4UUNA

Trichomonas vaginalis lactate dehydrogenase in complex with nadh
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
335
structure length
335
Chain Sequence
SEAAHVLITGAAGQIGYILSHWIASGELYGDRQVYLHLLDIPPAMNRLTALTMELEDCAFPHLAGFVATTDPKAAFKDIDCAFLVASMPLKPGQVRADLISSNSVIFKNTGEYLSKWAKPSVKVLVIGNPDNTNCEIAMLHAKNLKPENFSSLSMLDQNRAYYEVASKLGVDVKDVHDIIVWGNHGESMVADLTQATFTKEGKTQKVVDVLDHDYVFDTFFKKIGHRAWDILEHRGFTSAASPTKAAIQHMKAWLFGTAPGEVLSMGIPVPEGNPYGIKPGVVFSFPCNVDKEGKIHVVEGFKVNDWLREKLDFTEKDLFHEKEIALNHLAQLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-LACTATE DEHYDROGENASE
publication title Gradual Neofunctionalization in the Convergent Evolution of Trichomonad Lactate and Malate Dehydrogenases.
pubmed doi rcsb
source organism Trichomonas vaginalis
total genus 115
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4uunA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4uunA02
1NHWA 5I7EA 3JQCA 3H7AA 3WFIA 3W6UA 1C0PA 1NP3A 3A28A 2VOJA 2VN8A 4OSPA 4CMKA 4Q3EA 1GZ6A 1XR3A 1D8AA 3WLEA 4NK4A 1O8CA 3GOHA 1GEGA 4NQZA 4R1SA 3ROMA 3UCFA 4WNIA 1IPFA 3JD2A 4XR4A 4E2YA 2EJVA 3FNGA 2OP1A 3MOIA 3N74A 1VSVA 1RKXA 3C1TA 3MEQA 3ZH2A 4K1LA 4EYEA 4YEDA 4JLWA 3WYEA 3LT4A 1NQTA 3JD0A 4GKBA 1MFPA 3FWNA 2XOXA 4J1NA 4M86A 1GV0A 2PD4A 2UUOA 4YACA 3CE6A 3I9KA 1HKUA 3M1LA 1Z82A 2GPTA 3PYMA 1N7GA 5I9MA 2NADA 4Y6RA 3INTA 2OUIA 5AXAA 1ORRA 3CTMA 1GQ2A 2J5KA 2IODA 2CDAA 3QW2A 3PYLA 1E7YA 3E1KA 3VAZA 2HDHA 3DFZA 3DFUA 4DPLA 2EKQA 2YUTA 1TT5A 5IDYA 4RVDA 1I0ZA 1YL6A 1N1GA 1K89A 4TMFA 1BDMA 1A7KA 3TQHA 3I3OA 3VDRA 1ML3A 2IYPA 3AUAA 1AUPA 3FR7A 4JBIA 4MINA 2XAAA 2GN8A 4NG5A 3IKVA 3EY4A 3KO8A 3GG2A 2EEZA 4RJTA 1WZIA 1HEUA 1P9LA 1EBFA 2FY8A 2Q50A 4WLFA 5EL0A 1Y5MA 4L8VA 4O5OA 5CDGA 1KOLA 3LC7O 4PG5A 4II2A 3QHAA 1XCBA 1E7QA 3A06A 4FCCA 4Q39A 3DZFA 3JQ8A 4CMEA 1GY8A 2OHXA 3EGOA 1EFLA 2E82A 1NPDA 3N58A 4R9SA 4CLEA 3WICA 4F6CA 5L51A 3JCZA 2DC1A 2QHXA 3DAFA 2BRUA 3PVZA 5CEEA 4NU6A 1YS4A 1JW9B 3HDHA 3FBGA 3FSRA 4Y67A 5DCUA 3ZGYA 2Y1CA 3QWAA 1ZXBA 1E5QA 1DHTA 4YAGA 1LLCA 2B36A 1HLPA 1GYRA 1ARZA 3HDJA 2BHLA 2WDZA 2VHYA 3QVSA 4M87A 2YYYA 1TT7A 1NR1A 3ABIA 4EITA 3A14A 4FD3A 1E3WB 1C0LA 1X7HA 2GSDA 3M2PA 5IXSA 3OIFA 2BFOA 2C29D 4NH4A 3MJVA 2EHDA 3JQAB 3KM0A 2VYND 4ZRMA 4LK3A 3DB2A 2XF8A 1UDBA 3OBBA 1PR9A 2TMGA 4ZQHA 4ZHSA 1PJ3A 1DAPA 4BO1A 1DO8A 4FR5A 3QY9A 2RIRA 1O6ZA 2O3UA 1F12A 4RVGA 3GDFA 3SC4A 1H9BA 4WOKA 1Y9EA 5L3ZA 5EERA 2VNAA 3M1AA 1DFHA 3LC1O 4KTTE 4KDEA 2JCXA 1DSSG 1PJCA 2DAPA 4CMIB 1WLYA 1XYGA 5JDCC 2EV9A 2X5OA 3MJSA 3D4PA 1AGNA 5A9RA 3MCVA 4PG4A 3I9LA 1YDWA 4A73A 3MJ4A 5KVSA 3ETDA 3PHGA 4PRKA 3OJFA 4ZQEA 5FI3A 5LC1A 4BO6A 2X22A 4GX5A 1DLJA 4RL6A 1V6AA 1Q1NA 2H1SA 3CKYA 4E2ZA 2BKAA 3T4EA 1M6HA 3OF2A 3UAGA 4ALNA 4QT0A 5EINA 1I3NA 4RLHA 4ZN6A 3PP8A 4FFOA 1RM4A 1DAOA 4IGEA 1N5DA 4GVLA 1YXMA 3PTZA 4EUFA 1NFFA 4YJFA 1LDGA 2VYVA 3NGLA 5IDWA 5DBFA 4D45A 1KETA 3EVTA 2GO1A 2CDBA 2VHZA 4CMBA 1VJTA 1QV7A 3I9JA 1F0YA 3U5TA 3FNEA 3E6AA 3PFFA 1GYQA 1X1TA 2G0TA 3RFVA 3T4XA 3TSCA 1H5QA 2FN7A 2X6TA 1Z7EA 5HWSA 1KEVA 2A4KA 4B3HA 3E5RA 2ZTLA 1T4DA 2G1UA 2HK8A 2NWQA 4L74A 4CM7A 3MJTA 1PGPA 3WQSB 1SAYA 4DLAA 5BQFA 4UVIA 5IN5A 1H94A 1C1XB 5TIIA 3T7EA 4LSMA 4YR9A 1KYQA 2NTJA 3ITKA 5FWNA 1U5AA 1LA2A 4J9UE 2P68A 4RCVA 4RF5A 3Q1LA 5KOIA 2FSVA 2I6TA 1LJ8A 4MP3A 1O5IA 3TL3A 5KJ1A 5HTOA 2QRLA 1GZ4A 5FYDA 1LSJA 3DOCA 3AY6A 1ZK3A 1P1HA 4IGFA 3OFSA 3L9XA 1ONNA 1HDYA 1EVYA 3DMTA 5L45A 3JQFC 1A72A 3U3XA 3WYCA 1C1DA 3G1TA 1XWFA 3VKUA 1GDHA 3VH1A 2JAPA 4LCEA 1Q0QA 2X9VA 4CM1A 3GVIA 4O0LA 3ZNQA 2W2LD 5JLAA 3GEGA 3GNQA 5TC4A 4FN4A 4BNVA 1YONA 3LYLA 1E6UA 1DLIA 4JJIA 4PLZA 5ICMA 1LSOA 1B26A 2CVOA 4UUOA 4MVJI 4JBGA 3TZHA 2GZ1A 3GUCA 5JW6A 4NHEA 4ND1A 2LDBA 3TOXA 4CM4A 3KTDA 4EGFA 4HX5A 5JCJD 3GN1A 1XG5A 4RVSA 5JY6A 4OM8A 1YOVB 4EDFA 5B37A 1SOWA 2DPGA 2VRCD 1XU7A 5B4VA 3E18A 2GF2A 1P0FA 1GL3A 4W9NA 1YO6A 4QFDA 4DQXA 1GR0A 2VRBA 4WECA 1YB5A 1PGQA 1ZMTA 2QG4A 3Q6IA 1GUFA 2AA3A 2DLDA 4P22A 2VWHA 1MC5A 3HADA 4PVDA 3CMMA 4DUPA 4RO0A 3G0OA 3PLNA 1KEUA 1FK8A 2I99A 1NPTO 3PGJA 1YH3A 5C7IO 2C54A 4E2XA 1ZFNA 2BD0A 2O3RA 4BNNA 5AXDA 1EE9A 5DDIP 4S1VA 4OJNA 2X0RA 3IS3A 2UVDA 3KZVA 2VUSA 4RPGA 2FWMX 3DBHA 5CG2A 1AN9A 4DLBA 5L40A 4GMFA 2G5CA 4CQLB 4PLYA 1ZNQO 3SLKA 4LN1A 1T2CA 1Y8RB 5ES3A 4YJHB 2EW8A 3BMQA 2HJRA 4YJGB 3H5RA 4R54A 1NXQA 3O8QB 3OA2A 3D7LA 1DJNA 1HYEA 1LDNA 3DBLA 4P8RA 2PZMA 1Z74A 1B2LA 5EPOA 3OQ1A 5A9SA 2FP4A 1LQUA 4YTEA 3ANMA 1T4BA 3ZWWA 2VQ3A 4DPKA 4RVHA 5TLSA 2YDXA 1B16A 5G0TA 4WCDA 5T8KA 3ZWYA 5C5IA 1I36A 3OMLA 4UVHA 5KTKA 3KETA 2DKNA 3DBRB 3CUKA 2ZYAA 3TOZA 3FF4A 3P2YA 2PGLA 5L7WA 3RD5A 3V2HA 1R4NA 3RBZA 1BDBA 5TX7A 2QRJA 3OQ6A 3BTSA 1EK5A 1JA9A 1WDLA 3IP1A 3OJLA 4M49A 3WIEA 3UF0A 4N5MA 1OC4A 3E8XA 3WGGA 3DZIA 5GZ3A 4RZIA 1IHXA 4P4LA 1L7DA 1I8TA 4FC7A 3VH2A 4DWVA 4J7UA 4IZHA 4Z3DA 1G6KA 1RJWA 3C1AA 2O3SA 2ZYDA 5DULA 3NUGA 3DHYA 1HDCA 2CMDA 2H9IA 2Y0DA 2Y0EA 2GCGA 2C20A 1MB4A 1RM0A 3HSKA 4BKPA 3IUPA 4GX1A 1ADFA 5T64A 3KYDA 4BQRA 3MZ0A 1EFKA 4QFCA 3C7DB 4NJOA 4ALKA 1VC2A 4IINA 2B83A 3K96A 4AJJA 5TT1A 1A4IA 3BTOA 3DDNA 2ZQZA 5IDXA 2JHGA 3WJ7A 4WLUA 2VOEA 3E5MA 2VTDA 3RC7A 1GQQA 2CF6A 1ZO8A 1BTOA 1EQUA 3B1FA 3BMCB 3K31A 1GFSA 2YHIB 1JLLA 2Y68A 4HBGA 2Q2WA 2OOSA 3O26A 2DTEA 2VHWA 1QSGA 4P4GA 3WGQA 3PZRA 3SBOA 3AU9A 4RORA 4QX6A 3AI1A 4EEZA 8ADHA 4CM9A 1XIVA 4NBUA 1H6CA 2ZTUA 3EUWA 3OH8A 4AJHA 1N9GB 4HNHA 2NVWA 1LXCA 3ROQA 2O4CA 5JSFA 3PHHA 4RF2A 4NZ9A 1WWKA 4OO3A 4WEQA 3F46A 2WSBA 4AJNA 3AWDA 1YQDA 3GN2A 2WMDA 3GPIA 1TXGA 3KLMX 1UAYA 3K92A 4NBTA 3R3SA 4JJFA 1DFGA 2V6BA 5IXYA 5F1PA 4MJLA 5ENVA 3D3EA 3I23A 4MVJG 3WFJA 3I9NA 5KCZA 2FSSA 3H6KA 4OOFA 1XGKA 4IS2A 1HXHA 3CPSA 5FFFA 1Y6JA 2QIOA 4JIGA 1HDRA 4H15A 3H9UA 1R0SA 4HADA 2DBVO 4PG6A 4BL5A 5CG1A 1U5CA 1A4UA 1K6XA 3WLFA 1GUZA 3ZHBA 4BNTA 5B1YA 4NJMB 4P4NA 3H3JA 3ZWBA 3OICA 1E3WA 5GY7A 1YRLA 3IOYA 3TWOA 1PEDA 4J1QA 4BIIA 2W90A 4PFJA 3JQAA 1LTHR 1T26A 4BO3A 1A27A 4YCAA 1JVBA 4PZEA 1T2AA 2Q1SA 4UREA 2OP0A 3EC7A 4F46A 1HWYA 5IZCA 3GF4A 5JY1A 2IYOA 3FN4A 1PS0A 4YXFA 1U8FO 3GMDA 2ZATA 5L4SA 2Q1TA 1P1FA 4GPD1 1H2HA 5EIOA 1UXIA 4GSLA 3JQBA 4AL4A 1YB1A 1PZGA 1B8UA 3RJ5A 3JD1A 4HUJA 5L4NA 2IZ1A 2WJPA 5A5EA 5BSEA 1V3VA 1UXJA 3TN7A 1E7RA 3E48A 2JJYA 2SCUA 4WOJA 4XYGA 1IL0A 4XYLA 4ZA2A 4FDAA 4CMIA 2HAEA 3LT0A 1BSVA 1HSZA 2FR0A 1UZLA 4IZIA 4ND4A 3PHJA 1B3RA 1IZ0A 1W73A 3JQ9A 1UP7A 2HMWA 3JQGA 2OFPA 4Q9NA 3FRJA 1J5PA 4NBVA 3CZRA 4YQZA 2BGKA 3EVNA 4XEHA 3PDUA 2DM6A 2HRZA 3GRPA 1IE3A 4B7CA 2BGMA 3BZUA 5L7TA 3IKTA 3DZGA 2CFCA 1CRWG 2BELA 4OXYA 4XWYA 1LU9A 1NX6A 4QEDA 1M6WA 5A3VA 5JC8A 3D64A 3JQ7A 5L4LA 1N8KA 1DC6A 2EJWA 1HDGO 2PNFA 4FFRA 5EMHA 4ZICA 4DMMA 4BB5A 3CIFA 5L7YA 4XD2A 4DLLA 1PGOA 3SJ7A 5G0SA 3HG7A 4BOYA 4B4VA 3NRCA 2C7GA 1C1XA 1P1IA 4YT8A 3VC7A 1MX3A 3ZWAA 3EK2A 1M76A 4KUHA 4DREA 3QWHA 1KVRA 4WLOA 4TRMA 1W8DA 1EMDA 4GWKA 3UN1A 3DZHA 4CMEC 2C7VA 1E0DA 2FZEA 4J9VA 4YT5A 3ZHZA 1E6EA 3IQDB 4FB5A 4P38A 4J0FA 3P5SA 2Z5LA 4Z9XA 1QORA 1QV6A 5JMPA 4CLRA 4KWHA 1LDEA 3C7CB 4BO2A 1PL6A 5F1KA 4MVJP 1T1RA 4WCFB 4BNFA 1QLHA 2DUWA 2ILTA 2Q4BA 2QYSA 3AY7A 1A71A 4EJ6A 5KJFA 1QXSA 3JV7A 3P7MA 4IJUA 2PTGA 1IUKA 3QP9A 5IAAA 3ZNOA 1DRWA 1BXGB 4NBWA 4M8SA 1VKOA 4Y9DA 3UOGA 3WNQA 5TJHA 2VWQA 1ADCA 3GRKA 1HETA 4IXWA 4GX0A 4A10A 4CV2A 3KYCB 1ZJYA 2BMAA 2E48A 3DAGA 4TRRA 1LNQA 3WWZA 4TROA 2YFHA 3ASVA 5AXCA 2OZPA 2PH3A 3V8BA 5BSHA 1D4FA 1Q0LA 1ENZA 3ONFA 3CZMA 2I3AA 2Y67A 1JWBB 3ZDFA 2RBEA 4E3ZA 2G17A 2CY0A 1C3VA 3D4OA 3DO5A 3VH4A 2O3TA 3ONDA 5EJ2A 2A9FA 4J2OA 1ULUA 4XYBA 1DRUA 3ZCXA 1R16A 3ETGA 3DR3A 2EP7A 2Y1EA 4GSKA 4HV4A 2DFVA 2E4AA 2WE8A 4DA9A 1MFZA 3M2TA 4F3YA 1XLTA 3QIVA 1I3KA 1E7MA 1GPJA 3D4NA 1J49A 3KEOA 4CMCA 4AFNA 3L4BA 5A02A 4J1TA 1NTOA 3VOSA 2FPPA 1NQOA 4ITUA 4II3A 1PSDA 5JAZA 4CUZA 5JAMA 3LLSA 3NTQA 4CQLA 3BHMA 5GMOA 2AE1A 3VZRA 2Q2QA 1MA0A 4YJHA 5ILOA 1ZK0A 2VCYA 3C7AA 2HU2A 4J7XA 3GZNB 4BMNA 2VZ0A 2NU7A 1P1KA 4BO8A 1EDZA 2HKIA 3TPCA 2V6FA 1KVTA 3VHRA 2X86A 1VRWA 4CUJA 3UFXA 1PGJA 1HYGA 4XRRA 4DYDA 4YQYA 2HUNA 4YRAA 2O7QA 1W0CA 2E37A 4FGSA 4PZDA 5IF3A 3DBRA 4JK3A 3RVDA 1ENYA 3OEWA 4KMSA 1YL7A 4D0RA 1DDOA 3KVOA 3QJ5A 2J8ZA 4CLOB 4GWGA 5G0UA 3BMNB 5EQDA 4RPHA 2VT3A 4E5KA 1GYPA 4D42A 2B69A 5JXWA 1Y1PA 4PG8A 1F14A 3RAJA 1LC3A 5ER9A 2ZK7A 2J6IA 2O3JA 1H6BA 1WP4A 3AY3A 1PS9A 1R4MB 5KVVA 3C24A 1ZIDA 4BHTA 4QQRA 1YBVA 6LDHA 4MVJA 3HUDA 5TSDA 4FJ0A 3H3FA 3I1JA 4AICA 4TVOA 4CM8B 3QA9A 4IDFA 4HWKA 4EJ0A 5CDUA 1VKNA 3PHLA 5TT0A 4U6QA 4FOOA 2H6EA 4R9RA 2O50A 4BVAA 4HKTA 3DMTC 1N7HA 4GH5A 1PGNA 2PKQO 2OL4A 3X2EA 2WD7B 4NBRA 4AJIA 3ANLA 3W6ZA 5B4UA 3UH1A 3I83A 2HO5A 3UHAA 4EBFA 3LU1A 2J3KA 3BMCA 4D44A 3ZU4A 4DQUA 2V6GA 2P91A 3F1LA 5A1TA 4BKUA 1MG5A 2B4RO 4KQXA 1H9AA 1YWGO 1ZXLA 1S7CA 4K28A 4NI5A 3OA0A 5A4DA 1LSSA 3WOHA 1T24A 3BTVA 5IG2A 3ZV5A 4OXNA 1EVZA 3EYWA 3R6DA 2WEKA 2QW8A 4RVUA 4WLEA 4WUVA 4J4TA 4L0QA 4WJZA 1X13A 1Q0HA 1T2DA 3GEMA 4RF4A 3KOUA 5I7VA 2GN6A 4N5LA 1U3TA 4W9NC 5CEJA 3G17A 4MVJM 2R2GA 4FSHA 1WNTA 2CDCA 3HDYA 4Y98A 3ZWNA 3GHHA 1P3DA 3Q9UA 1U4OA 2GYYA 5GZ1A 4D41A 3NJ4A 4NDNE 1VJ1A 3GVPA 3GAFA 4LCJA 3PPIA 3I4FA 2CVQA 2PV7A 2X5JO 3EDMA 4YDRA 3U49A 3ULKA 4C4OA 3PJEA 2C2XA 4GAEA 1TI7A 5AYVA 2E6UX 1Z73A 3WB9A 1E1MA 4IDAA 1R0KA 3EAGA 4B4UA 2GD1O 1LLUA 1PJQA 3LT1A 1GCOA 1LDBA 3RC2A 1PR3A 4FFMA 3RWBA 4NJMA 3QVOA 2PH5A 3FTNA 3ZWXA 4JP2A 3KUXA 4JX8A 9LDTA 3OETA 1U1IA 5T57A 1K5HA 2C5AA 2O23A 3B20A 1SEPA 4Z9FA 4ZRNA 5TQVA 2ZQYA 5CDSA 3DXFA 3GUYA 3JYOA 4PGFA 2UAGA 1I3LA 1QYXA 1Z6ZA 3RU7A 5DP1A 2PZKA 1LDYA 4XKJA 3SXPA 3F1KA 5A05A 1X0XA 2Z95A 1IB6A 1FJHA 3L6OO 5T8KC 4ID9A 4J0EA 4U6SA 4Z6KA 2Q46A 4QXMA 3CINA 4I1IA 3TFQA 4KDFA 3SC6A 4MOWA 4PN3A 1I2ZA 1U8XX 1JAXA 2C5EA 1ONPA 1WMAA 1X7GA 3D3WA 5IFLA 5L9AA 1IOLA 4DBZA 3OIDA 4NNJA 5G0VA 4BGEA 1PZHA 2OORA 1MLDA 4HFNA 3E03A 1PTJA 1Z7BA 3DTTA 4GVXA 1KIFA 2Y66A 3FCOA 1TLTA 5DOZA 1E7SA 1NQ5A 3GT0A 3INRA 3NJ8A 4LRTB 5LDGA 4TRJA 3RKUA 3QRWA 1P77A 3ONEA 4IIUA 4Y6SA 1Y9AA 1P33A 3G79A 4JCOA 3WTBA 4BNHA 4O1MA 3BHIA 5JMWA 4UUMA 3ZV3A 3JD4A 2Y1GA 3HHPA 1NVGA 4W7IA 2CUKA 5AOVA 1NM5A 4C7KA 1ZEJA 3PJDA 3C1OA 5LCXA 3VKVA 5CFZA 3WJAA 1SB8A 1UH5A 3RBXA 5J23A 3BAZA 4L73A 1JKJA 4YB8A 1B8VA 4Z0HO 3U0BA 2C59A 1UDCA 4LVUA 4Q3AA 3UUWA 3RIHA 1Y8QB 3P19A 2NLOA 2W2KB 3RUIA 3S2IA 5DCYA 1PWXA 4J49A 1PJSA 1U3UA 2I66A 4MKXA 3W8EA 5KWEA 4ZD6A 3DTYA 3LQFA 3KBOA 4PLVA 4HFRA 5BNIA 1I10A 1FDUA 4MIYA 3WGOA 2VT2A 3UW3A 3DL2A 1AHHA 2WWRA 2D1YA 3PQDA 4MP6A 3GGOA 1LLDA 1ONOA 4WNCA 2CVZA 2WTBA 1PJLA 1U28A 1YQXA 4ONEA 4EZBA 1V3TA 2C2YA 1QYVA 4K26A 4RVFA 3NEPX 4CMJA 1NPYA 4XIYA 1DB3A 3E9QA 4O63O 1KC1A 4ZU3A 4F45A 2GASA 3WBBA 3QVTA 3DQPA 1PQUA 2B37A 4BGIA 3ZI0A 2DTXA 3C8MA 2O48X 4CUKA 2VHXA 5GZ6A 3H5AA 4PIVA 3D0OA 3Q3CA 1PJTA 4R5HA 6ADHA 4E5YA 4U7WA 2Q4EA 3UGKA 2VZ9A 4WCFA 5JDIC 2EIHA 1LX6A 1OZAA 3ADPA 3AUUA 3LC2O 3WGYA 4A03A 3ANNA 4NR0A 4I9NA 4IMRA 4L75A 1BXZA 3IMFA 1HZJA 4ROSA 1KEWA 5JC1A 2DBQA 2QQ5A 2C82A 4YT4A 1BVRA 3F9IA 4CQMB 3JQ6A 5AVOA 2I9PA 1DXYA 4OHUA 3KYCA 3OQBA 3FD8A 3U9LA 1GTMA 4YBZA 3WXBA 2JFFA 3LT2A 2IXAA 3L4SO 3ZU2A 1EVIA 1GU7A 3TJRA 5CP8A 3AFMA 4XDZA 3WGZA 1OC2A 5I7FA 5H82A 1I01A 1LRLA 3NT5A 3ZZNA 5IZCC 1HRDA 1N92A 3PEFA 1V9LA 3GQVA 4TRNA 1QKIA 4BNJA 3D1LA 1Q7BA 3VZQA 1PWZA 3DONA 3JQBC 3ZHXA 4KTVE 3WWYA 5DN9A 3U09A 5DCWA 5KNLA 4B7UA 4MPDA 1CWUA 4LISA 2D3TA 4MDHA 4UVDA 5U1PA 3GAZA 3FTPA 4XA8A 2X5KO 3K8ZA 1SB9A 4R4JA 4YJDA 1PJ2A 1O0SA 1HZZA 1HE5A 2JD0A 2RHRA 2ZJ0A 3ZHYA 3I9OA 2GN9A 1N1EA 1T1SA 3QE3A 3RI3A 3GDGA 3JQ9C 1YB4A 3FWZA 1E3LA 2CNBA 4QUKA 4DIOA 2G76A 3DWFA 3NKLA 1E92A 4ZQFA 5JDCA 3CMCO 4YT2A 4ZVVA 5B12A 2NUAA 1VL8A 4E5PA 4DVJA 4W4TA 1E1KA 4CQMD 3G1UA 4LRSB 1EEHA 3PZBA 1Z45A 3GZNA 4R3NA 4GGPA 3ZV4A 4RZHA 4O59O 2Q1WA 3VPSA 3O03A 2B5VA 4MVJE 2YV1A 3CXRA 2HQ1A 3RQSA 2WYUA 5DBGA 1CETA 1WW8A 2P4QA 1XELA 2AEFA 4XCVA 2QRKA 4IQ0A 3S2GA 4CLOA 2AQ8A 3BMNA 3S8MA 5DOVA 4FBGA 1O95A 3W8DA 4WEOA 3U4DA 1SBYA 4R68A 4Y8VA 1SNYA 3GGGA 5I8WA 4A0SA 2UYYA 1LUAA 2P9EA 4XGIA 3UXYA 4Z9YA 4KQWA 4CMGA 1OOEA 2XXJA 3W1VA 4HFJA 2P5UA 4PG7A 2NTVA 4I08A 3V2UA 4UAGA 1DOHA 1JDJA 3PYXA 1Q7GA 4CR8A 4R5MA 1OI7A 1HL3A 1K3TA 4H3VA 1AHIA 1FDVA 1D7OA 3GH3A 4BV9A 2B0JA 1VJ0A 4B4WA 2VYNA 3QSGA 1DC4A 1RYEA 1AE1A 2NACA 4GKVA 3IDSA 3PDJA 1NWCA 4NFYA 2NV6A 3ZU3A 5AXBA 3JQ8B 1NQAO 1IPEA 4CLXA 3GHYA 4M89A 3U4IA 3HDQA 1YDEA 1B8PA 2O2YA 2WM3A 1P1JA 5KJEA 4Q3BA 1LBEA 2ZB4A 2P9CA 1JN0A 1XQ6A 4GI2A 3RC1A 5JO0A 1ISGA 4G2NA 4NFSA 4GMGA 3WG9A 4D3SA 4PRLA 2GDZA 1H0KA 1DIBA 2QZ9A 3GNSA 3RC9A 2GERA 2PD3A 4IQGA 4CMAA 1ENOA 1CIVA 2IEBA 5COQA 1BRMA 3KB6A 4XDYA 5KVQA 3GY0A 4J3FA 3COSA 3PQFA 3L77A 3TZCA 1FMCA 4PLHA 4JBHA 4A26A 2VZ8A 2I67A 5G4LA 4E12A 4WK6A 2LDXA 4ZQBA 1A7AA 4RQUA 2VNSA 2FPGA 1HE3A 1QYWA 5F5LA 1G0NA 1UJMA 2PKQP 3IJPA 2RH4A 3WIDA 1XDWA 1MXFA 2WE7A 3VPFA 4IDEA 4JNKA 1WAMA 1I5RA 4PLTA 4OXKA 3FBTA 1SOVA 4OYRA 1SMKA 4BNXA 2R6JA 4ZQGA 1LRKA 3KSZO 7ADHA 5TRTA 3PWSA 3MJEA 2YJZA 4BQPA 3ZNNA 3B1JA 4OMUA 3NDIA 1U3VA 1YBMA 4ESOA 4UEOA 3SJUA 1B14A 1DHRA 1I24A 4BO7A 4E30A 3FPCA 3JTMA 4GLOA 1K0UA 1DIGA 3E9MA 2J3JA 2NM0A 4YAIA 2IRWA 3I5MA 4J1SA 2XXBA 3K2EA 1JKFA 3VVBA 2YV3A 3ITDA 1BW9B 3VTZA 3RUEA 3TF5A 4D3DA 1GUYA 1GZ3A 3DMYA 3H9QA 1ADGA 2IZ0A 4ALLA 4PLFA 3DBVO 1BGVA 2BI8A 4WPGA 4YJFB 4D7AA 4GX2A 1FDTA 1R15A 2V6MA 2J5QA 4J7CA 4IDBA 1CYDA 4MKZA 4OKIA 2B4TO 4BO5A 4I5GA 3K6JA 4IMPA 1VLLA 1X0VA 1OAAA 1XSEA 3A4VA 3UKOA 2W2LA 3LF2A 3JYQA 3NTRA 3F5SA 5K9ZA 5LDHA 2FMUA 1VL6A 4R1UA 5I8ZA 1VL0A 4YYZA 2PLAA 2AE2A 1EUZA 1GD1O 5G4KB 5C7OO 3ST7A 4A2CA 5JCJA 1CQIA 5COBA 2AQHA 2UV8A 1QLJA 5T6BA 3BTUA 4NK5A 4YPOA 4YAEA 3JYLA 4KP7A 2OGUA 4JQCA 3WSWA 4AJ1A 4E5NA 2VRCA 5FI5A 4R1NA 3V1UA 1ZUD1 3H65A 5EESA 1E77A 1Y8QA 4QTZA 2W2KA 3R1IA 3QVXA 4A27A 1ID1A 3LK7A 4BNYA 3CH6A 1NVTA 2CZCA 3W4IA 1FDSA 1U3WA 2G82A 4J91A 2AMFA 1HDXA 5F5NA 1W6UA 1C1DB 4PLCA 1A9ZA 1V3UA 5DT9A 4U8GA 5I9LA 2VYVD 2PR2A 3H5NA 3DHNA 2ZTVA 1DBVO 2EKLA 3R3JA 4XYMA 4XQEA 2EP5A 5C3MA 3ZWMA 3IUSA 3F4LA 1KERA 4DBVO 5IN4A 3U62A 4E4YA 3AOEA 4LVCA 3AUSA 4UVGA 3ZNPA 4QECA 1PQPA 4JXKA 1J0XO 1CQJA 1ZSYA 1CF2O 3EW7A 4CM4B 1QYDA 1KVUA 3MOGA 1ADBA 5A04A 4QO7A 4BB6A 1BWSA 3TDKA 1ZH8A 1PS8A 5T5QA 1P31A 3RFXA 3VDQA 2VHVA 4KZPA 3PQEA 4YRDA 1NAHA 3GG9A 2IE0A 1YOVA 5K0ZA 1ZSVA 3MWEB 1QYCA 3RBVA 1K2WA 3GPDG 1NWHA 5BT9A 2NVUB 4ZGWA 5K6AA 3IP3A 4IDDA 5JYEA 1EBUA 4JJGA 2JKVA 4PLPA 3AJRA 4MKRA 2Y1DA 4GGOA 5BNTA 2GGSA 4R41A 3GK3A 4N54A 1GV1A 4CJXA 2VTEA 1IULA 5ENDA 4CM3A 1NAIA 1M67A 3A1NA 3PIDA 4QSMA 1NVMB 2GZ2A 3OECA 2YY7A 1ULSA 3HQ4O 1NNUA 1HF3A 4BV8A 1NHGA 3Q2IA 4UULA 2RHCA 4EJMA 5JE8A 2P4HX 1ZW1A 2PWZA 2TMDA 3NDRA 4FS3A 4H16A 4IUYA 2Q2VA 3C3XA 3DBHB 1X15A 3QWFA 3MTJA 2GN4A 1RM3A 3PGXA 4LW8A 2HSDA 4LGVA 3KHUA 2PD6A 3SX2A 1M75A 3N7UA 2JFGA 3JD3A 3OJ0A 1HTBA 1MUUA 5ICSA 1Y8RA 1LRJA 2JCYA 3HZZA 3DBLB 2DTDA 2Y1OA 4DYVA 4BNLA 4YJGA 4I5DA 1KS9A 3O8QA 4CM6A 4E6PA 5A9SB 1GCUA 5A3JA 4J6FA 1PU2A 2NU9A 2GLXA 3DHEA 2Q1UA 3Q9NA 4OKNA 5TNXA 3PFWO 2HCTA 4OQYA 1MG0A 1HYHA 1Q2XA 4CR6A 5BNFA 1ZSNA 2AXQA 1T2EA 4MVJH 5COAA 1UZNA 2QZZA 3GMSA 5AQ1A 1R4NB 4R3WA 2AW5A 2R00A 3LDHA 3QV1A 3ASUA 3RSHA 4OAQA 5KVCA 1QMGA 3KSDO 3UCEA 2NQ8A 2NVBA 3D5TA 4MIEA 4FC6A 1DC3A 2XPCA 3W4JA 1ISFA 4W99A 3ICCA 1QG6A 3BMOB 3IC5A 4IDCA 3FPLA 2F1KA 1BMDA 2B5WA 2FOIA 1PJBA 1X7DA 4FFNA 1YQGA 1KY5A 2ZYGA 5FEUA 5A9TA 2NSDA 4YVFA 2A92A 4EEXA 4DC1A 3KYDB 4DXHA 4XJSA 2OXIA 1WMBA 2AQKA 4I9HA 3VTFA 3Q2KA 2JD2A 1P45A 1VPDA 1MC4A 2YHUA 1C14A 2DFDA 2PFGA 2DPHA 3H4VA 4URFA 1M66A 3ZWVA 4QO8A 4TSKA 1CDOA 2WYWA 3AFNA 3A9WA 2P5YA 4IJVA 4RQTA 1KBZA 2YQ5A 2Z1MA 3GFGA 4B4OA 4L76A 1EUCA 3ADOA 1U9JA 4RPKA 4J16A 1N2SA 1O94A 2FHSA 3GGPA 2PKRA 4YWJA 4JN6B 1T2FA 2PA3A 5IDQA 1WPQA 4KUEA 1QP8A 2YHIA 1PIWA 2X9GA 1UZMA 3C85A 4OGWA 4F6LA 4PLWA 1GEEA 1IY8A 1EQ2A 4I8XA 4U5QA 1A9YA 2J3IA 3VPXA 3OJEA 3WNVA 5HS4A 3R0IA 4BO0A 2QX7A 1ZVMA 3LVFO 4I5EA 1H93A 3TNLA 5JCXA 1N9GA 2BFAA 3OP4A 2WD8A 8LDHA 1EK6A 5F21A 4WCFC 2W98A 4EI2A 3EHEA 1D3AA 1MXHA 3F6YA 2HMTA 2X58A 1ZKMA 3S1LA 2B4QA 1LI4A 3LZ6A 1YGYA 1NYTA 4ALIA 1RWBA 4RDHA 1ISMA 1ZZEA 3H2ZA 1HLDA 2AHRA 2YZ7A 2RAFA 2GUGA 4XB2A 1T25A 3ZN2A 1ZJZA 3LSYA 1VM6A 1SPXA 4E0BA 1UP4A 1I32A 4OH1A 1B7GO 1J4AA 1PJ4A 1X1EA 1TEHA 2BFPA 4FPXA 4PVCA 5THQA 5JBIA 4M54A 4D46A 3RKRA 4X54A 2D4AA 3W8FA 1UUFA 3AK4A 2BI7A 4ZJUA 2ZJ1A 4JROA 3ZW8A 4BGVA 1HDZA 1B15A 1E1NA 3AI3A 3NV9A 5DP2A 4OIMA 4BNIA 3BHJA 4CM9D 4IXTA 3M6IA 2AQIA 3HNPA 4OL9A 1X14A 2NQTA 3JYNA 2P2SA 1P44A 1CEQA 4N18A 2X0NA 2ZB3A 1YKFA 4IM7A 2AEMA 1VI2A 1PL8A 3B70A 2YW9A 4D43A 4TVBA 3ZWPA 2YQ4A 5H81A 2OMEA 4D79A 4Z0TA 3OSUA 3V5NA 3OEYA 1P1RA 3QWBA 4K9DA 4L9RA 3EZLA 3BIOA 3PWZA 4J43A 4W82A 3TZKA 4DTIA 4RV9A 5CHEA 5TS3A 3ICPA 2PZJA 4BNWA 1IHYA 1YJ8A 4NPCA 1UXHA 4R51A 4EUEA 4ND3A 2DUUA 3DOOA 3PJGA 3TFOA 2O7SA 2DU8A 4HY3A 1U7TA 5THKA 3JQGB 4OQZA 2X4GA 3AI2A 3NYWA 4HP8A 2EGHA 3NGXA 1BW9A 4Q3DA 4XQGA 4FJ2A 2RCYA 1V35A 1WXDA 1DIHA 3PK0A 1UAGA 3K73O 2HK7A 4J4HA 3VZPA 4OSOA 3NAQA 1YVEI 1OMOA 2JD1A 1YE3A 3JQAD 2Q49A 2E49A 1IZ9A 5BSGA 1I33A 5I9NA 4FFPA 4PLGA 4XYEA 2YV2A 4NFHA 5F1OA 3S2FA 3ZU5A 2I76A 3F3SA 3JQ7B 3AUTA 3IJRA 3KV3O 4BO9A 4GLLA 4Q3NA 1E3SA 5JAIA 1LDMA 3OHSX 2GRAA 4PZCA 1F8FA 3F5QA 2JHFA 5G4KA 4UUPA 2O4UX 4TZKA 3RASA 1QRRA 2GZ3A 1G0OA 1R37A 3UICA 1UDAA 3NDJA 1DPGA 1WDMA 2CF5A 3OJOA 2H63A 4CR7A 5JAQA 2HMSA 4L4XA 5KKCA 1ZBQA 2Z1NA 4MO2A 3HB5X 4CODB 3HN7A 1XKQA 4DL9A 4KWIA 4BNZA 5JYDA 4R69A 3K5PA 5TF4A 4L4RA 4IY1A 5IJZA 4W6ZA 2ET6A 2UUPA 1VE9A 1SO8A 1U2GA 5BSFA 3S2EA 5IZ4A 4EUHA 3Q11A 2NTNA 3AM3A 2H5LA 4BNMA 1FF9A 1KVQA 3KRTA 4CLRB 1FDWA 2VWPA 3NTOA 1EZ4A 4UUNA 2JFHA 2V65A 5ITWA 5U9CA 3U4CA 1MGOA 4B3IA 4ALMA 2P9GA 3PHIA 3ROPA 1PZEA 3L0DA 1CJCA 2ZIZA 4XQCA 4XX0A 3GVXA 4GBJA 3GVHA 1S6YA 3PI7A 4INAA 1BXGA 3FI9A 5HS6A 3ON5A 4KOAA 1MP0A 5G2OA 2JCVA 2FZWA 1JQBA 5T67A 4TKLA 1LSUA 1MV8A 1UP6A 3WQQA 5HRUA 1EVJA 2D5CA 3FNFA 1ISJA 2EW2A 2NVUA 4AJPA 5L53A 4I9UA 4HNGA 1DEHA 4CL8A 1NFQA 1PQWA 1E3EA 2VUTA 2VUUA 2HMVA 4XIJA 1TVEA 2X23A 1O89A 2A35A 4IJWA 4IPTA 4OOEA 2Y05A 2Q99A 3QWIA 2O2SA 2ZTMA 3DZKA 4B8WA 1J6UA 3HN2A 3O38A 1YBAA 2EGGA 4KUGA 3DZBA 4IS3A 3H9GA 1I2CA 3L6DA 4UEJA 5EQFA 4E21A 1VSUA 3WR5A 1ISIA 1V0JA 4J90A 4YAKA 5B4TA 4CL3A 5DNAA 4ALJA 2EXXA 3KYBA 4R16A 4BS9A 4YAJA 3P2OA 3GR6A 1UXKA 4D3FA 2PGJA 2VWGA 3ZWOA 5A06A 3ETEA 3RUAA 1NFRA 4XJTA 4IJKA 4LMPA 3E9NA 3GC6A 3WMXA 2HLPA 4XGNA 4E33A 3I52A 4N7RA 4RGBA 1I2BA 3O4RA 1KEPA 1JU9A 1QR6A 1JTVA 2ZB8A 3DEYX 1E6WA 3BA1A 3VVCA 1JAYA 2D0IA 4J2HA 1C0KA 4MVJF 4ND2A 5KJCA 2YFQA 1YJQA 3GLQA 2RH8A 3T7CA 1EUDA 1TB4A 2DT5A 2HMUA 4M1QA 3STHA 2PZLA 3HE3A 3HWRA 1HSOA 2IEDA 4U0JA 5FF9A 3V2GA 1A5ZA 3BMOA 1P74A 4AJ4A 5A03A 3PXXA 3H9EO 2I5PO 5DF1A 4BNKA 1GQYA 2X0IA 5ER6A 3H9JA 1HE4A 4RPJA 1AXGA 1ZCJA 4HXYA 1F8GA 5CDYA 1TT5B 3DC2A 4XR9A 1R4MA 1XA0A 4IQ8A 3GZ4A 3VPGA 1Y5RA 3ZW9A 4DGSA 1XQ1A 3UCXA 1SZJG 2Y1FA 1E3IA 4AJOA 1M2WA 4CM8A 3BXXA 4JGBA 1TA4A 3V1TC 3ZV6A 2CD9A 3WSVA 3AM5A 4LSWA 3ZWCA 1P0CA 1E3JA 1R0LA 3KXDA 2X7HA 3RFTA 4AJKA 4IDGA 2WD7A 2HK9A 1BHSA 5ITVA 1DIRA 1F17A 1K6IA 4AJLA 1RYDA 5F3RA 4B3JA 3HFSA 2BGLA 4G65A 2FR1A 3JQFA 3AOEC 5DBIA 3TZ6A 1H6AA 4G5HA 4XZ3A 4DMLA 2POQX 1WVGA 1E1LA 3G49A 4TKMA 2B35A 3WYBA 5H83A 3SLGA 2D8AA 4IIVA 2FRDA 3K30A 1Y81A 2Y93A 1WZEA 2ZCVA 4E32A 3RUCA 5KKAA 3GFBA 3AOGA 4FW8A 2C07A 1GPDG 3UVEA 1E7WA 4C7JA 3IL2A 3HB4X 1EDOA 3KEQA 1NASA 3DOJA 5K6AC 3WMWA 1U7HA 1LQTA 4MVJD 1Y7TA 3QVWA 3D5QA 5ILGA 4XQ9A 4CM5A 4DRYA 4GL4A 3GDOA 3SVTA 1PX0A 3H8VA 3INGA 5ADHA 3RUDA 2OBNA 5JDIA 4ILKA 4PCVA 4RLSA 1B3BA 5BR7A 5JNLA 1D1SA 1C0IA 3LF1A 1DC5A 2OBYA 3L07A 3MJCA 3NX4A 1PZFA 2FR8A 3WS7A 3HFGA 3RU9A 3GEDA 5JO9A 3KSUA 4DQVA 1LEHA 4WLNA 3E82A 5C37A 3AM4A 2BFMA 5JPIA 3WX0A 5A5FA 3L4BC 4FGWA 3WBFA 5CPFA 4GQAA 3PRJA 5HA5A 1HE2A 2DQ4A 3TRIA 1RPNA 5CAEA 4FOSA 2JAHA 4LMRA 3KLPX 2EG9A 3AU8A 1AXEA 5CDTA 5JFOA 2Y99A 4E5MA 2BLLA 1ZMOA 1IYZA 3MTGA 4D0SA 3FR8A 1W4ZA 2PK3A 3B1KA 3FNHA 4G81A 2ZKLA 4U0KA 5CPBA 5EN4A 4FIZA 1BG6A 4TWRA 3Q0EA 1BVUA 1ZK2A 3GVCA 3G3EA 3MWDB 4UVEA 1L1FA 2FPIA 2A94A 1XHLA 1R66A 4R1TA 5MDHA 3I4CA 1YL5A 1OFGA 3WGTA 2BH9A 1FXSA 1U2DA 1R12A 3D3WB 1DJQA 4M55A 4WASA 4HFMA 3VPHA 1ZK1A 2R00C 1GAEO 4Q3CA 3B6ZA 1UR5A 2EWMA 3JQEA 4RPLA 4BMVA 4CV3A 1ENPA 5CEFA 4YA6A 2WYVA 3NT2A 5HBRA 1DIAA 2EF1A 4DIBA 2IDZA 3U4HA 5TGDA 4DC0A 4CV1A 2D5AA 4Z0PA 2IZZA 2Q3EA 4I5FA 3BYZA 4CV0A 3PJFA 4IBOA 4W7HA 2YDYA 2GNAA 2I3GA 4FJ1A 3L9WA 4XB1A 7MDHA 4R01A 4CMHA 1E5LA 2AG8A 3CSDA 1JWAB 4Y6PA 3S55A 5MGBA 4NU5A 2GR9A 4WGGA 1I30A 2W8ZA 5JS6A 3ENNA 3V1YA 3EZYA 4BNUA 3LLVA 3QLJA 4L4SA 9LDBA 2J3HA 1U4SA 2D59A 3OM9A 3QQPA 4TQGA 4BO4A 1RM5A 2C0CA 3WGIA 5HM8A 1SC6A 4WE3A 1ZEMA 2DBZA 3DZJA 3VH3A 2PY6A 2UDPA 4BKQA 4TZTA 3RUHA 4XGKA 4B7XA 1F06A 3W4KA 1L7EA 3DAPA 3WQRA 1ISHA 2D2IA 2NNLD 1KC3A 2AG5A 4NMHA 3RJ9A 3NT4A 1PL7A 2DVMA 2NU8A 2O3QA 3I6IA 4CPDA 3JSAA 4AVYA 4Z3KA 2X1HA 3JQDA 5I7SA 1NBOA 4CLHA 2JL1A 1JKIA 2X0JA 2ZB7A 4EW6A 2Y0CA 2EERA 4JP3A 4A7PA 1EE2A 1HT0A 3O9ZA 4RDIA 2AEJA 1H6DA 3L6EA 1CERA 4MP8A 2CSUA 5KIAA 3TL2A 4BNGA 1O9BA 1K6JA 1NR7A 4BGUA 1WDKA 3K2BA 3PWKA 3WDSA 4BMSA 1D1TA 2HJSA 2J5RA 3GA0A 3H2SA 4BUCA 5G0WA 4H7PA 2HRBA 3IIEA 4K6FA 1XU9A 1B0AA 4E13A 3RCBA 3ROKA 4WKGA 3RROA 4N5NA 4J4BA 1GADO 4E31A 5C7LO 2W4QA 4E2WA 3F4BA 4S3MA 4CLDA 3CEAA 4NIMA 1HDOA 2IXBA 3K9QO 4YRBA 1XEAA 4RF3A 3AW9A 4AJ2A 1KVSA 4DIFA 1KY4A 2OO5A 3WTCA 3ORFA 1DFIA 4MIOA 3I9MA 1LC0A 4O6VA 5U4QA 3I6QA 3GNTA 2NU6A 3PLRA 2Q45A 4A5OA 1SCUA 3ENKA 4CQMA 1DRVA 1Q7CA 4B8ZA 2V7PA 3FHLA 5TJ9A 3PIIA 3RUFA 4B79A 2X9NA 3TZQA 4FFLA 1LLQA 5DZSA 1I3MA 2QYTA 2X8LA 4AG3A 1V8BA 3EMKA 3VZSA 4XRGA 3HJAA 3OIGA 3WGHA 1H2BA 3BMQB 1UXGA 1ZK4A 2DBRA 3IAHA 1OBFO 2BF7A 4WLVA 1BXKA 3SEFA 1R6DA 1SEVA 1Z75A 2ZCUA 3F47A 5KJ6A 5L95A 4AJEA 4FQ8A 1G1AA 2EKPA 4BKOA 1JVSA 4K6CA 3X2FA 3JYPA 2F00A 2I65A 4UEKA 4ND5A 4BKRA 2PGDA 4DPMA
chains in the Genus database with same CATH superfamily
3AB8A 1E2EA 2OXEA 3OD5A 3JQCA 2J87A 3EUFA 4PHCA 3PFBA 1O1YA 2W37A 1VSTA 3M9XA 3WL3A 4FOTA 4EZEA 4JI4B 2PGNA 4JQZA 1BHJA 3LFTA 2XR1A 3D3NA 1XR3A 3IYLW 4Q5IA 3UK2A 1ELOA 4NK4A 4HMOA 1UKZA 2CDNA 4WNIA 3ERCA 3O2SB 2IHKA 2WUVA 1FXUA 1IXYA 4RHEA 1KI3A 3OZAA 5LYJA 3LYUA 3MEQA 1OW3B 4EI7A 4U7GA 3ZH2A 4DXAA 3KS9A 4N48A 2X41A 4JAVC 4GKBA 3L6BA 4WT7A 1QGDA 1FTNA 1GV0A 1XDGA 3LKVA 3I62A 3IJ5A 1Z33A 1SUPA 3E2MA 1Z82A 2GPTA 1QK3A 1MQ8B 1N7GA 1BGWA 1S2GA 1K97A 2NADA 3NVMB 4RGQA 4DANA 1A1VA 1QZUA 3CTMA 4XUEA 1KORA 4DBLE 1PBTA 1YUMA 4BVKA 1LPPA 2CE2X 3HXTA 4S1WA 5BWLA 4H9GA 3VAZA 3DUWA 4K86A 3IGFA 2YUTA 5IDYA 1ZW6A 5EIEA 2C0QA 1GGFA 1I0ZA 2IPOA 1BDMA 4TMXA 3J81A 3LS2A 3I3OA 4WACA 5ADWA 4REMA 2PZBA 1FXWA 3JZDA 4M36A 4H3SA 3A1TA 3AUAA 4P82A 3SDSA 4JBIA 1MHPA 4LYHA 3TB4A 1U2EA 3DE3X 3NFRA 2R8BA 3COVA 4OYYA 1UFRA 1JJVA 3IKVA 5D00A 2ZWIA 5JVDB 2XUFA 2ZGVA 3I09A 2C2OA 1RAIA 4Y18A 1DV1A 1A4RA 4YRKA 4O5OA 4TTVA 1KOLA 2HSEA 3EC2A 3OFKA 3QPWA 4OQXA 4OXXA 4II2A 2EDAA 2Q29A 3E5NA 3QHAA 4WXMA 2MYUA 4FCCA 4Q39A 5H1YA 3RBAA 1KQGA 1EFLA 1E3QA 3WICA 1KK0A 4LUCA 5ALWA 5HBGA 3DO6A 1SVMA 1CUSA 4F3TA 1XAIA 5IEBA 3H2HA 2BRUA 4ARSA 4LJKA 4B35A 3MSCA 5J2TB 2P67A 3QKIA 1HMPA 1AM4D 4JC5A 3FSRA 3NWJA 3TLEA 3TLZA 5DCUA 2OYSA 3ABSB 1XC7A 1ZXBA 3E0QA 3CPJB 1NKSA 1N0VC 1ULBA 1LLCA 3IEXA 3ZVMA 1GYRA 3CHYA 4XI9A 2BHLA 5EJ5A 2QU8A 2E4VA 4CFYA 4M87A 2IYEA 1XNHA 2I7DA 3C7KA 1FTQA 4KXVA 3BH0A 4ARAA 3CO5A 4Y2SA 3ABIA 5ECDA 3HCOA 1XCPA 5BN5B 4EITA 5IUNC 1YB6A 2CNWD 5ERYA 1JS1X 5MFPA 4K81B 4B3XA 4ZFNA 4Y0AA 5C8VA 4L7QA 4FD3A 4YP0A 1X7HA 2Z2YA 1EX7A 2PXHA 4R0VA 5FBQB 2YWFA 1NW6A 2AFRA 2BFOA 2C29D 1BAPA 3MJVA 1KDTA 4DCVA 5BURA 1ZP6A 3FOAA 2YJGA 2R85A 3DB2A 2VSYA 2XF8A 3G0HA 1SGWA 3PE6A 4X5OA 3SU8A 3T38A 2WT9A 4C29A 4KO2S 4KVAA 4ZHSA 5AW9A 2E2WA 2AI3A 3EFOA 3SZMA 1ZM3A 1PJ3A 1RAGA 4ZEWA 3A32A 3CLVA 4BO1A 3QY9A 3IQEA 3AKEA 5KNBA 1A95A 4QQKA 2YS6A 3ZVKA 4GRAA 4WOKA 2QPTA 2RHLA 3KYJB 5EERA 4ABYA 3M1AA 1G19A 1MH9A 1JU4A 2BGRA 2RAUA 2ZRPA 4W1PA 4KTTE 2B9VA 3VYRB 1D03A 2JCXA 2PE5A 4RD6A 4C7MA 1PJCA 1N1DA 3NBYC 1E0SA 1UOPA 2ICAA 5JDCC 3V8VA 3TMAA 2X5OA 4LBVA 1CJTC 1OILA 4NC9A 5DCLA 4LXYA 2AF4C 4YRGA 4Z1MD 1BWQA 3DCNA 5A9RA 5KTYA 4DJFC 4G5RA 2EAUA 2C95A 3PQCA 4RGYA 1G3UA 3ESQA 2DHEA 5D5QA 3OY2A 4U00A 3PHGA 5BN3B 4O1HA 3EXG1 4HNAB 4N41A 1H5NA 2X22A 1DLJA 4FK8A 4MPTA 1EP3B 1RI5A 1YSCA 2H2FA 2B2XA 3CKYA 3WLQA 1M6HA 5JADA 4AKIA 3WWCA 5EINA 3EPHA 1RM4A 1DAOA 1KYWA 4IGEA 1N5DA 1VCOA 2ZJ2A 3PTZA 3AZQA 5KWVA 3UTCA 4YCLA 2QPAA 2A0KA 2CJXA 3FNIA 4OHFA 4KN6A 1DOAA 4LJ7A 1LPBB 1N3BA 3S6JA 2HCJB 2YOHA 2ZR8A 1KETA 2XMRA 1HG0A 3WYFA 1CIPA 4YUXA 2GO1A 2C88A 1XZCA 2PUVA 2VHZA 1VJTA 1THZA 1QV7A 3DEZA 3I9JA 4WA7A 1R10A 4GXTA 1GYQA 2EX1A 4Q00A 3TSCA 2PIAA 3GT3A 3OZCA 2FN7A 3U19A 3B85A 3ME5A 1KFJB 4B3TB 5HWSA 5G40A 4UTRA 4R0MA 4WW0A 3VJMA 4B3HA 4LCBA 1U8AA 3CR8A 3EOAI 3C5VA 1PGPA 3JSXA 3QF7A 3L0ZA 4CG3A 2SHKA 3DE7X 1KSHA 2X8BA 1H94A 2E1PA 3T1NA 4D3XA 5TIIA 1WB5A 4FD2A 4K5QA 3A7EA 4L9AA 1X86B 3RQIA 4NWIA 4LSMA 2ECPA 1HORA 1TFRA 1B73A 4PPGA 1Y48E 2QGNA 5EC8A 4LC0A 4J9UE 3QOYA 4RCVA 2DR2A 4K88A 3Q1LA 5KOIA 2FSVA 5HTOA 2HZBA 4MP3A 2J59A 3UYLA 4K40A 2JEZA 3D7KA 3TBFA 5KNDD 3DOCA 1P1HA 2VZLA 4UE2A 3OFSA 2RGXA 5BMVA 4XJVA 1HDYA 3QUAA 1P3Y1 4L1KA 1Y3DE 1RI3A 4FN5A 2JGKA 5BV1A 3T3MB 1FLDA 3VKUA 5IS2A 5GP1A 1XDUA 3NIWA 4ZCPA 3KXPA 1XQVA 4DIKA 3N75A 2O5EA 3U60B 5DTJA 2OFXA 3S0JA 4DY6A 2ERXA 3MMPA 3R0ZA 5TC4A 3M6WA 2GJ4A 1E6UA 3JVEA 4PLZA 5DLDA 4ARVA 1R74A 4AS1A 4F92B 1LSOA 2CVOA 2XGGA 1DX9A 4UUOA 4BRUA 3GT7A 3T7SA 2PX2A 3C39A 3K72B 3TIIA 4ND1A 2H52A 2LDBA 2AOUB 3H6HA 3TOXA 1UPXA 4CM4A 5ALJA 4LXHA 1NF2A 5DHFA 1V2GA 1DKRA 2Q28A 1MX1A 3AB3A 2YXLA 3ANTA 4MWSA 2BONA 4CVNA 1UBUS 2VRCD 4UHEA 2QZPA 1RFGE 2I22A 2XQVA 3KJZA 1T4GA 1KYXA 3E18A 4M8LA 5J5VA 1P9NA 1WUYA 4NESA 3T5GA 2WMYA 4UCFA 1K7EB 2RG7A 4QFDA 3CX8A 1IY1A 1G4UR 4MJ3A 3WJ2A 4WECA 1YQWA 4AUEA 1JR2A 1Z17A 1XJ5A 1F6WA 2QG4A 2QJRA 2A0UA 2AA3A 2H59A 4RTPA 3KVRA 3SIWA 3PNLA 4J07A 4L5CA 4B32A 5C9ZA 1USGA 3PNBA 2P2LA 4PVDA 3RTCA 1V6SA 3TAUA 1K86A 1ZM2A 2H7XA 1IXSB 2IQ5A 1CY0A 1ZPDA 2G5TA 3G0OA 3PLNA 3ZE0B 1FP6A 2EZ9A 4IDHA 2UYGA 1J99A 1TZJA 4S1PA 1C9YA 3LBAA 1W85B 2FDRA 1OXKB 2J3LA 4K8OA 3IVCA 3MYRA 1FQWA 3AVUA 1K5DA 2QRHA 4FCTA 1Y7PA 4I1YA 4LDRA 2X0RA 4OJNA 3BIFA 2VUSA 5CH3A 4RPGA 1P2UA 3R3XA 2W2NA 3DBHA 3I72A 4NOKA 5CG2A 4O1IA 3FGOA 2G5CA 4G0MA 2NW6A 1ZNQO 3JRWA 4GMFA 4PLYA 4C4TA 4CQLB 3MQ4A 1Y8RB 1IY2A 4M7WA 5ES3A 5E7QA 3BMQA 5A71A 3FZEA 3MBKA 1P5ZB 4YJGB 1N2OA 3IHTA 4L3WA 4OLFA 2PLNA 4PZYA 3RAFC 1AVTA 2FHPA 3DBLA 4ACBA 5JSHA 2FP4A 4YTEA 3ANMA 1T4BA 3LKDA 1OKKD 1SPBS 5E9QA 3AEKA 1C8BA 2YDXA 1B16A 2QN2A 5JMOA 4WCDA 3JVUA 2ISCA 1E66A 3FAKA 4OU5A 3OMLA 3RSCA 2ZSKA 5KTKA 1U7WA 1UWVA 2HQSA 3O21A 1WUJS 3O8LA 4MQ4A 4MQEB 2GJKA 3TOZA 4ZI3A 1O57A 2V74B 1UDRA 3FF4A 3P2YA 4Z7QB 5L7WA 4KE6A 3EGDA 4OTZA 1P4AA 3RBZA 1KPIA 1NXPA 1UM8A 1Z07A 2HLDA 3KLOA 3OQ6A 3OC6A 4G1CA 3G9ZA 3ZCSA 1Y5LA 1JA9A 3R3UA 5L3SB 2J67A 2XCQA 1OC4A 4KR3A 3R5XA 3B9RA 3I8XA 4M0CA 3DZIA 4JSTA 4F9TA 3VYWA 3DS8A 1E9BA 5SY9A 3KPJA 1L7DA 1Z26A 3DDWA 3LC0A 2LRHA 4HDCA 1C9KA 4Z3DA 3ZX5A 4FW9A 1AKNA 2W6IA 1DAMA 1DWQA 5DK4A 5TEWA 5C35A 1GRNA 1UMDB 3E8MA 4IOKA 2Y0DA 3SI7A 3O94A 2RGDA 2C92A 2Y0EA 4DB2A 1Y3AA 4LYGA 4P7FA 3IUPA 5T64A 1KQFA 2RHJA 3MZ0A 4FXOA 4LNHA 2PYIA 1NL3A 4NJOA 4QFCA 4ZMRA 1UPBA 5I7OA 2X2EA 5JXJA 4ECEA 1JG6A 1UFQA 2EKZA 3K96A 3OZUA 2X0DA 3TD9A 2QN3A 5TT1A 1U0GA 4MWCA 3N76A 5SZJA 2I4NA 3BTOA 4S1OA 4H1TA 5H4GA 5HR5A 2YN0A 4DM4A 4Y2XA 3WJ7A 2BM8A 1JL3A 2PMDA 2VOEA 3AYXB 3CISA 4UMVA 4XDGA 1H4SA 5FLXA 3I2HA 3N0RA 1NN5A 1ODCA 1ZO8A 4TKZA 1BTOA 4NY1A 4JOBA 1GFSA 2HCBA 3CN7A 5CNMA 2GF0A 1I9GA 2YHIB 4FCWA 1W0KD 3T4PA 1ACJA 4B84A 1AA6A 4RDXA 1N2XA 3EJWA 4P4GA 1KJYA 3WO0A 1EXVA 3RB8A 1O58A 3IPRA 3SBOA 4ZK2A 1V7CA 4CXMA 1KP3A 3AI1A 4O4LF 1G5QA 1H6CA 4U2GA 3CQ9A 1X8XA 4LTDA 1MIHA 2XD4A 3EUWA 4MI1A 1T8TA 4REQB 3PFGA 1EGVB 1N9GB 5E9WA 3U26A 3CZAA 3MGKA 2JLCA 2ATIA 3FNQA 1Y4AE 2NG1A 4LI0A 4OO3A 4WEQA 1YIDA 2R3SA 2NXWA 2OUKA 1JSCA 3I8OA 1TQ2A 3IUBA 4BRZA 4BEBA 1TVKB 5ANRB 4ZAWA 1LBIA 3AWDA 3H5LA 5IH3A 4AJNA 4EP1A 4CI9A 2WMDA 1WNFA 3UC9A 4TX1A 1RDFA 3KLMX 1UAYA 3K92A 4ABTA 5LM3A 2HIMA 2PWBA 1DFGA 2IP2A 3GJ4A 2OMKA 3A3NA 4IEIA 4P3NA 3T3GA 5AFSA 5JSQA 1XJCA 4NF2A 4MJLA 1VFNA 3QVGA 4N5IX 5ENVA 5F77A 1E6MA 2R47A 5J2TA 2FSSA 4U9UA 3LP6A 3LXXA 3UOWA 4DR5B 1XGKA 4LTMA 1IEWA 2LIPA 1V25A 4IS2A 3PNKA 1HXHA 2XE6A 3NRJA 4YYEA 3CPSA 2K4MA 1V95A 3CEPB 2CXQA 1J9GA 1Y6JA 3H1FA 1TQHA 4FFWA 5EWLB 2VXOA 3HBLA 4ATNA 1Z6YA 3N1UA 4H15A 3BHNA 2JEOA 4Y9SA 5HF6A 4PG6A 3VR0A 1L3BA 5CG1A 4RTRA 4G0WA 3BXOA 3SNKA 5BN5A 4DV1B 1A4UA 2B3DA 2WT8A 3AB7A 1KNQA 3JAMA 1JAHA 4JC8A 4BNTA 5B1YA 3RVSA 1T5DX 2MSCB 2J9YB 3DOFA 3LBFA 1P2VA 3IOYA 4G23A 3OPYI 4BN0A 1YBFA 2H11A 2LV8A 4V0QA 3CURA 2W90A 3O1JC 1DINA 1YZVA 4PPQA 4BO3A 3OT1B 1JVBA 3OIYA 1T9HA 4UREA 3K0HA 3N8IA 1JG1A 1XD8A 3X3HA 4AN0A 1HWYA 1KO1A 5JY1A 2IYOA 3OQIA 1XQXA 2FCRA 2JIBA 2QK4A 3EGXB 2ZJ3A 3Q3GE 4DJJA 5EJMA 3DSRA 3PFKA 2VXCA 5L3RA 1UF9A 5L4SA 1GFWA 2P41A 2YZ2A 1T10A 1BVYF 1XZ8A 1JIIA 2Q1TA 4GYKA 4QEZA 1RR6A 2H1WA 5EIOA 1UXIA 2GK7A 3N6XA 4GSLA 3STXA 2V5VA 1EQAA 1WA5A 1PZGA 2VS1A 3VGPA 3WGVA 4P84A 5IYZB 3TSWA 4HUJA 1EX6A 3GD5A 1I14A 2NZ8A 2WJPA 3CH5A 4G4GA 4Y0NA 1Y9JA 3HGMA 2E3JA 1Y42X 1NN3A 3TAXA 4QM6A 2F8LA 4XYGA 1ESCA 5I4CA 2VHCA 3V80A 2ACWA 2BISA 3G9QA 1HSZA 4X61A 2FR0A 4IUDS 2A14A 4ND4A 3LHFA 1OHHD 4GMKA 1TF5A 3RJTA 2PJDA 4H1WA 2DFTA 3WADA 3CZ5A 5LBIA 5FI1B 1WRBA 3ZGOA 4DEXA 4Z4CA 3W5JA 2OFPA 4CCYB 1V2HE 3LGXA 3NHMA 1J5PA 3IB6A 4NBVA 2PCJA 1V16A 4AKGA 3LDAA 2QPLA 1ZM7A 2IYTA 1A96A 3IXMA 4HNAA 4XM2A 1D09A 2PSFA 3EVNA 1JFRA 3GRRA 1Y4DE 2XWPA 3PDUA 4LK2A 4RIIA 1YUBA 4R71A 5CFNA 4W5QA 4IGAA 4OAOA 2DM6A 4Q9HA 3C3KA 5J59A 3E1SA 1IE3A 1RXCA 1T8UA 3D6AA 4B7CA 5DM2A 5L7TA 4ZCIA 2QRVB 4RQAA 4WKCA 1YTLA 3PA8A 3DZGA 2CFCA 5BXQC 2QN1A 2NMVA 1CRWG 2BELA 3O8NA 4XWYA 3QLUA 3ZZTA 4QJBA 2UVPB 4MZXA 4X95A 2DR0A 1M2VB 4TS9A 4QEDA 1M6WA 1UKAA 5FHQA 4BWFB 1KAMA 1XAHA 3JQ7A 1L5VA 2P90A 2XOEA 4Q7EA 2PPVA 4DKXA 1PF7E 1SXQA 1DC6A 2FE1A 3SR4A 1OREA 2VTKA 2EJWA 2PNFA 3I42A 4K0KB 2V7XA 5AK3A 4DMMA 2X0FA 4GC5A 1JIVA 4OBEA 2QLLA 3CF4A 2NYAA 2G77B 4DLLA 2F3RA 2R1ZA 1FA9A 3SJ7A 5G0SA 5F76A 2BEWB 3HG7A 4B4VA 1ZI6A 2WV7A 2C7GA 5DGXA 5A62A 3VR4A 4BGDA 1N33B 3N2KB 3OOHA 4ITRC 3OFND 3U7JA 3VC7A 3AM1A 2ILVA 1RSZA 2C7BA 1VXRA 2WU0A 3VYVA 2FRVA 1HLFA 5A4IS 1L4UA 3PR1A 2R6R1 4LY6A 2CXHA 2WOOA 2ZT7A 1DQYA 5DBEX 3NZEA 2HPAA 1RRCA 3NPMA 4Q3KA 4TRMA 3W5BA 3U4AA 1J7KA 4GWKA 4OSEA 1VPWA 3DZHA 3TS1A 1XCMA 2HJWA 1BKSB 2H1LA 2QVYX 2OK8A 1TD9A 4J9VA 3MELA 4YT5A 3CT4A 2QLBA 3RJMA 4C0LA 2L18A 1W0JD 2ISQA 4PM4A 3G2PA 3BL5A 3P5SA 5AI0A 4DEYA 3A70A 3G59A 2JJ8A 1F60A 1QV6A 1SD2A 1U6KA 5C1DA 3DOEA 5KX5B 5DX8A 2AXEA 4BO2A 1Y1RA 1TIBA 3TTTA 3HL4A 1E9DA 2A7QA 1FYXA 1EG7A 1RABA 1T1RA 3H5WA 3EASA 2Q4BA 3JU3A 4PXSA 4S1TA 5KJFA 3SYLA 2ONZA 5JEEA 2XV1A 2G63A 3P7MA 4UFOA 4B6PA 3PPVA 1KH2A 2PTGA 4LXXA 3BGVA 4Q24A 5D01A 5BVHB 2JH3A 5IAAA 1DRWA 1BQEA 1BXGB 4Y9DA 4M8SA 1FC0A 2VDOB 4H17A 3UOGA 4HB0A 5TJHA 2HR1A 4HB2A 2QR2A 1E1RD 4F1JA 5ESWA 1TJ5A 2ZBPA 4WXEA 1Z2OX 1H2FA 5M04A 4GX0A 2AOUA 5ED4A 2V98A 3EMDA 4Q3OA 4LJ5A 4PYRA 1BN7A 1ZJYA 2D5IA 2PFSA 5A7GA 4A10A 1VLZA 4OB7A 1SIWA 2E48A 1ZCAA 3Q3VA 4TRRA 3WWZA 3ZXUB 1GPYA 1ZRNA 4P2GA 2W2OA 4KKXB 5BSHA 2X8AA 1D4FA 1Q0LA 3OESA 4KXMA 4QOFA 3U7IA 3MF4A 2FX2A 4KLNA 4LXTA 4B6JA 4ZIRA 2RIPA 3U17A 2I3AA 1QZXA 1XEFA 2PVPA 3IRVA 4RTKA 3O47A 4IVNA 1Y82A 4W8HA 521PA 3V8MA 3D3JA 2G17A 1JHDA 4QYMA 2J08A 3D4OA 1C3VA 3DO5A 2Z1DA 2FMXA 2ZE8A 2BGJA 1YJAA 3EFBA 5EXTA 2A9FA 4YGYA 1XTRA 1QNFA 5G1PA 5AXDA 1DQPA 1DRUA 3U7EB 3FKSD 4GYYA 3RVMA 4E94A 4NEQA 2PKWA 2PU5A 3KSRA 4AG5A 4D8XA 4WKNA 3BRCA 1WTAA 1P6UA 4Q9DA 1OX5A 4F3YA 4C01A 1H85A 1WW3A 4YALA 5E9AA 3BDVA 3MS2A 3D4NA 4D4KA 1W85A 1J0BA 3KEOA 4EW1A 4M37A 2IP4A 3V8PA 1PN3A 5CHYA 3VOSA 1NQOA 4OHXA 2MSKA 5KPJA 2YJ3A 3LLSA 4G0XA 4I6EA 4RFLA 4WTOA 5JAMA 3O8RA 4CQLA 3OM1A 2AE1A 3P0HA 1Z7WA 3VZRA 5KTRA 3PPXA 5DJ5A 2Q2QA 3Q7PA 1QHHB 5ECYA 2XGJA 1PK8A 2VDWB 4DQKA 4ND8A 4Y6LA 4IHJB 4M0FA 2AFIA 2PQ0A 4X3OA 3FDZB 4ETWA 4J7XA 1RQLA 3GZNB 4ENUA 1ZHOA 2HKIA 4GP9A 2C7QA 5HKKD 5JWHA 2QVCA 1VRWA 2X86A 3GWZA 4QUEA 1IZ8A 4M0LA 3UFXA 1PGJA 2EBWA 2PT5A 5EZYF 3E3NA 4ENWA 1SVSA 2E5FA 4YQYA 2HUNA 4QYIB 1NNEA 1W0CA 2E37A 5EMMA 4CKCB 3WLRA 2G70A 3PWTA 4MQEA 1L1QA 4A0RA 1EWYA 4EJSC 3H99A 5KOJB 1AV7A 4QOEA 4D0RA 3V3TA 5ECGC 4GXRA 1UFOA 3QJ5A 2QVZX 3VUEA 5G0UA 3BMNB 4RPHA 4N9QA 2EF0A 4UBJA 4WGFA 2YN2A 3F78A 4QUHA 1GYPA 4P0TA 5L3SA 4XWKA 2A5GA 4RL4A 4Q9LA 4GSYA 1Y1PA 4QFMA 5JXWA 2A3NA 3EDRA 2GCNA 3IMEA 4HGQA 4AULA 4DSOA 1LC3A 4MUKA 2OXRA 3QSYA 3NO4A 1P5RA 2GF9A 2MMCA 2JLQA 1GSIA 2YHAA 1HI9A 4MVXA 5F2KA 3ZJVA 1BH6A 4PZPA 4Y2HA 3EDCA 3PL5A 4A8JB 1PS9A 1R4MB 1RU3A 2BN4A 2D00A 5KVVA 1YQ9A 5LU9A 4LZZA 3UV7A 4M22A 4P4UA 2QE6A 4MUXA 4CEIA 4D9GA 1LZLA 3BGOS 1QZTA 5TSDA 2WIBA 3H3FA 4R8VA 1GA4A 2Q3LA 3K0CA 4O8CA 3ENVA 4HDNB 2V7BA 5TEVA 4K9LA 1E2HA 1HM5A 3PHLA 4UM9D 1U2GC 5FPTA 4DDKA 2HU5A 1O9HA 4L5BA 4CU2A 1QPZA 3GEPA 4TYQA 1TMOA 4QAJA 3E7PA 4R9RA 4QC2A 4UTOA 3V34A 1KHHA 4HKTA 2O7VA 4CKZA 4GH5A 1UINA 1RAFA 1ZD5A 2PKQO 3X2EA 2WD7B 4R8KA 3VDXA 2X3FA 2P8SA 2R5WA 5B4UA 2C5LA 1VSBA 2A9QA 2RCNA 5IC6A 4CIAA 5IFKA 3UHAA 3CLRD 3LU1A 1E62A 4ZOAA 4C0HA 1Y98A 3M4XA 3OKAA 2V6GA 2ECFA 2P91A 2P0AA 1QHYA 4JLJA 5IWAB 3TLXA 3TVTA 5ITZB 1H9AA 2Q21A 1A5BB 4MI6A 4K28A 5CU7A 4AMYA 3OA0A 3C5EA 4EL5A 1LSSA 1CQZA 3ZE6A 5A4DA 4J8PA 2OAQ1 1XKXA 4EZIA 4ZHQB 5AIAA 2H7CA 1THMA 2H8KA 3EEBA 1M0TA 5KQGA 3EYWA 3R6DA 2WEKA 2QW8A 1EHIA 1U0SY 4PYNA 4WLEA 4WUVA 4ZEOA 1Z4OA 4NCJA 5KNBH 2QTLA 3B7PA 4MYUA 4ECAA 4G24A 3IURA 1B0UA 1T2DA 2OY0A 2ORYA 3KOUA 4JB2A 4EMBA 1N5JA 2BHRA 4N5LA 3AR3A 1YRWA 2WPNA 4W9NC 1CUCA 2ZSUA 1IUPA 3IT0A 4U7TB 3B5JA 4XE5A 5CEJA 1FYWA 3SIRA 3ZDYB 4B3DA 5BRNA 2H51A 3HDYA 5JTTA 1O5TA 1UJ6A 1TVKA 3NFYA 4OREX 3TTWA 2FWNA 3ZVLA 2GYYA 3HTXA 3KK0A 1QRAA 3RKSA 3NJ4A 1KEEB 2Z57A 3H1BA 2B8EA 2JGFA 2W2TA 3EXHA 5JNUA 3CA8A 4O2AB 4NABA 3ZE7A 4BWGA 2WD9A 2I7TA 3G2OA 4YDRA 1D6NA 3ULKA 5JAPA 3OOWA 4D8WA 4UAUA 4D56A 4JA2A 2O8FB 3DLBA 5AYVA 3DW1X 3LSTA 4ZKEA 4KIWA 1V4NA 1RWQA 2W6JA 3L7KA 1G9XA 1RD4A 2YASA 3R0JA 3J7AC 3SQDA 4ZI2A 4CIXA 1PFKA 2IUSA 3KQMA 3TUJC 3UXMA 5CA1B 2OFFA 2XB2A 1JR3A 5H59A 3QVOA 2WUEA 2OV1A 3FTNA 2JIQA 1K4MA 4QLBA 9LDTA 4H1HA 1M6NA 5B57C 1M1NA 3DF9A 1JA0A 3OZSA 4LXQA 4OQDA 4B48A 3ZC3A 1G6Q1 2C5AA 4HQ6A 4Z9FA 4ZRNA 5TQVA 2I4IA 3BQMB 3AF3A 3OT1A 1OV6A 3DXFA 1DS6A 3R40A 1ULAA 2I6QA 3D59A 4X6UA 3IOCA 1W5TA 1ATZA 1Z6ZA 4WUTA 3W5UA 5FWXA 1LDYA 3F1KA 2FPLA 2QRUA 5AKEA 5I6DA 3EGXA 3VMMA 2ZYHA 5DNUA 4FMDB 2O2JA 1YRQA 4BDTA 4RLFA 2WAOA 3DC7A 5KB3A 3L6OO 4HXEB 1KQNA 3COPA 2ZIXB 2Q46A 4AZVA 1XJWA 3MWDA 2C7OA 3TTUA 3BFKA 1E2PA 4KDFA 3SC6A 3BS4A 2OM6A 5IYZA 3B51X 4C4ZA 1ONPA 3D3WA 3NUQA 4G5FA 1IXRC 2JS7A 3A6JA 5G0VA 4QBGB 3ZPXA 1R5JA 5KSOA 2GSWA 1KDRA 1KRHA 1HUQA 3X1MA 3MJDA 1KIFA 1YVDA 3FCOA 3L8HA 1Q95A 3NHJA 3Q40A 1TO6A 3IP6A 3NHSA 1AF4A 4LRTB 4L28A 4JYBA 4TRJA 2JGAA 3K0EA 3QRWA 2XCRB 5TXGA 5ALDA 1OQAA 1YHZA 1N6IA 2JH9A 5LLSA 3T9AA 5B4VA 2J9GA 1Z38A 1TVCA 2MYTA 4N01A 2B8JA 3G79A 4WXYB 3CSSA 2LWIA 3PXCX 5JXGA 1DO2A 4IKOA 1G9SA 3A58B 3JD4A 1KDYA 5FHRA 1YFZA 3ZHVA 4DMUB 4CIBA 1X8LA 1YRAA 5AOVA 3CNHA 2HGZA 5BOVA 3GLGB 4ENSA 3WJAA 3BB1A 3RBXA 4P58A 1J90A 3BAZA 3L7LA 1R8YA 1JZQA 3DYIA 3OSZA 4BLOA 2B7LA 1AG9A 5HIAA 2NPOA 3U0BA 4KYVA 4GDMA 3PNMA 3UQZA 1P0MA 3VRHA 1Z4JA 4RS4A 4RD3A 1YR7A 1AK9A 5JZBA 3RUIA 4JWTA 4DNFA 5JJIA 1PWXA 4J49A 4J2TA 1U3UA 1HBJA 1IM5A 3I0MA 1UOQA 3GP8A 4QDOA 3SHVA 4EG7A 2EFGA 4DR1B 4HFRA 5BNIA 1FDUA 2XCOA 2D74A 4AF6A 3BULA 1EUQA 5ALSA 5FTMA 3S2ZA 2WWRA 3JAWA 2CSXA 4MP6A 3RAGA 5H0IA 4NE2A 1KDPA 3IBCA 4Q1DA 1X3SA 2EJCA 4L3VA 2GWRA 4YP6A 5THXA 2BEWA 2C0PA 2ZR7A 3SOPA 3I5XA 2CVZA 3QFTA 3KKEA 4JNCA 4QBKA 3N2KA 2ZULA 2JEYA 1O97C 1B2RA 2O2HA 4K9RA 3ZGVA 4BEJA 4EZBA 4AP9A 4K26A 4RVFA 2WSSA 3IQXA 1DB3A 5AVJA 3MERA 5C18A 5JJBA 1TCUA 2JKYA 3OKPA 4K6GA 3W8NA 2XGOA 3CSUA 3QVTA 3FMGA 3O7WA 4PAGA 2ZW9A 2B37A 3QX8A 2VF4X 1AKMA 1FU7A 2QS9A 2OYCA 2A0WA 1WVIA 4LNAA 2D0OB 4OJTA 1FY2A 1YV9A 5AW7A 4DGQA 4NDAA 3D0OA 4R5HA 2P6RA 2A67A 3QLVC 3U3RA 6ADHA 3Q8MA 3RTEA 4E5YA 2BMFA 2FKAA 1RTKA 4ZXFA 5JDIC 2EIHA 1E18A 3ZTTA 2B1RA 1ZM9A 1U6IA 2GOYA 3N53A 4HUQA 3ANNA 1TJ4A 1NZFA 2AMJA 2FPWA 3LFHA 4L75A 4NR0A 3IMFA 4DWWA 5BVHA 1KEWA 2Z2XA 2GPJA 3MRTA 1HX7A 2CNNA 5JC1A 1ILEA 2Z98A 1YHNA 1O5OA 2XRZA 1JFFA 5HIJA 4YT4A 3F9IA 3V7NA 1DKUA 2ACVA 4IQFA 2YX1A 5AVOA 4R81A 3PEYA 3VV3A 4EA6A 1P4JA 4KODA 3FD8A 1PVVA 4ZT4A 3QUCA 2LNDA 3ZU2A 5CFOA 4AO7A 5HG0A 3TJRA 1TC2A 2E4ZA 3UB3A 3MW8A 3WBKA 1V8DA 3EGVA 3I2JA 4JGGA 4LKRA 3FBWA 2GVDC 2SICE 1RZRD 1KI2A 1V9LA 1L5NA 1CXZA 3IT1A 3LIPA 1K4KA 2Y71A 3WRYA 3RS3A 2GNOA 3VZQA 4D9NA 5J2UB 5JNWA 1Y3IA 5K8VA 5L6MB 3ZHXA 3G82C 2FDCA 2Q62A 5KYYB 1SKYB 3LFUA 2WICA 5IBCA 3K0SA 3AEXA 2IXDA 1C4KA 1RE0A 3F90A 4JBXA 2Z9DA 1T5TA 3E1GA 4MDHA 5BR4A 4DSAA 4S04A 2J9RA 3QU5A 1NN1A 2GZDA 3SIXA 1M5RA 3FOCA 1W36B 4CGZA 1QG4A 3AR8A 4G8DA 4E51A 3QMVA 3BF8A 3CWQA 1PJ2A 1EDEA 4ZAZA 1O0SA 4EL0A 1HZZA 2JD0A 2EQBA 4G5SA 1YE5A 4LYEA 3HWWA 1N1EA 2O06A 4ETIA 1DRJA 1TC1A 2I3ZA 3KKPA 1Q44A 3SBDA 1T2VA 3Q98A 3HM9A 4DIOA 1ZXXA 2R84A 2P0YA 1E92A 2X6RA 1WKBA 3Q3JB 3OHPA 1NMYA 1QHHA 3IP9A 2NUAA 3DMFA 2BCJQ 2VDWA 3K8OE 3NIDB 3GEHA 3UM9A 1E1KA 1QLWA 4MGYR 1EXMA 2BBOA 1DG3A 4CQMD 1QFJA 4M1OA 1QKJA 1Z45A 3GZNA 3PR2B 5BR1A 4KRFA 1RQNA 3GLFB 1IHOA 5BW5A 4RZHA 2OHHA 2WLSA 2I2AA 221PA 3M3PA 4O59O 3MK31 1LPMA 2FWJA 2Q1WA 2R68A 2JI4A 1I4EB 3HXOA 2HQ1A 1W9MA 1L7AA 3GJZA 3QTBA 3RVNA 3EF0A 3N0WA 5I7UA 5KOJA 2AEFA 4MKHA 4XCVA 2FZGA 3S2GA 4HH3C 3WIVA 2AQ8A 3BMNA 1FFEA 1N5LA 3S8MA 3R23A 5IULC 1WZCA 2A9PA 2BEVB 4L57A 4KPGA 1DCMA 3W9UA 1ISPA 5ERXA 1C7FA 3U4DA 4R68A 3QE4A 5IJ9B 4RYLA 4Q9KA 2QZJA 1XMVA 4HQNA 4BZXA 4BQNA 2OO3A 3WHLA 2R1TB 3MWGA 4HPXB 1OOEA 2XXJA 4Y0VA 2NTVA 2OYRA 3UGQA 4A8JA 1EJBA 5IHPA 4AK9A 4O25A 5LQKA 3VKHA 1KAEA 4A15A 4MCIA 5ARBA 1MT3A 1N2GA 1OA1A 1U0FA 1K3TA 2KJQA 1N78A 1ZQ9A 1FDVA 2WIFA 3FSEA 3R5FA 4X91A 1JEAA 1E9EA 1QR2A 3SM3A 4PAQA 4HDNA 1IC6A 3ML1A 3OOSA 4C4YA 5BORA 2FH5B 3Q2OA 1XZKA 4LY9A 2BGUA 1DC4A 4B3BA 3EVZA 3AR6A 1RYEA 4CF7A 2BM1A 3IDFA 1MRNA 3WNDA 2VT6A 4IOLA 4ZTZB 4HB3A 3CPHA 4LYDA 3ZU3A 2C04A 3JQ8B 4GPTA 4R9UC 4V3BA 1WB4A 2JAUA 4V0KA 2WKPA 2QAGC 2CVHA 1ZNXA 4ENRA 5ALOA 4H6XA 1D6JA 3ABZA 3RGWS 3VBEA 4ZYTA 1P1JA 1TU0A 1XXLA 3OZWA 1LW7A 4RDCA 5ITZA 5JO0A 1XQ6A 3RC1A 1ISGA 1FS5A 1VPLA 5CVUA 3ND9A 4GMGA 3WG9A 3ZGLA 4CKXA 4ZHQA 3A3PA 4KW7A 1H0KA 1T9BA 1UK7A 3BICA 2FJUA 4PAOA 4ZZ1A 5JNSA 1DC8A 1DPFA 4BN5A 1U7DA 2FE4A 4IQGA 4YJ3A 1H2ZA 4CMAA 3PT5A 2VO1A 1ENOA 4MVYA 5KVQA 1BRMA 1JTFA 3R7SA 2JGJA 3GY0A 3COSA 3PQFA 4MRNA 5LP6C 3AR7A 1SR8A 1FMCA 1YA8A 1JR3E 2BMEA 2PBLA 3A1WA 3BG5A 4JBHA 3NYRA 5GVRA 2Y9MB 5G4LA 1L4FA 2VJLA 1ATIA 3TTVA 1XNQB 4I7EA 1JAZA 2LDXA 1D9XA 1GQFA 1ZAKA 2H4XA 3O8BA 3X1XA 4C20A 1A7AA 2OR3A 4RQUA 2B21A 4MAMA 4EYGA 2BW0A 4IHQA 3DHVA 3O90A 2OT3B 4LZOA 4LF4B 3I9V6 1NVVQ 1R9GA 3WIDA 3QE0A 1MO2A 2IV3A 3O7MA 4KV7A 3UJAA 1BS9A 1U98A 3ZLVA 1JIJA 5DSZA 4RMGA 2ONJA 2WWYA 4POOA 2X1LA 4JNKA 3ZG6A 1MB0A 1WAMA 3MBIA 4G0OA 1I5RA 4PLTA 4OXKA 2CCJA 1C30B 1SOVA 1SMKA 2J5XA 1EJ0A 2XVXA 4OYRA 4DR3B 3OCYA 2O8FA 5JWRA 3NM6B 3KZNA 1QIKA 1SJ9A 5FUXA 3I4LA 7ADHA 1JA1A 3HJGA 4KI0A 5DGTA 3OEHA 5TRTA 3SFTA 1HT1E 1VHDA 3QEOA 4JEHA 4PZ9A 2J0SA 3B1JA 4GP7A 4IX1A 5CA1A 2AYXA 4P7JA 4HVCA 1X7WB 3WGMA 2JVJA 4UEOA 1A5TA 1DX4A 1MABB 3ZHOA 4IFBA 5JCOC 5C8YB 2RGNC 3RHFA 1D8TA 5K0TA 1EK0A 3VAAA 1ZISA 4MR9B 2DPXA 2F8MA 4ZXPA 2R97A 1OI4A 4FKZA 5CCXA 5IUKC 2NM0A 1JALA 1SXPA 2W43A 5CFRA 4J1SA 5FJIA 1M2HA 3VVBA 5GV7A 1BW9B 4TGLA 1QRDA 3TF5A 4V0MA 4LE0A 2ZIXA 3H9QA 1ADGA 4W8OA 1ECJA 2BI8A 3G13A 4EX6A 1QB7A 4INOA 5A2QA 1UIRA 1N5IA 3I2YX 3VR4H 3TB6A 2JBAB 4OI1A 5KTPA 1FDTA 1PO7A 1Y7LA 2YMLA 4IZ6A 2GEUA 4FDLA 1CYDA 2DFNA 3A1CA 4MKZA 2XBMA 4Y2UA 1D2RA 3ZCVA 2OCAA 1ZH6A 1U1EA 3D0RA 4GQBA 5AJXA 1WUTA 2G28A 1VLLA 1W4AA 4NL4H 5KNBD 2JGLA 4ICIA 3REQB 1ECBA 3ZWQA 2N1MA 2E4UA 2FMUA 2X8JA 2P40A 4R1UA 1EFUA 3BKXA 5AMXA 2PLWA 3QU7A 1VL0A 4R2WA 5EOVA 2DETA 4X94A 5F2NA 3D6UA 5AIBA 5AVSA 3RSOA 2I3DA 3AG5A 1R00A 1CQIA 5JCJA 5ELXA 3BTUA 4NK5A 5K0CA 2Y1XA 3GLGA 4CEJB 1YQQA 2OGUA 2H1HA 2PUWA 3P9RA 4AJ1A 4CDNA 3WLAA 4HLNA 4L08A 1ST2A 2WKQA 4RETA 3ZXIA 4FQ5A 3HC7A 5EESA 4WXRA 2ECKA 1JBEA 3AJEA 4QTZA 4Q82A 1ID1A 3QTTA 3HXLA 2Q6VA 3ND8A 1IHPA 1KZ6A 2CZCA 1VA5A 1GITA 1E98A 1FDSA 1P6QA 3LX5A 4RKEA 2R1VB 1YOBA 1HDXA 1WPGA 4PLCA 4LX0A 2ZP1A 1A9ZA 4H59A 5FUMA 2V8BA 2Q5CA 3PDWA 4I50F 1SVOA 5EXSA 3R3JA 2PVCA 1GGVA 3GFPA 4EB6B 2E4WA 1QFXA 1FYVA 4PO3X 5H5JA 1AGPA 2ZUSA 4WK4B 2JFZA 3UMCA 3F4LA 4B17A 5BW8A 3N2YA 4KFTA 2IYVA 2NT3A 1YAJA 2M98A 1FUIA 2XVYA 4XX0B 5LZ5A 1K6MA 3EIHA 3F8WA 1PQPA 5IF9A 1CDZA 3L8FA 2ATVA 4TWAA 4QICA 5TF0A 3QXJA 3QOXA 4XXHA 5AI6A 3MWFA 4QO7A 5EIBC 4D92A 1BWSA 3M1YA 2C4VA 1ZH8A 3CLHA 3R6TA 4QU0A 1G3IA 5T5QA 1P31A 3VNBA 2JH8A 4RK1A 1G18A 4KX5A 2QI9F 2O0MA 3B3AA 1V11B 3MCZA 5EUQB 4NLLA 3ZHTA 1SKQA 1RRPA 1YZFA 3ZR4B 4ZGWA 3JALB 4JJGA 2JKVA 4IJMA 5JQWA 3ICQB 3AHFA 5GGYA 4LQLA 4EG0A 2NP7A 3BGWA 3PDHA 3CFYA 2GGSA 4R41A 3GK3A 4CJXA 1GV1A 4Q9AA