XBUA 4R2LA 4MUEA 4HOYA 1CJUC 4ESEA 4XUGB 2CNDA 4C0QC 4DQLA 2IXGA 4ND1A 1VM6A 3A31A 1YK0A 4FM9A 3SYRA 4ID9A 3WHKA 1T1SA 3SHFA 4LF6B 2N1BA 4QZVA 3FKSD 3F5DA 1ZS9A 3LCCA 4UTXA 4BO6A 4Z4IA 2O8NA 1KTIA 4AIRA 2RGXA 2VPXA 2XXBA 3E3MA 2OD2A 4HNAA 4UTZA 4EFDA 3RVBA 1JE0A 2I80A 3AZOA 4BKUA 5F7JA 2NZUG 3QOWA 3OZ7A 4HX5A 3F73A 1Z7BA 1V8PA 4RIFA 4Y6OA 1JDUA 3WG9A 1YNOA 3ZVNA 3SDZA 2J6IA 2WM2A 2ON6A 3ZI7A 3BWYA 3OU2A 2IF0A 4B31A 2OHVA 1WMSA 1PG5A 1V0JA 5EPOA 2O14A 2AZDA 4JVMA 2YKGA 4ZALA 4L02A 4L74A 1AO0A 1XTTA 4UOZA 4TYWA 3QI2A 1K68A 1CE8A 4DMMA 3P5SA 2CJFA 2ZTLA 1M2GA 3BE6A 1YH3A 3C24A 4H6WA 5CT6A 5C53B 2H7VA 4ZCLA 3N2YA 2A7XA 5G0WA 4NFHA 1GUZA 1G21E 1GQ2A 2ZB4A 5DK6A 1MC5A 1IBMB 1YFKA 2R5NA 3KQPA 4FN4A 2PUAA 1FFYA 3EDOA 2C3YA 2QF7A 3OVMA 4GVLA 5EKSA 1ZK1A 3A0RB 2ZVDA 3BWDD 3N8NA 4FW9A 4RJIA 2GWHA 3UXYA 4ONEA 1GRQA 2GEKA 3AFMA 3V4SA 4OY3A 1UJCA 2Q4OA 3KZVA 1CYDA 1W88B 4IILA 1DL5A 4GRAA 3VR2A 4A8HA 4AJHA 4HWRA 4QT4A 1AXRA 3ZWAA 5DGIA 1S01A 4XGIA 1UQTA 3WL7A 3ETEA 4AJLA 4A0GA 2K4MA 2HADA 2JAOA 3IDOA 5K8LA 2EAUA 3N0TA 1K2VN 3B8EA 5D3QA 3RF7A 3U19A 3ABQB 1JJAA 5BOVA 3V8MA 5IASA 3ER9A 1J09A 3BSYA 2WWFA 4GE0A 4WK6A 1EPUA 5H7XA 1NW9B 1J7JA 3R9IA 1JIUA 1SXJD 3KPWA 3ZQ4A 4CLRB 1OAKA 3U61B 5EE0A 1LRKA 1XPJA 1H0KA 2XWQA 4WD3A 5AI4A 4AZ0B 2VDKB 1N1EA 2ICAA 2J3DA 1EK1A 1M7BA 2Z3VA 2YHUA 1KQOA 1PYDA 4TL6A 1DBVO 3UYKA 3IEVA 2IY8A 1EWVA 1XTPA 2IUFA 1E1CB 2BI4A 2H51A 3QHAA 2ATEA 5HVNA 5AJUA 4YECA 5T4HA 2GHIA 3OUUA 4JZYA 3FWZA 1ZOPA 4B4KA 2VJBA 4B0PA 4Z5XA 4LXQA 1VKNA 5AUOB 5AJZA 3KHSA 4KQJA 4HQNA 2R68A 5IAJA 5CVVA 2WVGA 1G41A 2YQ5A 3H5WA 4BE7B 4LGCA 2JBAB 3A4MA 1JR3D 4OHWA 4XYGA 5L9AA 4QTZA 4EUEA 2PEZA 1I2MA 3Q1LA 4DWJA 4D9FA 4V03A 4YI3A 2E89A 4L5JA 1WUHS 3EGDA 2R1UA 2D5BA 1SQ6A 2ZETA 1MCZA 1P1HA 1S1MA 1W0KA 4AQYB 1UP6A 5DGHA 4WACA 1GPAA 5K6RA 1M1YB 1RAEA 1ULZA 2BI8A 3LBAA 3ML1A 1YB7A 5JJBA 1U9CA 3OD1A 3ZE2B 4GI7A 4AQ7A 2H1RA 2B30A 6GPBA 4OBEA 2HU5A 4QHTA 3C3PA 4CI0B 4OJTA 1IN5A 4MHTA 1QG0A 1ZMOA 2XAAA 3GWGA 4GXTA 4MIKA 4P81A 2J9GA 2B69A 3R7SA 3S2SA 4OUKX 1JIIA 1A4XA 1NJGA 2BV3A 2NZJA 4YMUA 1OXUA 3OMLA 3KETA 3O9VA 3ANSA 1IQUA 4ZZ1A 1JQAA 2FEWB 4Q4AB 4RV5A 4RZHA 2NX2A 4UPVA 5CFLA 1AZWA 1WEKA 2AJCA 3BMOA 4C0BA 3WMWA 3OA0A 4W5WA 1G59A 1YJBA 1GU7A 2PFKA 4YIKA 1XNRB 2IE0A 4HDRA 4P5EA 3RNOA 2BMAA 1GAQA 2GAIA 3IMEA 4RESA 2GHRA 1EVIA 1G291 1VBNA 1FFSA 1E2HA 2R66A 4NTZA 3ND9A 1Z5VA 2HJGA 3JATA 3CZAA 3JW8A 3W9UA 3X1ZA 1XC7A 2PZEA 3IDSA 2OK8A 4UUPA 1QIMA 1R8XA 1WCV1 2FE4A 1XQYA 1TX4B 1P3Y1 1TM7E 2J6HA 4PFSA 3TLZA 4CKCB 1QIIA 1FQKA 3FVVA 3O5AA 3AQIA 1U8FO 2N75A 3OI7A 1TM4E 4L78A 2QL9A 4FHGA 5H70A 1EDZA 4QT0A 1NP3A 1P31A 2P4QA 3G8CA 4DT1B 3THSA 3ES9A 1XQWA 1A88A 3QMVA 4WE3A 5CEEA 2GK6A 3PJRA 2QTFA 3CC8A 4B4VA 4L4RA 4YY3B 2X7XA 2R8XA 2DJ5A 3PHLA 3IUMA 2OGTA 4JUFA 1OZHA 4BQSA 2XMCA 1K8RA 3HYTA 3O2JA 3U7FB 1PEAA 3C74A 5CCDA 1UXJA 2DBRA 4YRLA 2YFQA 3UV3A 5K01A 2YWEA 2BM1A 3EQ6A 4K0RA 4L0MA 1ZXLA 4Y1FA 4JBXA 5GQSA 3W7AA 1R9GA 1WULS 4A26A 1E9EA 1GNRA 3BF8A 4JHXA 5KQMA 1AIPA 1NJ8A 4ZVUA 2DLDA 4GT1A 2B9EA 1X7ZA 3FBGA 4RH3A 3X1WA 5ITZB 2DHQA 1ENZA 5C80A 4MNTA 1Y4DE 4C3ZA 4LHSA 3ZV7A 4E15A 4V02A 2AJBA 3BSWA 4ZDJA 5B6JA 1CR2A 2R7KA 2VHYA 3ZGNA 4UZSA 4E22A 1SKMA 4DQDA 2BF4A 4PRKA 4QSMA 2B7BA 6AT1A 4RSRA 5GONF 4JMPA 2H48A 3FM9A 4IQGA 1VHJA 1VDZA 1W0CA 2V6GA 4TPKA 3FSGA 2P9JA 4WOKA 4WQMA 2EFGA 2NT4A 1J2RA 1GIAA 1T3LA 3ZUGA 3H65A 1H3FA 1B2RA 2BFBB 5A9SA 2Q3HA 2WUWE 2XWPA 5LIPA 4OJYA 1OYVA 4U7WA 3VYSB 1T6ZA 4IL5A 1RACA 1DLJA 1EB8A 3L8FA 2V6FA 2B94A 6Q21A 3T0FA 1EFPA 2GAJA 3K1YA 4TUYF 4V0NA 4YXWA 2I7XA 4WFIA 5DOZA 3FDZA 3W5UA 2BGWA 5AI0A 4OHMA 1ZCAA 2M6RA 3ICVA 2NUAB 1GEGA 1QZ3A 2JHFA 3A1VA 1FVFA 3PICA 4OI4A 1N5LA 5C32A 5CLHA 1HL3A 2WIAA 3KVOA 4HJXA 4IGEA 1KKMA 4UD2A 1B93A 2JFYA 2JJQA 2WYWA 3TZKA 3QM1A 3H05A 1RPZA 3GMDA 1A9ZA 1JG2A 4B73A 2BBSA 1PKXA 5LYJB 4EW3A 3F9CA 5JD6A 3WQSB 4Y2QA 1M2EA 2YWXA 4DA9A 4FLEA 4PS1A 3CNBA 4WA8A 3ZV6A 3S5JA 3HJNA 1R0WA 4B32A 4O0MA 2YCBA 1KEVA 1OV4A 2HDNB 1T3HA 5I7HA 4U3JB 1YR2A 3SAJA 4G5OA 3OX4A 3RRFA 5K3OA 5KX5F 1B3RA 2J09A 3NEYA 3X2FA 1D2GA 5B4VA 4TWZA 1VHTA 4QQKA 3FNIA 2Z3ZA 1RI4A 1N5JA 2WM8A 3ROMA 1X6VA 3EUAA 3TTTA 1JVNA 1V9LA 2PQ2A 4GYKA 1A27A 1AF7A 2I2XB 5ALGA 1ISMA 3RRNA 4C0HA 1FDVA 4PHCA 3UJ6A 1HTTA 5DTJA 3V5NA 4EA9A 1GKKA 3QE4A 5A4IS 1FXWA 1KVQA 4AB1A 1DRJA 1QR2A 4AZ3B 3AHEA 2QLMA 1M2VB 3H1GA 1UPUA 4DLPA 1JSRA 1SIWA 4LDZA 4MCJA 4PCUA 1NFQA 1R0YA 1Y9JA 3K1AA 4H18A 2FDCA 2I99A 4UBIA 4ISBA 2VG8A 5AR1A 1UJ2A 3WA6A 3D3EA 4X8LA 1KI1A 4EB0A 1IVYA 1IULA 3RWMB 1A7UA 1KI8A 4URUR 2EZ4A 4NH0A 2X7JA 3SF0A 3T5MA 3L8ZA 1G8AA 1SD5A 5DNAA 4KIUA 4HYEA 5FNVB 5IZCC 3MELA 2B36A 1UZLA 3FA2A 1RCUA 2FJUA 2OVFA 3T1NA 4CKEA 3MEQA 3FMFA 2HI0A 5CNIA 2WF5A 4K46A 3SXUA 3W5HA 1SOVA 4X3CA 4X95A 1QPBA 1V71A 4H1UA 3GK3A 4M8NE 1V11B 5E6RB 3N8HA 5FLXA 3FKJA 3OTQA 3ZY5A 8ABPA 2F43A 3P9NA 2X2FA 1U7WA 2BIFA 2ZWIA 4OHBA 4CMKA 1F7VA 4N7MA 3MPOA 5DX0A 3H9UA 2FK7A 4IAOA 2P9CA 2QLJA 5HFJA 3OHSX 5FHQA 2BDUA 3RFFA 3S2IA 1XRJA 5LQAA 3KZMA 4XUEA 4LBWA 3ENVA 3LYLA 3SEZA 3BD9A 3E3OA 4U8GA 1O1YA 2QUAA 2RI0A 4K8RB 4ZWNA 3TD2A 3VNAA 1XLWA 4FFMA 1L6IA 4XE5A 3AR2A 5FLKA 2P65A 4BECA 4O4IA 4A7PA 2ARKA 1YCHA 3QKUA 3S28A 3OFVA 2NO6A 5DGXA 2P35A 4IUBS 4DCTA 2VNSA 1HF3A 4X7RA 8GPBA 4E07A 3R7WB 5K0EA 3AL0C 2QAGA 3OPYA 4JYAB 1G8JA 3T9BA 5JY6A 1RVV1 2WKWA 3N6RA 4ZT4A 1DBWA 3PE4A 3H13A 4NS4A 3CA8A 2HIAA 1IMJA 1KOLA 1MTZA 2J3HA 1HT1E 2FFBA 5BMVB 4PN7A 2IIQA 2CVOA 1DAOA 1U9ZA 4YWHA 1NVBA 1EI9A 5DXJA 5CD9A 5JCPA 4YJ2F 4QPZA 4AF6A 4H7HA 1H3EA 3AESB 4GVPA 1QYWA 4W5JA 3O6VA 3UGKA 1N3YA 2GA9A 1WXGA 4BVKA 1Y6JA 1Q5PA 3M70A 3VTFA 4MQ5A 5TS2A 4DDMA 4QOJA 3SBXA 3WRYA 3I9JA 4OJKA 3DMTC 3FVRA 1A7AA 1R4NB 3KQQA 3BBPA 4YP6A 1WW8A 3SLRA 3CX4A 2O4CA 3CO5A 3N8DA 4MUXA 2D1QA 4K9OA 3R8XA 4AKHA 5BWBA 1NV8A 1M67A 3IAFA 4A16A 4B09A 1WZEA 1IC6A 2Y4OA 3BMCB 1EP2B 5KNCD 1B23P 1ICIA 1ZH8A 2R6GA 3OQJA 4LRTB 1WLSA 1V8BA 3R6DA 1TOAA 2H07A 4HGYA 5IKOA 5LXTF 1BXGB 1RRMA 3IDAA 5TQ0B 2NUTA 1TJYA 1P5FA 2FN9A 5HQTA 5LQMA 4Y2VA 1MPTA 1ADGA 3ZDRA 4RTKA 4ZVSA 2CMFA 3TX6A 4L8FA 4PGFA 4XX0B 5HDBB 4AN0A 3MCTA 2ODPA 1EVYA 3E5NA 4OSOA 1RYZA 5LQKA 1JEYB 2CJPA 4UNNA 2ZYVX 3GDOA 2FSVA 4LDPA 3CLKA 2PRYA 3IQGX 1UR5A 2RGEA 3WKBA 4FCVA 3FOWA 2FKNA 2EKDA 1RTTA 2GTHA 1G8FA 2O2GA 4R51A 3ADBA 3NMUF 2BGUA 1LBQA 1UMKA 2DWUA 3X0DA 1TW2A 5HKBA 4NATA 4ZCSA 3T52A 1G20B 4MQUA 5FPQA 1QUFA 5FUVA 2W6PA 1L5NA 1FJHA 3WLHA 1JX6A 1U99A 4KXUA 2ZULA 4PANA 5L7YA 3QUTA 4DPMA 5K2OA 4LIPD 3RCBA 5BT8A 3N3AC 4F4CA 4F2PA 4X85A 1I2CA 4OFZA 1MC8A 4Q4HB 4C4SA 3S8EA 5M2QA 1AQNA 1F6DA 3HCRA 4JNCA 1VXOA 1K8XB 1ULBA 1GT91 1ZLYA 2JLCA 4PQEA 1TAHA 4TWBA 4AG5A 1Y1KE 3KZOA 5FTKA 2AZTA 1XXLA 4BFXA 5JO0A 3EPJA 5DBFA 1A9XB 1OT3A 1FUIA 2WZCA 2AQIA 1RQ2A 5ALWA 3LY5A 5L6LB 4GP7A 4CF6A 4YO7A 1Z7WA 4IDPA 4NQRA 4GX5A 5DBHX 3A1UA 1QRRA 3N5CA 3C98A 5FI5A 3MPUA 3FNRA 3P0IA 5F64A 3IVMA 3Q7SA 3LCVB 2IYOA 1VJ5A 3ZWDA 1ISGA 1EA5A 2W4QA 4IRUB 2OCXA 3HDJA 1RKXA 1CUBA 1Y81A 2CLEB 2ODNA 4LHYA 4Y2RA 3GGGA 4TMTA 2QTTA 5GVRA 3ZNPA 4CR8A 2XAUA 1X1RA 3LVBA 1SVUA 3DZCA 2ZUBA 4OH7A 1E3EA 1VG0B 3O7MA 3RV4A 3AU9A 2FTKE 1OZGA 2XIQA 4W63A 1JJIA 3BC1A 3AVVA 5DSTA 4F60A 2HAEA 1L4NA 1NTOA 3BB1A 4RW0A 5JZVA 2E2WA 2CSUA 4KO3S 2IL1A 3EXEB 3IT0A 5JI3E 2W8ZA 2L69A 3NZEA 2XLBA 5AVVA 4X62B 4G1CA 4M9XA 3ANYB 4Y67A 1GNTA 3DL0A 1B1CA 4I1YA 2A5LA 2VT7A 4FQ8A 1AMNA 5GJWC 3VR6H 3JPYA 4K1LA 2FLWA 3JQPA 2CL6X 2VPQA 5ALRA 4ZCRA 5DM1A 1U94A 4W5OA 3KQLA 3O9ZA 3HSSA 4D92A 3S1AB 1DEAA 1U2GC 3IT3A 1TNDA 1R18A 2RJOA 2V7WA 2WTUA 4G97A 1PFQA 4KIWA 2C4VA 2VLBA 3KU1A 2JRCA 1KPHA 3JYNA 2V4MA 3CTMA 3HDGA 3WP1B 3ZY3A 4DXDA 1C9JA 2J4CA 5C7YA 5HRAA 4GGPA 2X5JO 1RKVA 4YAUA 3EIEA 5SV2A 1FVHA 5DM60 3MJ4A 3OJWA 4PC1A 1DQSA 4DSNA 4FUQA 5LB4A 4A8JB 3U5TA 3CX3A 5BQ5A 4LF9B 1L5GB 4F3CA 3COZA 1XPUA 3G7NA 3D1VA 1RHQA 3IBGA 4EAQA 1SM4A 2AVDA 5CU7A 1XVUA 2PAAA 4YH1A 5B4TA 1CRZA 1NG1A 4P31A 1EUDB 1JIVA 1PFYA 1USKA 1EINA 2G5CA 2ZIFA 3N76A 3ON5A 4PBRA 4WFJA 4JYZA 4CF5A 5HR5A 1ZD9A 3M9XA 3P9RA 3U4AA 1JGTA 3I6BA 1N0VC 3F6BX 1UZUA 1LPOA 1T8SA 2HCBA 1T3ZA 3O8OB 1T0HB 3G2MA 4C6TA 5BWMA 1WQ3A 2IP2A 2Z5LA 3FSRA 1XHLA 2AC7A 1R3DA 3HCNA 4PTLA 3GRAA 3UWSA 3K70D 4GAEA 1WG8A 2H1LA 1T5SA 5AKLA 2QL7A 3IR5A 2VA9A 4LJKA 4C0WA 4E5SA 4WZZA 3TZQA 1GTL1 3O82A 1Y3DE 2CWDA 3BN3A 2VH5R 2ZRQA 1ULHA 2AEEA 2WEKA 3PGJA 4QPNA 2PLFA 1IOLA 4WKOA 3T3MB 2VL7A 3OPMA 2YWRA 3PUWA 4X1OA 1WRBA 2ALJA 3EPPA 1TZJA 3PQCA 3A2MA 1M3SA 2JCGA 5IC4A 4MZDA 1J8QA 2ZM5A 4R3WA 3KYJB 1HDIA 2AK2A 1T0UA 1QHNA 3H8SA 4C21A 2WJ4A 5L3QA 1BX3A 4IJ6A 2IOFA 3GGPA 3BXXA 2OBNA 5EKTA 3T38A 3NOQA 5ADUS 5JZBA 1SQGA 2IBSA 4X5OA 4B4WA 2Y0CA 1REQA 1DAIA 4IJKA 5D1HA 4LY0A 3AUAA 3LKZA 4LXTA 3K9WA 4WN9A 4XQ0A 1X8JA 5FHRA 2N42A 4RNDB 2EOAA 3FCOA 4TL9A 2J3QA 4GPD1 1CUDA 3DL7A 4U8HA 1PSDA 1MTOA 1NMZA 1U0RA 2OHXA 4EG6A 3ONVA 3TYXA 2XHZA 4W1PA 1VG8A 2YOHA 4DSZA 3UPUA 3ZJ5A 5FYDA 2Q6OA 3VPDA 1C80A 1DINA 3DL2A 3DR5A 3D3NA 3FROA 1NY5A 3GMTA 3VPAA 8ATCA 1ZGAA 1D03A 1USUA 2JGKA 4JJIA 4UE2A 3WB9A 1Y9DA 2ZR0A 3DA8A 1R2QA 4V2UA 3QUCA 2G9VA 3C1OA 1O4VA 2BGTA 2W2VA 2VKTA 3E9NA 4XTCS 3L7LA 1PG2A 1XTKA 4TLCA 1R74A 3LCUA 3V8BA 4B87A 2HMYB 3BGVA 4F7DA 4B3DA 4TMXA 4R2MA 3CRVA 3UV6A 3CTPA 3IIEA 1OA1A 4DR4B 3G9TA 2PKRA 1AX9A 3GU3A 3OJXA 1M10A 3EC1A 3R6LA 4FDTA 3GEIA 4MO2A 2YWFA 1RHRA 4GKVA 1U7UA 4X3PA 5AVOA 5HIJA 4J0GA 4R71A 3VR2D 2REOA 2DHEA 1GKUB 2LGJA 3AKDA 4Q9IA 4P0TA 4K5QA 1JHPA 4XJSA 3TB4A 1H2HA 3HVUA 3RRXA 4D0RA 4OHOA 5CG1A 4MVYA 3G49A 2EL9A 1AHHA 2I87A 2BY4A 3RRZA 1DBQA 1IHXA 1SURA 2QMUA 4GICA 3BFVA 5TGTA 4D2IA 2UVPA 4IGIA 1DLIA 4GMKA 3SOPA 2RGBA 4YMGA 3ZU3A 3C6XA 4P34A 5C1BA 2BEVA 4LQCA 2MSLA