5A1TA

Trichomonas vaginalis lactate dehydrogenase in complex with nadh and oxamate
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
331
structure length
331
Chain Sequence
AAHVLITGAAGQIGYILSHWIASGELYGDRQVYLHLLDIPPAMNRLTALTMELEDCAFPHLAGFVATTDPKAAFKDIDCAFLVASMPLKPGQVRADLISSNSVIFKNTGEYLSKWAKPSVKVLVIGNPDNTNCEIAMLHAKNLKPENFSSLSMLDQNRAYYEVASKLGVDVKDVHDIIVWGNHGESMVADLTQATFTKEGKTQKVVDVLDHDYVFDTFFKKIGHRAWDILEHRGFTSAASPTKAAIQHMKAWLFGTAPGEVLSMGIPVPEGNPYGIKPGVVFSFPCNVDKEGKIHVVEGFKVNDWLREKLDFTEKDLFHEKEIALNHLAQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-LACTATE DEHYDROGENASE
publication title Gradual Neofunctionalization in the Convergent Evolution of Trichomonad Lactate and Malate Dehydrogenases.
pubmed doi rcsb
source organism Trichomonas vaginalis
total genus 109
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2015-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5a1tA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5a1tA02
1HDOA 5C7LO 1TLTA 3IKVA 1NHWA 3GMSA 3VDQA 3GHYA 3NJ8A 4J3FA 5U4QA 2EGGA 2V6GA 1IULA 3L77A 4R5HA 3G79A 3AOEC 3H2SA 4ND5A 3UGKA 4JP3A 4JQCA 2X1HA 1C0LA 3NT4A 1YVEI 3TZCA 3U4DA 3FSRA 4PZCA 2ZB3A 3OIDA 3OICA 1DC4A 4RLHA 2W2LD 2UVDA 3MTJA 5G0TA 1RPNA 1W4ZA 1Q7GA 3FRJA 3ZH2A 2PGJA 4NJMB 2Y1CA 1ZNQO 2DUWA 5TF4A 3ROMA 4MVJD 1LDNA 4BO1A 4YAIA 1XYGA 5HS6A 2PY6A 1U8XX 4H3VA 1IUKA 3C1TA 1H6AA 3E82A 5LCXA 3MTGA 3GY0A 1BVUA 1WDLA 4IIUA 4NFHA 2EG9A 3JQGB 2FN7A 4MP3A 3I9MA 4ALIA 3ON5A 4B8WA 3CTMA 4P8RA 1N8KA 3VVCA 4DC1A 4WLOA 4NBWA 2CD9A 1FXSA 4RPHA 4CMEC 1BXZA 3GNSA 1JKIA 2OBYA 3I6IA 5A4DA 1N92A 3C8MA 4WNCA 5EIOA 4OKNA 4NJMA 3PQEA 2RH4A 4OOEA 1KYQA 4AJ1A 2I67A 4XYGA 2OGUA 3PGXA 3PIIA 4AJKA 2ZTVA 4CM7A 3ZGYA 4HY3A 2EERA 2C7VA 3QWAA 3VTZA 3JQGA 4EI2A 4BKQA 4PRKA 2I5PO 1LX6A 1VRWA 4CMIB 3B70A 1GCUA 3ZV4A 2GDZA 3VDRA 3KEOA 1IHXA 1QLHA 3F46A 2X4GA 2HCTA 3JYOA 1UDBA 5TT1A 3SLKA 2PD3A 4WPGA 5JLAA 1LRJA 1V3VA 4KUEA 3NDJA 5T67A 4R1SA 3WICA 3QVSA 5CHEA 2AEMA 2Y1DA 3OJOA 4AJOA 1BRMA 3DZKA 4QT0A 3M1LA 5DOZA 1ONPA 3CZMA 3FR7A 2NU8A 3AY3A 3PFWO 1C3VA 1UZNA 2VT3A 2VUTA 2QIOA 4ZQBA 1R4MB 3CXRA 3Q9NA 4P22A 1EE2A 4W4TA 3GGOA 4PG4A 3CSDA 1H2BA 3E48A 1VJ0A 3MJVA 1K5HA 4CMIA 2I76A 5ER6A 1KVRA 4OL9A 5ER9A 2WMDA 1NQ5A 4EBFA 1YJQA 4TQGA 1ISIA 4Z0TA 3CUKA 1LLDA 4IJVA 1L7DA 3JQDA 1NR1A 1X1TA 1HL3A 1HWYA 2B37A 4FGSA 4PLZA 3SVTA 3JQ9A 1E7MA 1U3VA 2X8LA 3PDUA 2E49A 3AJRA 5BSFA 3Q6IA 1QSGA 4J7UA 2AQIA 1XU9A 1VI2A 4WK6A 5JO9A 1R4MA 2YY7A 4HV4A 4NPCA 1NX6A 5L95A 4FFLA 4BO8A 3EGOA 1E0DA 2SCUA 2Q4EA 3DOCA 1SB8A 3L9XA 2TMGA 1BG6A 5JBIA 1ZZEA 1P31A 3S55A 1ZSNA 4U8GA 4GSKA 1PJ4A 5EL0A 1B8UA 5EN4A 1EUCA 1AUPA 1ML3A 2D4AA 2HUNA 4WE3A 1GPJA 2AXQA 2VWPA 1WLYA 1UXKA 2PA3A 5K9ZA 1TVEA 2JD2A 4BNWA 4OJNA 4YR9A 2QRLA 1QYVA 4RZHA 2WYUA 5KJFA 3F9IA 4XDZA 4DVJA 1QR6A 2JAPA 4GMGA 3IS3A 4BGEA 4M8SA 5AQ1A 1PIWA 2HMTA 3TOXA 1XU7A 3CINA 3OQ6A 1GUFA 3K9QO 3WIEA 4BNNA 5ADHA 4CV0A 4BO0A 3JQ6A 5IDQA 3VC7A 1Y81A 3KTDA 1P1KA 3PP8A 2DKNA 2NTJA 2QZZA 1IPFA 3TQHA 2VHXA 5KVSA 3I9JA 3DZIA 4PLWA 3GVPA 2PV7A 3WB9A 4FR5A 5G0VA 5C37A 2XXBA 1I3LA 2P4QA 4LVCA 2HMWA 3WGIA 3NT2A 4MVJP 1MP0A 2FR0A 3FN4A 4EW6A 2CDAA 3CPSA 4NQZA 5G0SA 3H7AA 2Z95A 3INRA 3KXDA 4QECA 4WCFC 5BSHA 3BTVA 5L4LA 3DBVO 1Q0LA 4J1TA 4DBVO 1PJ2A 2VHWA 3JQCA 1E3WB 3JSAA 3W4JA 4CLOB 3JQFA 4UEKA 1GUZA 3VKVA 5JO0A 5JDIA 1E7WA 2BGKA 1HE5A 1Y8QB 3AUSA 1FMCA 3GOHA 1S6YA 1A7KA 4AJ4A 2EKPA 4OMUA 3CZRA 4RV9A 3QQPA 1JTVA 3I4FA 1NFQA 2ZYDA 3WBBA 1XQ6A 4HADA 1PJLA 2CY0A 2P5YA 4FC7A 1QYCA 2WJPA 4FD3A 3V8BA 3O26A 1SB9A 3I3OA 4LK3A 3ZWYA 3PWZA 1U5CA 2BMAA 3JTMA 3WBFA 1K2WA 4HWKA 1U3TA 3GHHA 4CMBA 5GY7A 1IZ9A 1H0KA 3GDOA 1E3WA 4CLOA 1M67A 1UAYA 1LSOA 3ZZNA 1DJNA 1NVMB 2GLXA 1HETA 2A35A 1Y8QA 1WZIA 1DEHA 1EUZA 4PIVA 3GDGA 1T1SA 4BVAA 3LT4A 1DIAA 1JQBA 2IZ1A 3BTOA 4ID9A 3QSGA 5JAIA 5AXBA 3K31A 2H1SA 1HDRA 1EVJA 2BLLA 4DQUA 1OBFO 2IEBA 5CAEA 2Y1EA 4BO3A 1NVGA 1ZEMA 5FEUA 1C1XB 4GH5A 3ZU3A 2GZ3A 1ISFA 3JQBC 4IZHA 1G0NA 4OOFA 4ZJUA 1GEGA 1ZK0A 1YE3A 4B7UA 5DZSA 4I9NA 3CIFA 4MIEA 4ZD6A 2JFFA 3V1TC 1DXYA 2E6UX 3WOHA 5B1YA 1C0KA 2AQKA 4FC6A 4P38A 4YJHB 2HKIA 2ZKLA 3OA0A 3S2FA 3STHA 4AL4A 1ZXLA 4Z0HO 2HK8A 3O03A 4LRSB 5AYVA 2DUUA 3C1AA 2Q2VA 5KWEA 3TZQA 3C1OA 1XA0A 3AUUA 1LLUA 3DL2A 4R1NA 1BMDA 1ARZA 1C1XA 1M6WA 2X0NA 5DDIP 1AE1A 4TVOA 3GEMA 4TZTA 2YFHA 3HSKA 5T8KC 1XG5A 3DTYA 2BF7A 4R4JA 3TZHA 4E13A 4G65A 1YB5A 3UICA 1LLQA 1GZ6A 2F1KA 1IZ0A 1HLPA 4YJHA 1QMGA 4ALKA 2O4UX 3AU8A 5K6AC 2GF2A 2QZ9A 4XEHA 3RFVA 1ENPA 1RKXA 2OBNA 4I5EA 2FSSA 2BFOA 1QKIA 5JY6A 5JAQA 2V6FA 1ZO8A 2D59A 4HP8A 4J1NA 3R3JA 3ABIA 4GX0A 2ZJ1A 1U8FO 4WECA 1NTOA 1UDAA 4JJFA 2ET6A 3A14A 4JXKA 1LUAA 4CQMB 2VHVA 2XPCA 4G81A 3OHSX 3ZU5A 4HFMA 4AJEA 3DHNA 4U6SA 4DBZA 1PWZA 2DLDA 1D1TA 5A9SB 4FBGA 3UFXA 4MINA 3W6ZA 5IZ4A 3PJFA 3ZWAA 3KSZO 5F3RA 1O95A 3DBRB 1I33A 4OYRA 4R9SA 4CR6A 1JKJA 1HLDA 1VKOA 4J91A 3TRIA 1R16A 3NKLA 4I8XA 1E3EA 1T4DA 4UUMA 4BMSA 1E77A 1P74A 1SC6A 1HYEA 3S2GA 3NJ4A 1U7HA 1HZZA 1HF3A 1A27A 2AE2A 1Q7BA 1NXQA 1UXHA 3E9QA 2Y05A 3INGA 3JD1A 4BGIA 3NTRA 3ICPA 1OI7A 3WR5A 1PSDA 4D44A 4HNGA 4WLNA 4CMAA 8ADHA 1LU9A 1JAYA 4CUZA 2VWHA 2C2YA 3ROKA 8LDHA 2A92A 3DBRA 3GQVA 4BNKA 3MCVA 3B1FA 3HB4X 4IDBA 3GVXA 5JY1A 2P9CA 1GZ3A 3QIVA 3IUSA 4RF4A 3TJRA 2G17A 1QYXA 3GFBA 3OM9A 4TKLA 5IDWA 4GLOA 3BIOA 1CF2O 2P4HX 3KYDA 1DC5A 3W8DA 2CF5A 2HMSA 1Q0HA 2QHXA 4DRYA 1GFSA 4F3YA 4YB8A 4J4HA 3VHRA 1NQOA 3GG9A 3AOGA 3KB6A 2P68A 4PGFA 3U3XA 4DIBA 3Q1LA 2I9PA 3GF4A 1A9ZA 4ZICA 3WDSA 4W82A 4KOAA 2GNAA 4ILKA 4E5KA 1M66A 3BXXA 3SX2A 3HN7A 4TKMA 4E33A 1B8PA 5CDSA 5AXCA 1YKFA 4XYLA 5L53A 2BGMA 1H93A 3JQAB 3PEFA 4KUGA 4BS9A 2E48A 1Z75A 1DO8A 2CVQA 1ULUA 1SZJG 5L45A 2HLPA 5KJCA 4NJOA 1DIRA 4O59O 4YAEA 4YAJA 5FYDA 4OH1A 5A04A 2H63A 4TWRA 3WLEA 1E3JA 1F0YA 1L7EA 4J7CA 3VPSA 4A7PA 1WNTA 4YAGA 2VYVA 2NU9A 3ZWCA 4BNGA 3TL3A 3K92A 5CEEA 1KVSA 5F5LA 3QVWA 1F8FA 3ZWXA 2JFGA 2OUIA 3DFUA 3E18A 1V6AA 1Z7EA 3DMYA 3IOYA 3JQAA 1N9GB 2AQHA 4MVJG 3L4BA 5ILGA 4N5LA 3W8EA 4BO5A 3U62A 1E5LA 3HDHA 4AJNA 4O63O 4IMRA 1U28A 3WXBA 2W90A 1LSUA 2I3AA 4XWYA 1P1IA 1EVZA 2R2GA 2CSUA 3H3JA 4RO0A 1J49A 4FPXA 4Z9XA 1YDWA 2PZMA 4L4XA 3TDKA 3RJ9A 4DLBA 4LW8A 2YYYA 3AWDA 4RF3A 1EE9A 3PJEA 5F21A 5CPFA 1WDKA 1MFZA 2UUOA 1WDMA 2WD7B 3RUCA 3NT5A 4U0JA 2EGHA 2W2LA 3RC9A 4R01A 1N9GA 3DZFA 3HNPA 1A7AA 3EHEA 4MVJA 4GVLA 4BHTA 3K30A 1GEEA 4RQTA 2E37A 3JYLA 3W6UA 1DHTA 5JCJD 4I9UA 1YGYA 2GO1A 3GVIA 4OXYA 1IE3A 2Q2WA 5U9CA 2CUKA 4PLGA 3ZCXA 5B12A 4J4BA 1OOEA 3ETGA 4WKGA 2ZK7A 4L8VA 4QFDA 3WSVA 1YL5A 1CYDA 2DBZA 2Z1MA 4WASA 3INTA 3RUDA 5BQFA 1C0PA 4G5HA 4OIMA 4ZQGA 4XYMA 3ZI0A 1UXJA 2GASA 4W6ZA 1EMDA 1O94A 3HADA 3QJ5A 1GUYA 3KO8A 4MO2A 2OP0A 2B69A 3IJRA 2J5KA 4Z3DA 3WYCA 4FOSA 5COQA 3HE3A 4O1MA 3BZUA 3K8ZA 4DMMA 4IJUA 1GQ2A 2DU8A 1BXKA 1PJBA 5G0UA 3RUAA 5G0WA 4BGUA 4CLEA 1ADBA 4S3MA 3GVCA 3CKYA 2VUUA 1NVTA 4UULA 5FF9A 3KLPX 1Z82A 2DBRA 2Q2QA 4PLHA 5KIAA 2BI7A 1IOLA 1T2DA 3ZWWA 3RBZA 3GUCA 5LC1A 1ZXBA 2YHIB 1B26A 3PJGA 1E6EA 1XKQA 3DDNA 1AHHA 2IRWA 4Y6RA 4NBVA 5B4VA 2BH9A 5I8ZA 3G1TA 4BNHA 1SOWA 2EP7A 1U5AA 1BHSA 5KJ1A 1XSEA 2VHYA 5I9NA 2V6BA 1NQAO 1B7GO 3WGQA 5JDIC 2Q3EA 3LYLA 4I5FA 4Q3NA 3AM4A 1F8GA 3GUYA 4XYBA 3ZV3A 3GA0A 1GL3A 3LT0A 4R51A 5CG2A 1ISJA 2O3SA 3QRWA 1C0IA 4LVUA 3SEFA 4GWKA 4B4VA 1U7TA 1G6KA 2Q1WA 4WLEA 4JJGA 3FTNA 5DCUA 3UOGA 2YHIA 3V1UA 3WGHA 3WYBA 4CUJA 1J4AA 1DBVO 1QXSA 3LZ6A 2X9GA 4KQWA 3WFIA 3IIEA 3O38A 4RVDA 2YQ5A 1LDMA 4NU6A 7ADHA 4L76A 4CLDA 2IZZA 2FPIA 2AE1A 1NAIA 2TMDA 4FGWA 3EY4A 1CEQA 4AJPA 1T24A 4G2NA 3FNHA 2WE8A 4JIGA 4DC0A 2YDXA 1U4SA 3N7UA 3RFTA 5ES3A 1ENYA 2HU2A 4JNKA 3DBHA 3EC7A 1N5DA 5A3JA 1Y9AA 5L7YA 4GSLA 2R00A 1UJMA 4NZ9A 3UCXA 4CQLB 4BMVA 2OORA 3I23A 4J43A 5T6BA 4CM1A 3PLRA 3PHHA 1PWXA 2VRCD 4Q3DA 2YDYA 2ILTA 4WEQA 3ZWBA 2PGDA 1GQQA 5TQVA 3DHYA 5L7TA 3QLJA 2VNAA 1CWUA 2O7QA 1JLLA 2A4KA 4A73A 5A05A 4GWGA 3C7DB 5KJ6A 3ZNPA 3E5MA 3GRPA 3EYWA 3QY9A 3MJ4A 4ZA2A 2V7PA 2WDZA 4RCVA 3RD5A 1B15A 1PGPA 3PFFA 4XR9A 1GTMA 1ZUD1 3GZ4A 5G4KB 3OJEA 4YQYA 5TSDA 3WQRA 4CQLA 2QRJA 3ENKA 3F1LA 3WQSB 2EHDA 2ZB7A 2AEJA 4NK4A 4FQ8A 5KJEA 5GMOA 3NEPX 2JCVA 2NVUB 3PK0A 2D3TA 1LEHA 2QW8A 4BOYA 1J0XO 2HMVA 3D4PA 4ROSA 5KKAA 4M87A 1YBVA 4IGFA 4Q3BA 2V6MA 2FWMX 3HZZA 3OECA 2PKQP 4BMNA 5CDTA 4BB5A 2RBEA 3A9WA 3G3EA 4URFA 2GZ1A 5DBIA 3IKTA 3SC4A 5IG2A 5AVOA 5EINA 2Y93A 1X0XA 2VNSA 4BNTA 3PRJA 3F4LA 4J1SA 4D45A 4F6CA 5G4KA 5HWSA 2FRDA 4IUYA 2NQ8A 1TT5B 1X7GA 2B0JA 3T7CA 4LCJA 4WNIA 2NVUA 2J5QA 4YT8A 3VPGA 2JD1A 1YL7A 2JAHA 4E5MA 1YBMA 2QX7A 3GLQA 4OM8A 1HDGO 4UUPA 3H3FA 5BNIA 1KC3A 1XGKA 1PS9A 3DO5A 1E1NA 4I5DA 4PLVA 1D3AA 1NNUA 1SBYA 2CNBA 2G76A 2HJSA 1WAMA 1D8AA 3TF5A 5U1PA 4H15A 5FWNA 4BO2A 4PVDA 1Z74A 1T2EA 2OP1A 4IQGA 4WUVA 1OMOA 1B2LA 1ISHA 2I66A 1BW9B 4J2HA 2FPGA 4BNXA 1TT5A 3ZWMA 1DRUA 1ZIDA 4FS3A 1NP3A 4MKRA 3WQQA 2PK3A 5L4SA 4CODB 5LDGA 2VRBA 2IDZA 4LCEA 2C0CA 4MVJE 2ZTMA 1PGNA 4LGVA 3ANMA 2O3TA 4LN1A 5IZCA 3SJ7A 5DP1A 4JJIA 5JDCA 1ZCJA 1R37A 4TVBA 5MDHA 4QEDA 5JPIA 4WOKA 4P4LA 4B4OA 2BRUA 3I9NA 2HSDA 1EBFA 2EP5A 2H6EA 2NUAA 3F47A 3UN1A 4FDAA 4E2WA 2AG5A 1BW9A 2NU6A 1ISGA 3OBBA 4W99A 1N1GA 4EUHA 3JD3A 1YB1A 5JC8A 4Y9DA 5F1OA 1I2BA 4MPDA 4J4TA 1Y8RB 3KBOA 2R6JA 3BHIA 2EW8A 1K0UA 4ZRMA 4FFRA 4MVJF 1I36A 4DLAA 3K96A 4AJLA 4P4NA 1RM5A 2W4QA 3DMTC 3KRTA 1R15A 4H16A 1KOLA 3ZV5A 4JX8A 4XGNA 3C24A 4A03A 2JJYA 4E2YA 2WWRA 4D42A 2RH8A 4XB2A 3FNEA 3WJAA 1BSVA 3LC7O 1DB3A 1DRWA 1E3SA 3ZWVA 2YV2A 5KOIA 2P9EA 4CPDA 3KYBA 1FDTA 5JYEA 3DTTA 1EBUA 1R12A 1Q0QA 5C3MA 1Y8RA 3LLSA 4M89A 4QXMA 4D3SA 2EWMA 3VH1A 3NTOA 3E1KA 4IY1A 3WGTA 4J1QA 3S8MA 1QV7A 2E82A 2Q46A 4ALJA 1H6BA 1HXHA 2EKQA 4L4RA 1T25A 3KUXA 4OHUA 3PI7A 2O23A 2JCXA 4DMLA 4YTEA 1GV0A 1PR3A 1GAEO 2VYND 4A27A 1WPQA 1RM3A 1E5QA 2VUSA 3RBXA 3PQFA 2FZEA 2QRKA 4CMKA 4EEXA 5FI3A 1QG6A 2JCYA 2I6TA 2EIHA 5F1PA 1JA9A 3WIDA 3ENNA 4QQRA 4MOWA 1DIBA 2YHUA 1YWGO 5HTOA 1XIVA 4A26A 1DJQA 1OC4A 3MOGA 3Q0EA 4YXFA 5TNXA 1E1LA 9LDTA 2PR2A 2BHLA 5ENVA 4CUKA 3FD8A 1UDCA 1WMAA 2GPTA 1CETA 3F5SA 1P77A 1X13A 2UYYA 1MXFA 1ZSYA 4PLPA 1PX0A 5CP8A 4GL4A 4OKIA 3WTBA 4OGWA 1Q2XA 4CM3A 3H4VA 4KTVE 3HN2A 1MV8A 4E31A 3DXFA 4IZIA 3L6DA 4WGGA 1MC4A 3PGJA 4O5OA 2Q45A 4GX5A 1CQIA 5IAAA 2J3IA 3LC2O 3I52A 1H6CA 3WGZA 3ZV6A 4YEDA 4ZU3A 2Q49A 3DZGA 1NQTA 5KTKA 5JCXA 1VL6A 1KEWA 3IAHA 3QA9A 3RSHA 3KVOA 1NWCA 4GI2A 3Q2KA 1UH5A 3ONFA 1HEUA 1B3RA 2Z1NA 1A4IA 1VPDA 4FCCA 2WEKA 4NBRA 1J6UA 3TZ6A 4DTIA 2PFGA 4XGIA 5COAA 5IJZA 4RL6A 4S1VA 4IS3A 4EEZA 1KVUA 5FFFA 3BYZA 2VOJA 1WWKA 3SJUA 2NLOA 4NH4A 2NADA 1X15A 2JL1A 4R1TA 3OP4A 5BSGA 4FIZA 3MJSA 4RQUA 1SMKA 2B36A 4TRMA 3L07A 1A9YA 4C7KA 4E30A 1H94A 3GN2A 3RUHA 3QVXA 3KM0A 3V5NA 4TRNA 4D7AA 2X58A 2D0IA 2OZPA 4GX2A 4II2A 1P44A 1GU7A 2X9NA 3L9WA 4R69A 1C1DB 1UP4A 3QWFA 3VZPA 2PGLA 1SOVA 1OFGA 2BELA 2DVMA 2WYWA 4E5YA 2VWGA 1ZVMA 3PYLA 2PD6A 1HDXA 1LSSA 2UAGA 5B4TA 2YW9A 3EVTA 4M49A 2NU7A 2HQ1A 4XQCA 3W4KA 2QQ5A 1LRKA 5IXYA 5I7EA 3AOEA 4IXTA 4RZIA 4WCDA 1ORRA 3OH8A 1UP7A 3EMKA 1XELA 4PZEA 4Z9YA 3GNTA 1TI7A 3QW2A 1YQGA 2ZATA 3IDSA 2GSDA 4CV2A 2GN4A 4NIMA 3FTPA 4BKOA 4PG6A 4Z3KA 1A4UA 1C1DA 1PL6A 2NVBA 4Z9FA 3S2EA 3U4HA 1U3WA 2GZ2A 4O6VA 4N18A 1KEVA 4I1IA 4PLTA 5K0ZA 5BNFA 1E92A 2BFPA 4YBZA 1LDBA 1PU2A 2C5EA 5GZ6A 5A03A 4RPGA 2EKLA 1VSVA 2EJWA 1F17A 3FHLA 4J0FA 1TXGA 3PZRA 4N5MA 1P1JA 3GGPA 4CMEA 4CJXA 4B7XA 3H5RA 2B5WA 3EZYA 5JW6A 5DOVA 4D3DA 1VL0A 1XDWA 1EUDA 2ZYGA 2YUTA 2GYYA 2NVWA 1N1EA 3BMOB 1I10A 4MDHA 1BWSA 4W9NC 1YONA 1HTBA 1FDWA 3MJCA 5TJ9A 2CVZA 3KOUA 3QV1A 1N7GA 1PQUA 3OJLA 3C3XA 2Y1FA 1DHRA 1YJ8A 5JCJA 4E3ZA 2B35A 1SAYA 3OJ0A 1YBAA 4ITUA 4NHEA 1CDOA 1F12A 4L0QA 4R54A 3ZW9A 2IYOA 4L9RA 4C4OA 2EF1A 1GZ4A 3KYDB 4YT2A 3U49A 3BMOA 1DFIA 2DT5A 4CLXA 3EK2A 4I9HA 4OSOA 3ROQA 2DTDA 1PQPA 1D1SA 1ZK4A 1QV6A 4PLFA 1V35A 3DAFA 2Q1SA 1JKFA 3NUGA 4B79A 3WNVA 3R1IA 3DHEA 2Q4BA 1AGNA 1R0SA 3A1NA 1XR3A 2G0TA 1R4NB 3KEQA 4LSMA 5CFZA 4OSPA 1V9LA 3HDJA 1PZHA 1O6ZA 1VKNA 3RC7A 1V0JA 4NFSA 2JFHA 4IJWA 4DLLA 5T64A 1HSZA 4FN4A 4J9VA 4NK5A 4ESOA 9LDBA 2JHGA 1ONNA 2PZJA 3C7AA 4YRAA 1M75A 5TGDA 5DCWA 3TNLA 3HUDA 5I9LA 3ITDA 1UZMA 3Q11A 3NGLA 5L3ZA 2IYPA 1YS4A 3D64A 1U3UA 1GV1A 4BO7A 5HM8A 2PZKA 3L4SO 3OJFA 4MKZA 1T2CA 3WGYA 1V3UA 3H9QA 2PWZA 2P91A 3H9JA 3AY6A 1T1RA 1R4NA 3JD2A 1SO8A 3SC6A 3LF1A 2FPPA 2G1UA 4HFNA 2Y0DA 3F4BA 3MJEA 1LNQA 3JQ8B 4HNHA 3FNFA 1SEPA 3PJDA 4P4GA 4ND4A 1DC6A 2IE0A 3JYPA 4Y6SA 1PJSA 2BFMA 2X5JO 3M6IA 3R3SA 3I9KA 1SNYA 4FFOA 1U2DA 3VPXA 4AJIA 3DAGA 4J6FA 3WFJA 3SXPA 4N54A 1ZBQA 3PVZA 3LC1O 4XRRA 3PHIA 3VOSA 3U0BA 2AW5A 3ANNA 4WCFB 3GZNB 4CM6A 4MVJM 5DT9A 2DBQA 2D5AA 1VJTA 2D5CA 2DM6A 3S2IA 3FPCA 3JQ8A 3K6JA 3WX0A 4EGFA 6ADHA 1GYRA 2O3RA 3PHJA 1QORA 3K2EA 4HFRA 4QTZA 4FJ0A 4JGBA 2EW2A 1PL8A 4GKVA 5C5IA 1TB4A 2OO5A 1GD1O 5TLSA 5JDCC 2C54A 4JP2A 2BKAA 2P5UA 2VRCA 3H5AA 1AN9A 3JQEA 2FSVA 2G5CA 1NPYA 2DTEA 2AG8A 2OOSA 4IXWA 1RM0A 3JQ9C 4Q39A 4WCFA 3GZNA 3CH6A 4KDFA 3VH4A 1RWBA 5KVCA 3M1AA 4DPKA 4GVXA 5H82A 4TSKA 3LU1A 5ENDA 1WXDA 3NDRA 4DGSA 3GDFA 3LQFA 4YRDA 4WOJA 5TT0A 4CMJA 1DFGA 3IL2A 3ONDA 3HDQA 4XJTA 1R66A 3NV9A 4YA6A 3VPHA 5J23A 4EUEA 4FFMA 4ZHSA 4Q9NA 1F14A 2VN8A 3AM3A 1NPDA 3Q2IA 4NBTA 4XX0A 3NDIA 1EK5A 1Y1PA 3SLGA 3BHJA 4KZPA 2OHXA 4GAEA 5IDYA 5L4NA 4BKRA 3W4IA 3H9EO 2EJVA 1HSOA 4MVJH 4ND2A 1LI4A 1NFFA 1NR7A 4GBJA 5I8WA 2O2SA 3HWRA 3RUEA 5A9TA 3ANLA 3GAZA 1HYHA 4UUOA 1HRDA 5EESA 4MIYA 4J90A 3PLNA 1LRLA 3B1KA 4E2XA 2PTGA 3ZNOA 5HBRA 1Z7BA 2IEDA 4UEOA 4YJDA 1HE4A 2ZYAA 4GGPA 3FCOA 4KDEA 4EZBA 1SCUA 3O4RA 1NAHA 3EZLA 3GPDG 1LC3A 2CF6A 3T7EA 1U9JA 4IDDA 3RASA 4H7PA 4NFYA 4CQMD 4R16A 3DZJA 3K2BA 4CR8A 5C7OO 2RAFA 3L0DA 3S1LA 1AHIA 5IF3A 1PEDA 3JQBA 5JMWA 4ALNA 4U6QA 2F00A 3H2ZA 2YV3A 2H5LA 1ENZA 1XHLA 1Y5MA 1VL8A 1X1EA 3UKOA 3ZU2A 3PWKA 1KBZA 3PZBA 4HUJA 1PR9A 1Z6ZA 4F6LA 2FHSA 4ZGWA 4FJ1A 5TC4A 1O89A 1T2FA 3IC5A 3GG2A 3RC1A 1XCBA 5DULA 2X0RA 2C07A 2DTXA 2HRBA 4D46A 3WJ7A 3JQFC 4D0SA 3ONEA 4CM9D 3IUPA 4Y6PA 2VT2A 2P2SA 3RFXA 3RI3A 1H6DA 4JN6B 2VTDA 2ZQYA 4LSWA 1MLDA 3DBHB 2ZCUA 3GEGA 3T4EA 3B6ZA 3F5QA 5JMPA 1EQ2A 1PS0A 4UVEA 4D0RA 4CMCA 5T8KA 2VHZA 1I32A 4OXKA 3WMWA 3Q9UA 1H9AA 1DDOA 3IJPA 4DIFA 3N58A 1DLIA 1YH3A 1E7SA 4BV8A 4FOOA 4CLHA 1I30A 3ZN2A 3VZSA 1U4OA 2O3JA 4J7XA 5TJHA 1B0AA 4YYZA 1I3NA 3M2PA 4RPJA 4BUCA 3ZHXA 2RHRA 4HXYA 2W2KB 4BO6A 1V3TA 2Q1TA 3ADPA 2YZ7A 3BAZA 3DEYX 4ZQFA 1CRWG 2OXIA 4EJ6A 4JBHA 1JDJA 3WWYA 1BDBA 2YQ4A 1H2HA 3HQ4O 1IPEA 2Q1UA 3ZNQA 2EXXA 1IL0A 3AFMA 2FR1A 3B1JA 3G17A 4IM7A 3H5NA 1KEUA 2VZ9A 1KY5A 1XEAA 3AU9A 4BIIA 2GN9A 3RUFA 1EK6A 1K89A 5I7SA 4CL3A 2IODA 1P3DA 2Q50A 3LLVA 1YRLA 5JAMA 1IYZA 3RVDA 2NM0A 1FDUA 3FR8A 2J3KA 1DAPA 3TSCA 4M54A 3ZHYA 3COSA 2O4CA 4DPMA 4IDAA 4PG5A 2WM3A 1ZJZA 1GADO 2W2KA 2C5AA 4BQPA 3FBGA 3AFNA 2GN8A 4DA9A 3GFGA 3NRCA 1KS9A 3FNGA 3GC6A 4WJZA 1ZFNA 1G1AA 5A3VA 3I5MA 4AICA 2HK7A 1VE9A 3GAFA 3FBTA 2VOEA 5I7VA 1EFKA 2VZ0A 4TRJA 3GT0A 3W8FA 4CL8A 2X6TA 3JD0A 3KYCB 4KMSA 4NI5A 3RJ5A 4MVJI 1H5QA 4DQVA 5CEFA 1LJ8A 2FY8A 4RDHA 3OIGA 4BNIA 1EZ4A 1E6WA 1E7RA 1HZJA 2VYNA 2OMEA 1K6XA 3DZBA 5EJ2A 4HX5A 3WGGA 2X9VA 4PLCA 2O2YA 4UAGA 2X0IA 1KIFA 4PVCA 4YVFA 3CMMA 2YJZA 1IY8A 1ULSA 3D7LA 3PIDA 3ZW8A 3OSUA 3ST7A 4DXHA 4QX6A 4UEJA 2VTEA 4N7RA 4DL9A 5ILOA 2B5VA 3ASUA 3JYQA 1NPTO 4CMGA 2FOIA 5ITVA 4RPLA 1O5IA 4L74A 3AI3A 2NTVA 3DZHA 2NNLD 3KYCA 4UVDA 3UCEA 1ZEJA 2CDBA 4BKPA 3TFOA 2DFDA 2CVOA 5DF1A 1XWFA 3WYEA 5A5FA 3GMDA 4YDRA 5BR7A 3MEQA 4PCVA 1LDEA 3DC2A 4XZ3A 1GPDG 2D8AA 2LDXA 2YV1A 4HFJA 5TX7A 1KY4A 2UDPA 4YACA 4IDGA 3D5QA 4XR4A 4K9DA 3NAQA 3H9UA 3QE3A 1HT0A 4IBOA 4F46A 3WWZA 2Y67A 3UHAA 4BNUA 4KTTE 4FFNA 1E1KA 4I08A 4EYEA 1NFRA 4XIYA 5L51A 4ALMA 5CDUA 4YJFB 4PG8A 2PNFA 4L75A 1EDZA 3D4OA 4KUHA 1DLJA 3EW7A 4CV1A 2POQX 3LT1A 5IN5A 4FSHA 5IFLA 4PZDA 4CM8B 1P1RA 3L6EA 4E32A 4FB5A 5F1KA 2JKVA 2IXAA 2E4AA 1DAOA 4ONEA 1QYDA 4MP8A 4RVFA 1W73A 2O50A 1EVIA 4ND3A 5G4LA 4Q3CA 2HDHA 1MGOA 1EEHA 1ID1A 3BMNB 1O8CA 5BT9A 4R9RA 4A0SA 5KNLA 2JD0A 3VPFA 2BGLA 3VH3A 4YJFA 2Y1GA 2XF8A 2NV6A 4Q3AA 3A28A 4BO9A 1MX3A 3QWHA 4FFPA 2B4TO 3IP1A 4ZQEA 3AI2A 3F1KA 4Y8VA 5DBFA 3BMQB 4X54A 3U9LA 1KEPA 4CM8A 1HDCA 4L4SA 1S7CA 5DP2A 3OFSA 2GUGA 1K3TA 3AY7A 2XOXA 2D1YA 2I3GA 3ZDFA 1X14A 4DIOA 1SPXA 1ZK2A 4Y67A 2AMFA 3JYNA 1IB6A 3I6QA 3P2OA 1ZJYA 3JQ7B 3IP3A 2QG4A 2RCYA 4GKBA 5IN4A 3BMNA 1GDHA 3OETA 3PHLA 1MFPA 3E5RA 3TOZA 1H9BA 4D3FA 2GGSA 1K6JA 1B16A 3GPIA 5ICSA 3BMCB 1JWBB 3KSDO 3RKUA 3OQBA 3E6AA 1I3MA 1PZEA 4RJTA 2DQ4A 2PH5A 2X22A 5HRUA 4YT4A 3BMQA 1TT7A 4OAQA 4BGVA 2EEZA 1LTHR 1GR0A 3GN1A 2OL4A 2ZTUA 1LDYA 5GZ1A 3EDMA 4CLRB 4OO3A 3ICCA 3DAPA 4K26A 3TN7A 5DBGA 4YWJA 4CV3A 3ORFA 2Q99A 3BTSA 4K6FA 1DRVA 1WMBA 3JQ7A 4UVHA 3WTCA 2ZIZA 5BNTA 1LSJA 3U09A 3RBVA 1YDEA 3P2YA 2WE7A 2GR9A 5KKCA 3BMCA 3TL2A 1T4BA 3V2UA 2X23A 4J16A 1ENOA 4DYVA 2ZB8A 3QVTA 3WS7A 3FWNA 1N2SA 1HDYA 2EV9A 3ZU4A 4B8ZA 1PL7A 3FPLA 4J2OA 3CEAA 4RORA 3HHPA 3L4BC 4CLRA 5HA5A 1RYEA 1VSUA 3VZQA 4KQXA 1I5RA 4CM5A 1U2GA 1WP4A 1ZKMA 4YJGB 4MP6A 2YFQA 2Z5LA 2Y1OA 1ZSVA 1OC2A 1JVBA 3DOOA 4AVYA 4GQAA 4GPD1 4U5QA 4UUNA 5KVQA 3JD4A 4IGEA 4BNYA 4EDFA 2ZQZA 1FF9A 4NNJA 4WLFA 3ZWNA 2Y99A 4WLUA 2G82A 3OEYA 1GYQA 3WG9A 4IJKA 4MJLA 1N7HA 3GH3A 3UF0A 5KVVA 4AJJA 1JN0A 4E12A 5AXDA 3D4NA 1D7OA 4INAA 5FI5A 1JVSA 2XXJA 4OQZA 5A5EA 2DPGA 3HG7A 4RLSA 2UUPA 3F6YA 4JBGA 4XD2A 1E3IA 1HYGA 4BB6A 5AXAA 4YJGA 1ONOA 4ZQHA 1E3LA 1Q7CA 1SEVA 3HB5X 5CPBA 1E1MA 4NR0A 1ZK3A 3TPCA 3DFZA 4LMPA 1UXIA 1GCOA 4DPLA 1YL6A 3OQ1A 1I3KA 3OMLA 4TMFA 4IIVA 1MB4A 4XA8A 3D3EA 1I0ZA 4DREA 5CEJA 1KVQA 3DWFA 4E21A 2DAPA 1DFHA 3AK4A 2GD1O 3ETDA 3LDHA 4R3WA 2HJRA 4TZKA 5HS4A 2A94A 5T57A 3FI9A 4XB1A 3ZHZA 3TZKA 1O9BA 4Z0PA 1DOHA 5EPOA 2HO5A 3MWEB 1HE3A 1LBEA 3RIHA 3P5SA 4U0KA 1T2AA 3PDJA 5CDGA 3ZWPA 3G0OA 4XCVA 1PGQA 4FJ2A 2W8ZA 1P45A 4Z6KA 2NWQA 4UVGA 4K28A 5B37A 4JROA 5JAZA 3E9NA 3DOJA 5JE8A 4GX1A 2NQTA 2J6IA 2GERA 4QO7A 3DR3A 3CE6A 3AW9A 4E6PA 2GN6A 4EITA 2AEFA 3VKUA 4R3NA 1Y5RA 1R6DA 3ZWOA 3GVHA 2X86A 1FJHA 1YQDA 3UXYA 4DQXA 4E0BA 2PLAA 4BQRA 2AQ8A 3RKRA 1YQXA 1HKUA 5A9RA 3IQDB 4XIJA 1RM4A 1WZEA 4B3JA 3MJTA 2HMUA 5JNLA 2DC1A 3RAJA 3LSYA 2O48X 1W6UA 1I2CA 1CERA 1VC2A 4AG3A 5JSFA 3JCZA 3RUIA 1MG0A 3I1JA 4JK3A 3RWBA 2QYTA 3UW3A 3OEWA 4M86A 1PJQA 1P0FA 1J5PA 1AXGA 1DPGA 3PTZA 5DCYA 3B20A 4E2ZA 1I24A 3SBOA 4IDCA 3AUAA 2BD0A 4GGOA 4OQYA 1E7YA 1U1IA 1HE2A 4LMRA 1KC1A 4BNVA 2X7HA 3RC2A 2BFAA 3N74A 1E7QA 4RF2A 3BA1A 4WEOA 3BTUA 4FW8A 5GZ3A 1M2WA 3L6OO 3I4CA 4AFNA 3UAGA 4B7CA 1F06A 3WLFA 4IPTA 2XAAA 1QLJA 4XKJA 4WLVA 1RJWA 2C20A 5JFOA 5A1TA 3KZVA 3O9ZA 5JXWA 3AUTA 2Y68A 2BI8A 3KV3O 5L7WA 1ZW1A 5C7IO 2RIRA 2R00C 3ITKA 1FDSA 1OZAA 2I65A 1WVGA 5COBA 5TRTA 4RVHA 1AXEA 3UCFA 4R68A 3M2TA 1LXCA 4W7IA 5H83A 4B3HA 2ZB4A 1DIHA 5I7FA 3T4XA 3UUWA 2ZJ0A 1W0CA 2J8ZA 4MKXA 3QVOA 5JYDA 3EUWA 1BVRA 4CM4B 1P9LA 4Y98A 3VZRA 1IHYA 1O0SA 1PGOA 1G0OA 5JC1A 4RVUA 3UH1A 3HFGA 3R6DA 1HDZA 4IDEA 1YOVB 5EMHA 7MDHA 1CQJA 2WYVA 4ZRNA 4YQZA 2NACA 4UREA 4XYEA 2V65A 2Y0CA 2CDCA 1ISMA 4IS2A 4F45A 1Q1NA 5BSEA 1B14A 3DBLB 3G49A 4CQMA 4PLYA 1NBOA 5TS3A 3QWIA 1BGVA 3OA2A 3AM5A 2DFVA 5IXSA 2D2IA 3K5PA 2B4RO 3PXXA 1UZLA 1ZK1A 5EQDA 1ADCA 3ASVA 5A9SA 3H9GA 3O8QB 1JW9B 2CZCA 2J3JA 3WNQA 4ALLA 2J5RA 3U5TA 3MWDB 2WTBA 2FP4A 1E6UA 4M1QA 3H65A 3PYXA 4CM4A 1T26A 3E9MA 4JBIA 4R1UA 3P19A 2ZCVA 3TFQA 4AJHA 1YOVA 1D4FA 3PYMA 4RVGA 1EDOA 2AA3A 4CM9A 1UUFA 3LK7A 4EJ0A 3RROA 3C85A 6LDHA 3DBLA 4RDIA 1UR5A 4BKUA 1Z45A 2Y0EA 2FZWA 4RVSA 3MZ0A 1XQ1A 2Y66A 1ZH8A 2I99A 3DMTA 3H8VA 3ZNNA 1P0CA 4LISA 1PS8A 1OAAA 4KWIA 1MUUA 2GCGA 3KETA 3X2EA 1P1HA 3A06A 3E8XA 3O8QA 1R0LA 1P33A 2HAEA 4AJ2A 3K73O 3TWOA 4BL5A 2QYSA 4J0EA 4KP7A 4QSMA 1EQUA 2VCYA 3E03A 5THKA 2AHRA 2DBVO 1DC3A 4XGKA 4IDFA 1YO6A 4J49A 4NMHA 3FF4A 1C14A 1ADGA 3IMFA 2J3HA 3OIFA 3R0IA 4NDNE 1L1FA 3V1YA 2NSDA 1WW8A 3KSUA 2C2XA 3MOIA 4GMFA 4A5OA 3KHUA 3ULKA 4E5PA 3LF2A 2H9IA 3HFSA 4BNFA 4BNMA 3U4CA 1P1FA 1GY8A 1NHGA 3HDYA 3NX4A 1MG5A 2PD4A 1FDVA 3CMCO 3U4IA 5I9MA 4OXNA 3RU7A 1A5ZA 5IZCC 1YXMA 3LT2A 3ROPA 1QP8A 3GGGA 2ZTLA 2O7SA 2C29D 3G1UA 3NYWA 3P7MA 5ITWA 2CFCA 1Y9EA 2A9FA 4R41A 1LLCA 2VZ8A 5AOVA 1MA0A 1FK8A 1EFLA 4EJMA 3RCBA 4M55A 2PZLA 4KWHA 3VTFA 2WD8A 4BNJA 4IINA 2FMUA 1A71A 3X2FA 4LRTB 4L73A 4NBUA 2C7GA 2IXBA 5DN9A 1YB4A 3LVFO 3C7CB 4UVIA 1PZGA 4QUKA 1NWHA 4IMPA 5DNAA 4II3A 2C59A 1GYPA 3V2HA 4XRGA 4YRBA 2X0JA 3DB2A 5IDXA 4K6CA 1PJTA 1K6IA 1BTOA 4N5NA 3GR6A 3D0OA 3VH2A 2OFPA 4ND1A 1Z73A 2VQ3A 1NYTA 1M6HA 5KCZA 3WGOA 2X5KO 5H81A 2C82A 3GNQA 2LDBA 2IZ0A 1UXGA 3RU9A 1BXGB 1LA2A 1X7DA 3I9OA 4BNLA 1LDGA 1PZFA 4MIOA 1VLLA 4W7HA 1R0KA 4R5MA 4D79A 3EVNA 2VWQA 3BHMA 1RYDA 3GEDA 3I83A 2GRAA 4ZN6A 1GQYA 4PRLA 4RF5A 1JU9A 2WD7A 1NASA 4XJSA 4D43A 4XQEA 4E4YA 5EQFA 1JAXA 1M76A 3DQPA 1VM6A 1W8DA 1X0VA 4TROA 1KERA 4B3IA 2CMDA 3PQDA 3QWBA 4RGBA 1B8VA 3PHGA 4IQ0A 5A06A 3H6KA 4JLWA 4K1LA 3W1VA 1BXGA 1DIGA 1PQWA 3A4VA 3FWZA 4PG7A 4QFCA 1TA4A 3ADOA 4TRRA 1Y6JA 1B3BA 1Y7TA 1XLTA 4NU5A 4EUFA 1CIVA 2HRZA 5LDHA 4DYDA 3QP9A 5L9AA 4JCOA 3HJAA 4C7JA 3GRKA 3UVEA 1TEHA 1I2ZA 2W98A 4HKTA 1BDMA 4Q3EA 1ADFA 1X7HA 3NGXA 1UP6A 4IQ8A 4QO8A 5F5NA 1UAGA 1MXHA 4E5NA 3GK3A 2DPHA 1PJ3A 1QRRA 2O3QA 4NG5A 5A02A 1I8TA 4GLLA 1MC5A 1QYWA 4B4UA 1DSSG 3DONA 5EERA 3VAZA 1KETA 3D3WB 1JWAB 2JHFA 3NTQA 3I9LA 3V2GA 4DWVA 4YAKA 1ZMTA 1LC0A 1PTJA 5K6AA 3EAGA 4YCAA 3QHAA 4J9UE 5THQA 4A2CA 4B4WA 3WMXA 1NM5A 4A10A 4CR7A 1CJCA 2NTNA 2PKQO 5TIIA 1LQTA 4XDYA 4ZVVA 3OF2A 4U7WA 2X5OA 4XQGA 1VJ1A 2UV8A 3JV7A 4YPOA 1I01A 3PWSA 3D5TA 3D1LA 4CMHA 3ETEA 1KVTA 3VVBA 5B4UA 4DUPA 2VYVD 3D3WA 1A72A 2B4QA 4W9NA 1LQUA 5MGBA 1PGJA 2PH3A 2WSBA 5G2OA 4O0LA 5T5QA 5JS6A 4PN3A 1V8BA 5CG1A 3PPIA 2RHCA 4BV9A 2P9GA 1PJCA 2FR8A 3Q3CA 1EVYA 2HK9A 4HBGA 4RPKA 2B83A 3JQAD 5L40A 4BNZA 5ICMA 1ZMOA 4BO4A 3AI1A 5CDYA 3WSWA 4PFJA 2O3UA 3KLMX 4I5GA 3RQSA 3ZHBA 4YT5A 4D41A 4XQ9A 3F3SA 2PKRA
chains in the Genus database with same CATH superfamily
2O0JA 3I4LA 1ZR4A 1RFGE 4UM7A 1PQ4A 2WT8A 4EL5A 5HZGA 2ZBQA 3Q8KA 3DO6A 4V0ME 1QX3A 2V6GA 2HA5A 4I1OA 4U39A 3THWA 4FYMA 3OBIA 3PQ2A 2QAGA 4GYKA 4EHBA 2XRZA 3AONB 1CZNA 3C48A 1ACMA 2X1HA 3BWYA 3GT4A 1C0LA 3PUXA 2FPWA 2A57A 3O5AA 4AI6A 2PLFA 4Q48A 1TYAE 3AR2A 4PZCA 1LD3A 4RV4A 1EB9A 1FVHA 2WFLB 5K3AA 3EEQA 2V6JA 3K4QA 1T8RA 2NO4A 1W4ZA 1Q7GA 2HPHA 2PMFA 4NYMQ 1U6JA 3KXPA 5BYBA 1AQLA 3QFRA 2KLBA 5TF4A 4DANA 4DCNA 1Z63A 1U0LA 2WU8A 2IPMA 4ZHQB 3HY3A 5HS6A 1K4YA 1U8XX 2EFGA 2YXPX 2YINC 4ZVTA 4LJKA 1YZYA 5MHTA 1PD1A 1EHIA 1ZOOA 1QF9A 2OD2A 2RJ3A 3Q9LA 2FN7A 3W5IA 4MS4B 2ZGVA 3C3DA 1PZMA 4MP3A 3NORA 3PUIA 1E9AA 3ON5A 4TMKA 3TZBA 4ALIA 4ZC1A 1IB0A 3P1JA 5NULA 4LRYA 1J2EA 3UBTA 2AFHE 4NBWA 2CD9A 5KC9A 4N3GA 3GT7A 4RPHA 1V1MB 3KD2A 1BXZA 3GDHA 3BD8A 3GNSA 4S35A 1F3OA 4F3KA 4LF5B 1GXSB 3I6IA 1D7AA 2WFLA 3GLRA 5DBHX 2EG5A 1U6KA 1P4RA 3PQEA 2RH4A 4OOEA 4AJ1A 2FPUA 2IX9A 3TINA 3QNUA 2NU8B 1TLFA 1WSDA 2IBTA 2YZMA 2A1IA 3IUMA 3NVKI 4JLNA 3N8NA 2XGSA 1PNOA 4CM7A 4ID3A 3OLYA 2BTQB 4LE1A 1Y6QA 4C4AA 4YUZA 5ALYA 2G80A 2C7PA 1XOIA 4JLKA 3VTZA 5FTLA 2M6LA 2CXTA 4IHJF 4CMIB 2X6QA 3VDRA 2DKFA 3ZGXA 1PKEA 1VBFA 4KR9A 1IHXA 1QLHA 1L1RA 2P8JA 3F46A 1MB0A 3TOCA 3WI7A 1CQPA 1UDBA 2YY6A 4RZ2A 5CNIA 5J59A 4WPGA 3SLKA 5CD9A 1V3VA 1DG1G 1QDEA 1RKBA 1V1MA 2AR0A 4I6GA 5ADUS 4Y9SA 2COUA 3FVTA 1K66A 2BSAA 3G8AA 1S2IA 1W47A 2WAYA 1X7WA 4MVXA 4MTLA 5JASA 1IN6A 1QVAA 4FFVA 5KYKA 4BTLA 4R9NA 5KBYA 2IUFA 3CRNA 3M1LA 3ICQB 1ONPA 2WTEA 3Q3JB 3BCRA 2NU8A 1NT4A 3NASA 1C3VA 1DJPA 2VUTA 3RNLA 3DXXA 3K1ZA 5C4MA 1E4VA 1NMZA 2BTQA 1GUAA 1RXCA 5DM0A 3Q9NA 4P22A 4QRIA 1EE2A 4LNUB 4XLZA 5GOZA 4Z7QB 2XNSA 1H2BA 3D6VA 1VJ0A 3E48A 4GM1A 4CMIA 4BQSA 3IUNA 4TMTA 5CIYA 3HO1A 1XDBA 1ZU4A 2QSZA 3QOWA 1PP4A 1JH8A 1SRQA 4XFJA 3LQQA 5BRAA 4OL9A 1JLRA 5CLGA 2NQ2C 4YPFA 3AEQB 2HY7A 4N0DA 4MHOA 4B0PA 2OBMA 2Q1XA 2PX6A 1ISIA 5SICE 1FFCA 3H84A 3DMNA 3QTTA 4LI0A 4YRQA 1OYWA 2P69A 2Q3HA 3GJSA 5TGTA 2B21A 1R1DA 3JQDA 4K87A 4ER5A 4DDUA 1C7QA 2W58A 1YCHA 4YGXB 3WL8A 2PYDA 4MWDA 4AT1A 1E7MA 3PB3A 1FU7A 2X8LA 4FMCB 3UG7A 5BSFA 3MTEA 3IQFA 3ZLTA 1RJDA 4FYHA 4DUYB 1QSGA 2OENG 2AQIA 3GCXA 3IUQA 5AM2A 3OEED 3GLTA 1H66A 1FYFA 4FUQA 4R7GA 3RODA 5FLXA 4LNUA 1XD2B 3EWNA 1Z62A 4GHWA 3WRYC 4BO8A 1IUOA 2Q3LA 3EFOB 1JYFA 1D2EA 4GE3A 3T7KA 3ZQ6A 4LZLA 4HQKA 2I6FA 1ZAYA 5C80A 1PR0A 1SB8A 3JWHA 4Z8YA 3LKZA 3AEQA 4E4TA 3WGUA 4M76B 1F9AA 3P96A 3K53A 1PJ4A 1QO7A 1B8UA 4R0MA 1AUPA 1Q21A 1ML3A 3OOHA 4RQAA 1JZSA 3RS7A 2N47A 3BB4A 3RC3A 3SEZA 2FHPA 1WLYA 2R8PA 2O20A 2Z30A 1JTEA 1TVEA 3F49S 3FUCA 2JD2A 3TTYA 3WA6A 1U2DC 1VSBA 4GR9A 4UBLA 4BNWA 2QEQA 1RPJA 1J2JA 3N0VA 3EVDA 4IUDS 3IYLW 4IAOA 1AK9A 3MRVA 4Q47A 5DLDA 1XD2A 4JU8A 2WYUA 5KJFA 4GNKA 3JVVA 3EFOA 1QR6A 3DKVA 621PA 2QUJA 1RZRD 1Z7YA 3K9NA 2A30A 2IS6A 4OBBA 4UNPA 5ADHA 1UKBA 1NV8A 3K9QO 4BNNA 2D54A 4CV0A 4BO0A 3A9RA 5JIBA 4URVR 1ZLXA 1NKSA 3VYTB 1IN1A 4L07A 3WGKA 2ZIUB 1JXOA 2V7WA 1OUMA 2UUAB 4KHZA 5AK3A 1XZQA 3I9JA 5KVSA 2PZFA 3DZIA 3IA2A 4HEHA 4KVZA 3KLNA 3LZCA 1ECPA 1IDN1 4MV4A 3WB9A 3ZGLA 3L3BA 1N5JA 1SVKA 5A4MS 2ZSIA 3CUWA 1A5TA 3FPBA 3L7AA 5E6SB 4MVJP 1T1EA 1Q0ZA 4EW6A 1N6NA 4QBGB 1MIHA 2ZBUA 3CPSA 3OAAA 4NQZA 4F9TA 4Q00A 4EHDA 1SQ6A 2Z95A 4K8RB 1U11A 4WCFC 3HWSA 1L4BA 4KK4A 3BTVA 2GOYA 5L4LA 1Q0LA 5JHGB 1KGSA 1U3GA 2XVYA 2DCMA 1NUQA 3VKVA 1GUZA 1N0WA 4MMYB 2CNNA 2BGKA 1HE5A 2BIFA 2WWVD 3HL4A 1S6YA 1OIWA 1YMVA 4JSYA 1KH2A 1TZMA 3V97A 4ZJYA 1ZY2A 2TSYB 3EUFA 2X2PA 4G8JA 1PO7A 2EKPA 1QQ5A 4OMUA 4RSRA 3V7NA 4L9SA 3T9AA 3QQPA 4PGGA 1KGDA 1NFQA 3TKAA 3MJRA 2RHJA 4Q1AA 1TNDA 1KZGB 5E6SA 4RTNA 1YB2A 2YWGA 2CLHB 2XRYA 3GFSA 5CAEB 5CIQA 4FD3A 3ZWYA 1QMPA 1U7DA 4ZEXA 3JTMA 3WBFA 1K2WA 5C8YB 4HWKA 6NULA 3SYNA 1XLVA 2POCA 2HDOA 1SWWA 2NTEA 4CMBA 4ZARA 1KEZA 3TLGB 4CN9A 1CFZA 2E2WA 4HRAA 1SKMA 4XASA 5AQEA 3ZZNA 1NVMB 2A35A 2WJ4A 4C30A 4PO1A 1WZIA 3BHNA 4FNMA 1EUZA 4HRXA 2ARKA 5C3UA 2GXQA 5EUBA 1XZCA 2HC9A 3GLHB 1XZJA 5AW4A 4RFVA 2QT1A 3LT4A 1JQBA 5HHTA 1Z0AA 5F51A 3VR0A 1Q2UA 5AXBA 4Y0NA 4XCQA 3LX4A 3SDBA 5MFZA 3MJDA 4UDNA 2ALJA 2JZCA 4HH3C 4WK2B 3FI0A 5CAEA 3BE5A 3R74A 3I6ZA 2WVGA 3PPVA 3WDKA 1NVGA 4GDMA 3NCHA 5C8YA 5CNKA 2VRNA 4JT4A 4DDWA 5B2ZA 1DG3A 1GGEA 1OZ0A 3IT2A 4JHXA 3QE2A 2IZ7A 1G0NA 3TLGA 1FSSA 4C4TA 2WQZA 2QN7A 4B7UA 3SXUB 1HI9A 1P7CA 4N9QA 5AW1A 2J3QA 4G24A 4MIEA 4M9UA 1DAEA 1XTUA 2J0VA 2JFFA 3CISA 4GYWA 4PO9A 5ULLA 4EPYA 4UPVA 3V1TC 4N01A 5BVHB 3RABA 1Z4IA 3GLHA 1NYLA 2HKIA 4YJHB 3AL0C 1JG2A 1TYBE 4CDRA 1L7VC 3KZ1E 3GWGA 4POAA 3LBHA 3HZOA 3F9CA 2HK8A 3O03A 4N3NA 5L3SA 3TTXA 2QRUA 4B45A 4RK4A 4LOJA 5BMVB 2INGX 3LBAA 3C1AA 5EPUA 1B1AA 4FGJA 1Q50A 2HNAA 1L5HB 2TMYA 2AF3C 2HSZA 3EAQA 4LA4A 4F7WA 2KPOA 1UFQA 3QLEA 4CL2A 3H5TA 3ONVA 1C7EA 5F1YA 1B43A 4NCIA 1BMDA 1M6WA 2WFZA 2J45A 1UJCA 2CEAA 3H11B 4CGYA 3IE2A 5DDIP 1M1ZA 3UT5B 3AUJB 3B2NA 4TZTA 4UDYX 5EXDA 1DKMA 4WK0B 4CIWA 5K2MA 3QUCA 3SXUA 2BF7A 3PS9A 3MF4A 4NOLA 3TZHA 1YB5A 2RHWA 3EIUA 3HU5A 3V1NA 1Y6FA 1AUVA 1SXJE 4IOLA 2V4MA 4PRZA 4YJHA 4WXEA 3ESYA 3QXXA 5K6AC 4U2KA 2ZBEA 1CR6A 1VCHA 4XEHA 2WSSD 4NCBA 2BTEA 1H3NA 1UFKA 1ENPA 1VPLA 1ZIXA 2WWGA 4P6VF 4BZXA 5BMVA 2HU7A 1QKIA 1DV2A 4IQFA 3TTSA 5JAQA 2J32A 2V6FA 5CW2A 4Z53A 5K03A 1ML4A 2KLHA 3GXOA 1UJ5A 3UXHA 5EHZA 4UC0A 5E7IA 3GH1A 2SNIE 3H11A 2WSYB 3VSCA 1RWPA 4WECA 4JJFA 1UDAA 1V11B 3JU3A 3UT5A 4QHSA 2ET6A 4ZIRB 1MJFA 1LUAA 1YSCA 4I66A 4AXBA 3QUTA 3QE0A 3EWIA 2AT1A 3WSTA 1ZP6A 4QYXA 1XF1A 3UMGA 2P0YA 5JANA 4HFMA 2H7VA 1MAHA 4X20B 2EL7A 3DHNA 1FSPA 4I50B 3WNCA 1KH1A 5EKSA 3QHPA 4GM0A 2Q3JA 1W5BA 1Z68A 4QULA 3UFXA 1J56A 1J2RA 5FADA 3ZE0B 4DV5B 5ALKA 1JX6A 3BF7A 2RKWA 2R62A 3EIHA 4FI3F 1R9NA 4RNDB 4ER3A 4F0JA 2WHRA 3NHYA 1QAOA 3IVGA 1P19A 1RCFA 1VKOA 2CLFB 1UIRA 4J91A 3TRIA 4DA6A 4ZZ3A 3L8YA 1R16A 4KITB 5ESDA 2B5OA 3LQ2A 3P9RA 4YGYA 1SOMA 4QXOA 4UUMA 4ZMRA 1E77A 1P74A 4C2TA 3K0BA 2BGUA 1DBRA 4ZIRA 1SXPA 1HZZA 3MGBA 1A27A 3AR8A 3RT7A 1J9EA 1NXQA 1WB5A 3INGA 3IVAA 4DR3B 3FHOA 5F2OA 1SK8A 2WAOA 4JKIA 1N5MA 3WK7A 4X20A 2PT5A 4JLSA 1KAMA 4I50A 3G2MA 3LXMA 1TQ4A 4WLNA 1M2VB 3UAWA 2C1ZA 4MGZR 1LU9A 2PS1A 5ALHA 1YRHA 1W0KD 2VWHA 2C97A 3FPFA 3GEHA 3HNOA 2HEGA 1RWOA 3W04A 1NBMD 2VHCA 1F2VA 1BN6A 2RGCA 5FKJA 1FFYA 3Q6NA 5HZKA 2GPJA 3E9CA 1IY9A 3UMSA 2VNIA 3Q88A 3B1FA 3HB4X 5GINE 1YIAA 2ACVA 2P9CA 4L02A 1YS9A 3QIVA 3IUSA 2XUJA 3TJRA 4TN1A 2PUAA 1JSLA 2OVBA 4NYIQ 5IDWA 2IEZA 3A6DA 4LC1A 5GJWC 2GXSA 1UPFA 3NH9A 2ZE5A 4K8OA 4KIFA 3AZOA 3HYSA 4MV6A 1Q0HA 5BWCA 4MQEB 3GYGA 3RF6A 2IGBA 3SZLA 5KSZA 4DIEA 2P2LA 2GS9A 1OIXA 2ZJOA 2BEVB 1GPH1 3ZK7A 1VRVA 2E4YA 1GCIA 1M2VA 4DIBA 1UBRS 1H2ZA 3LDFA 1L7PA 4G4JA 1A9ZA 7GPBA 4FZJA 1U7OA 3ORHA 4ON9A 4ILKA 4BLRA 2VJAA 3M6FA 2QTGA 2H7XA 4QXQA 1UBGA 4TKMA 1G3QA 3U7FB 3MTBA 2C2GA 2OESA 2NYAA 2XQIA 4F96A 1RZ3A 2A58A 9ABPA 2KQUA 5CDSA 1XI2A 1F5NA 5AXCA 3F5MA 4LOAA 4K9PA 2P4UA 2JS7A 1G7TA 3QVUA 1LJLA 1UQRA 1H93A 2OV2A 4GBMA 4O4HB 5IW8A 1POXA 2QRVB 3URKA 2FCRA 1DO8A 1A2KC 2WUGA 3PGA1 4JWKA 1GAQA 4MQEA 4QUAA 4EZIA 4KXVA 5L45A 3QPWA 2C4WA 4YAEA 2VUIB 2Q5HA 4QYWA 3T61A 2NOAA 2QMQA 3OIVA 4REMA 3UB4A 3MS2A 2OYSA 2VBCA 3ZK9A 5DTRA 4A7PA 4YAGA 3QVMA 3JXEA 1FX1A 3OMXA 4LXXA 2VYVA 5KHAA 4CHGA 5KWVA 1ZM4A 5K05A 3K92A 4H3KB 4NH0A 3A6ZA 2WSLA 3K1TA 5F5LA 3PNVA 3QVWA 5FV7A 1K8YB 4QREA 4U7TB 1CIPA 3LCRA 2DH6A 1GG8A 3HUUA 1FE8A 1TKBA 4OHXA 1P7YA 2JFGA 2OUIA 3IOYA 3E18A 4O4HA 2R4UA 3DMYA 5TDHA 3T5MA 1N9GB 2QRVA 3FLAA 4NCXA 3JQRA 4MWSA 3F9RA 3IVRA 2IY7A 3VGJA 3G8BA 3MWFA 4N5LA 3W8EA 2V74B 2ZRFA 2WZDA 3ABZA 1E5LA 1RTKA 3HDHA 3X1WA 4AJNA 1WZNA 1U28A 3E70C 2R6CA 3KHTA 2IHVA 2HGZA 4WACA 3LFTA 2RGEA 4XWYA 1EVZA 1G4AE 2RG7A 3ABQB 3D0KA 4RO0A 1J49A 2SBTA 4FPXA 3WBJA 4JJEA 3HB7A 4H9GA 1XKLA 4A5SA 2GPYA 3VO1A 3T3HA 2I2DA 1EH5A 3K9GA 2DFNA 4L4XA 4DLBA 4KAXA 3PF8A 3PE6A 1NSYA 3AWDA 3B5EA 3PJEA 4PAWA 1V9SA 5CPFA 3RTDA 3I0ZA 1FJXA 1R64A 2GZHA 2A9JA 3RUCA 1D6SA 2HBZA 3NT5A 4YIKA 4L50A 5T41A 5AOBA 2A9KA 1A8QA 4I2VA 4J0GA 4R01A 1A4RA 1PTKA 1N9GA 3A11A 1U8EA 3C5VA 1NNI1 1A7AA 3DJYA 1NUUA 3ROFA 1E3TA 3S81A 4KGVA 3R7FA 4FM9A 4AS1A 2R48A 3BGWA 3NHAA 3BCHA 1IWOA 5AKLA 1RS0A 2NUPB 1JEQB 1OILA 1WLSA 1YGYA 2GO1A 3GVIA 4NYMR 1WTAA 5B58T 3RGWS 5U9CA 1SQ5A 2CUKA 1Q1ZA 1Q16A 4PLGA 4QUEA 4NEGA 3PC6A 3ETGA 4WKGA 4UAUA 1PHPA 3PFBA 3UA3A 3GLHE 4Q3KA 3EDCA 4QFDA 3UUEA 3ZUGA 4EKNB 3JZMA 1RKVA 1CYDA 4KWEA 3Q85A 2Z1MA 4FHCA 4WASA 3RSOA 1LTKA 4A6XA 3RUDA 4CE6A 5FWAA 4US2R 4OIMA 3AQ4A 4I36A 4F4UA 5I8PA 3KQUA 4ZQGA 4XYMA 3I64A 1YDMA 3ZI0A 3PQ5A 1V6SA 3QQ5A 4OHBA 1O94A 2GAIA 3ESQA 3HADA 3KS9A 4GU5A 3KUCA 3L4JA 3UGQA 1E1CB 2FOXA 2MSWA 2YCLA 3IJRA 3HCPA 4UOZA 1CB7A 4FOSA 5COQA 3AFHA 4C3VA 2FGJA 2RAUA 3OCVA 1ZOSA 4WRRA 1KEEB 1U0NA 4DMMA 1TCVA 3D9QX 1WPGA 2NUPA 3GELA 1JEQA 1GQ2A 1BXKA 2DU8A 4UHKA 4XWGA 5G0UA 3RUAA 3GUUA 4BGUA 1ADBA 3GVCA 1ORWA 4I4TF 4E14A 2A59A 1Q3HA 2O1SA 2ZRJA 2VUUA 4ODIA 4RD4A 2PYZA 1U0TA 4G1EB 4MWZA 4PX3A 4UULA 1J8QA 4QDJA 1JLKA 2QU7A 3IVXA 3R0QA 4DLRA 3CRW1 1Z82A 2G63A 3M34A 2Q2QA 5H68A 5TEWA 1Q1EA 3FJOA 4A0RA 1EGHA 4F91B 2QUIA 5TQ0B 16PKA 4HQLA 4DFDA 1KHTA 1D2RA 5DISB 2ZZKA 4BGDA 1B26A 1FQWA 3PJGA 2AUMA 3ILVA 3DDNA 4MQ5A 5B57C 1X8LA 2IRWA 1E1CA 2ZUDA 2YN2A 1OF1A 2G0NA 2WINI 4B44A 3K1YA 2BH9A 2LKDA 5GOTA 3AC0A 1YJ5A 5I8ZA 1SOWA 2EP7A 3LX6A 5KJ1A 1KEEA 5DLYA 4WXHA 4GF5A 4L3OA 2ZR9A 2KE5A 3HYTA 3W05A 3KPYA 4CTMA 1ZJWA 2GAAA 4JITA 4BFCA 2Q5IA 2HI0A 3NONA 1NQAO 3OEHA 3BL5A 1RBQA 3WGQA 5CFQA 4PE5B 4R1LA 3HVIA 3LYLA 4MPRA 4RC9A 1AG9A 2ZAYA 2ZJ5A 2IEAA 2OFWA 1OWOA 2ZJ7A 3D8BA 1GL3A 3KT0A 3QE4A 4F7DA 5I48A 1Y34E 1ISJA 2HX1A 2JI7A 5TQ0A 3ZEIA 5AJUA 1KMQA 2Q1WA 1VB3A 3BULA 3K6SB 4I6JA 3UQZA 1ZX1A 2DWOA 1TC1A 3MELA 3PFCA 3V1UA 3WGHA 3RTAA 1UL1X 3MPUA 2XH8A 2WB4A 2HGSA 2P79A 3H05A 3SYMA 4I1RA 3M9WA 5BW4A 3S3TA 3IELA 4JZYA 2GESA 4HQ6A 4KLCA 3O38A 2LIPA 3F5DA 5EXSA 4ESVA 1YJXA 1W6RA 3MSCA 4RGVA 1IM8A 3DVRX 4R2HA 5DLEA 2RC5A 4CLDA 1P9WA 1SR8A 1NLYA 1M33A 4UCFA 4A1OA 3U7HB 3H2GA 2PL3A 2J4CA 3TM5A 4B33A 3AVYA 4YV7A 2WNSA 1CEQA 3ASYA 4G2NA 2WE8A 2YDXA 1QP4A 1U4SA 2O1EA 3O3OB 5CVVA 1ZCAA 5ES3A 4JNKA 5IJXA 3HZRA 5B3JC 3B3QA 1AXRA 2HHCA 3DBHA 5HFAA 2CXQA 4U8HA 5ES4B 1E60A 4X8HA 1Y9AA 4DDVA 3FLEA 1RWNA 3UAXA 4L5YA 2FE4A 2LBPA 1JT2A 1OVMA 4CT5A 5B55A 4JJAA 4RX1A 3E7WA 4ZCMA 1EDBA 3MUEA 3V7UA 4CQLB 5LFAA 1E9EA 4BMVA 2XD4A 1K7YA 3ISTA 3DLHA 3FYTA 5KC8A 4G1UC 1WCYA 4NXMB 1PWXA 3AIOA 1SGWA 1Y1SA 2ILTA 2FEXA 2YDYA 3BJMA 2BGJA 4E4RA 1V5EA 2PGDA 1ZOPA 4BPRA 1EB8A 1NU8A 1AH2A 1GQQA 2PEYA 3DHYA 3FOZA 4JDUA 4LJ4A 4EELA 2DY1A 5D86A 1NUPA 2WKSA 3CEMA 5C1IA 2O7QA 3UJCA 5KPDA 2A4KA 3HCDA 1G20B 1X9IA 1PG0A 3CRZA 4YHHB 4GWGA 5KJ6A 3ER9A 2DYKA 2P9BA 5HFNA 2I3ZA 5EG5A 2W71A 4RCVA 2GT1A 2HDNB 3RD5A 3GLSA 3UEOA 4JT8A 1ZUD1 3DE4X 2HOQA 3JX9A 4CQLA 1VLMA 1A8UA 1TQDA 2AX4A 2B92A 4JVMA 1G1MA 3OCXA 1JPVA 4QIHA 1KH3A 3NEPX 2JCVA 2P3QA 3CG0A 4M36A 5FUBA 2NVUB 2JLXA 2D3TA 2Y6VA 3GBVA 1FZQA 2A8YA 2C78A 3PT5A 1COWD 1FMFA 2CD7A 1GPLA 2KS6A 2HMVA 3LVQE 4YQFA 2HEIA 3CFYA 3BDVA 3D4PA 3F71A 3O1HB 4ROSA 4M87A 4WOCA 5JVDB 4IGFA 1FU8A 1Q1QA 2XTMA 2XQGA 5C1OA 1WZ2A 2QN2A 1C9MA 3W2HA 1G20A 3GAMA 3GLUA 1GGHA 1YFZA 5CX4A 4HRVA 4URFA 2GZ1A 2PXAA 2AXNA 5KTSA 1B23P 5K7SA 3IEPA 2GEDA 5JCPA 2QD4A 2ADOA 2P30A 1CDDA 2PCJA 3ZGZA 4TZ6A 2Y93A 1BFDA 2CJFA 3U3RA 1X0XA 4HL6A 1H1DA 4DRZA 1RYBA 2X5NA 3ETLA 5E4JA 3NOQA 3PEVA 3KOMA 4BX3A 5I45A 1ONBA 2FUKA 3GJRA 1QYIA 3GUZA 1FIUA 1M6VB 2CLEB 2NVUA 3EUEA 1QR2A 2QLLA 3PX2A 4IRXA 3VPGA 4DNOA 4BXOB 1BZYA 1XZEA 4DDHA 2AYYA 2Q27A 1G8PA 2QGFA 3OC6A 3N2EA 3STUA 3R0VA 3CC8A 4C0AC 4E5MA 7ABPA 1YBMA 2QX7A 4OM8A 4UUPA 3CT6A 4ZKEA 1WY7A 1KC3A 1X7ZB 3B6IA 2GCPA 4JI5B 3TQRA 2C0PA 2OSBA 1Q22A 1ZD3A 5AM1A 1WXWA 2FWRA 3U13A 1XMXA 2HJSA 2ZRQA 4KDCA 4AWXA 1JQEA 2XX3A 4PR0A 4DR7B 3A1DA 1JR6A 4XD7A 2BWJA 3PBKA 2H4JA 3WLHA 2OP1A 3B89A 3J81k 3P2EA 4BJ1A 1B2LA 3SI7A 2WD9A 4MWBA 1OQAA 2I54A 1SIUA 3KT3A 3OPYB 1RPAA 2XNJA 1ZH6A 1DRUA 4DDMA 1ZIDA 1M6VA 1NP3A 2PK3A 5IJAA 3QX7A 4D9MA 2MSEB 4DILA 3LCMA 2ZSUA 2IDZA 1NZDA 4LCEA 2C0CA 1DXHA 4JOSA 2ZTMA 1G291 1PGNA 2FW8A 1YDHA 3Q5EA 3IMCA 4LGVA 2LCQA 4LN1A 4MK4A 5IZCA 5CITA 1JILA 1SY7A 4EJSB 2C4VA 1KSGA 1R37A 4C0KA 3PHBE 5MDHA 3B3GA 3V2IA 4DMGA 4QEDA 1Z4NA 4RHUA 3MQ2A 2BRUA 3KSAC 5M5BA 4OGLA 2H6EA 4GQIA 4IH9A 3ZJTA 2Q29A 3VZDA 3AHJA 5IP5A 1IXSB 2ZSBA 4FDAA 4OLAA 1J06A 4E2WA 3H1TA 3L8CA 3OPYA 2FQYA 1UBUS 4MEJA 2DHDA 1DBIA 2C2ZA 2OPBA 1Z0JA 3JD3A 3IEXA 5F1OA 4B6PA 3WLLA 3ZXXA 4JFAA 4V0SA 3ILHA 2WNHA 2Q9CA 1SUCA 4J4TA 5TPZA 4GPAA 3E84A 1UDXA 2B1IA 2EW8A 1A98A 1TM1E 1UEIA 1X1QA 3BHIA 4QOJA 3EIEA 3INYA 1Z0UA 3N2YA 3KQOA 4LBZA 4ZOEA 5DHAA 2YFKA 2ZRHA 4ZRMA 1M6EX 5A0VA 1YUBA 1XHFA 1I36A 4FFRA 5DHTA 2QR5A 5JXHA 1RM5A 4KN8A 2JRCA 4LHYA 1KOLA 1GQRA 3ZV5A 2LIVA 5E3JA 4ZVUA 1GG2A 1BGXT 4A0HA 2JJYA 3F8SA 2R1TB 1OH8A 4XB2A 2AWNA 4RH3A 1KP3A 3M1IA 1DB3A 4U2GA 4TLDA 3AR5A 1DRWA 3ZWVA 2BY4A 1T0UA 1T1IA 2IYVA 5HKKA 4HDOB 2W8BB 2YJ4A 2NP6A 4RNCA 5BWMA 5JYEA 1FMLA 3EZFA 2PX8A 3Q0TA 2C5BA 1FUEA 1GU1A 1Q0QA 2Q4DA 1FQJA 5C3MA 4M89A 4D3SA 3PFNA 1JHZA 5LP6A 2C7OA 3KOUA 4L5BA 2GXAA 3E1KA 2Z6VA 1KAGA 3Q6MA 4LG1A 5DRTA 4DG5A 3OQVA 5BR1A 3EMDA 1ZIPA 3M3PA 1E1QA 4D8YA 3S8MA 2FLKA 2VDJA 3NQ41 2HA3A 4RTPA 3E8SA 4J0DA 2XGOA 2EKQA 3RAEC 1T25A 3BD7A 2XITA 3KUXA 1TYDE 4OHUA 4PBSA 4F85A 1ZXXA 2O23A 3PI7A 4DMLA 3MG9A 4YTEA 4QBIA 5KYTA 1PR3A 3OY2A 1Z8FA 2R1TA 2QUZA 4A27A 2VJMB 3HZHA 4J3NA 2BGNA 3D4LA 2VUSA 3PQFA 4CMKA 2D2FA 3WDLA 3BWVA 2ZSJA 4EEXA 2JCYA 1QVRA 1OFIA 2I6TA 1CQIB 1ES9A 3RVKA 2W8BA 4CQJA 3L4KA 1RHUA 4I4NA 2QPOA 4LWOA 2K2QB 1FXUA 1WHSB 4TVKA 3W77A 2J09A 4MOWA 1NJ1A 2G5TA 3S4YA 3M3DA 2PE5A 4QPDA 4KXUA 1LY1A 3NKVA 2GBLA 4WA7A 1RRPA 3BGDA 4QODA 4OAOA 4I4LA 3ZLVA 4CUKA 4FEEA 4CI0B 2CV0A 3D4IA 3F5SA 3LQRA 3WGNA 4MXDA 2WTNA 1C5KA 4CEJB 1ZSYA 1MXFA 5ITSA 4GL4A 1ZUWA 4PO8A 4G8CA 4OGWA 1IPHA 1RDFA 2EQAA 2PRSA 3JR7A 3NC4A 5GPBA 4UXIA 4KTVE 4BQNA 2VJMA 2H2AA 2HJVA 1XZHA 3NHSA 2Q6KA 3L6DA 2ATXA 1MC4A 2CXOA 1HORA 3OCJA 2Q45A 4O5OA 5JJ5A 1CQIA 5LPNA 1I2MA 4PCLA 1WHSA 4BX9A 4G0MA 1H6CA 1BWQA 4EF6A 1KOFA 3N5CA 4L6CA 1E2NA 2H4YA 4YEDA 3L0CA 2IS1A 4ZU3A 2XMDA 3KQVA 4B09A 3I72A 1VJCA 5BWNA 4OFZA 2P6MA 3IAHA 3OZXA 1BROA 3SFZA 3AFIA 3WLNA 2GLUA 1P73A 3MT7A 1XMJA 3ZIAD 1D07A 1J22A 3L5OA 3ONFA 4PPQA 4CEJA 1U9ZA 5J40A 5DX1A 2PT6A 3B6EA 4D3ZA 5AUOB 5FAXA 3ADKA 1I51A 2C0QA 1H2AS 5KTTA 1E79D 2H7YA 3DF9A 3TZ6A 5CFOA 3F6SA 4WBNB 1VSTA 2QV7A 3TLXA 1XPRA 3EVBA 2F55A 2GD2A 5CH8A 2I2AA 2AYZA 1P17A 4HQ0A 3LAWA 3HEAA 2A0WA 1A5BB 4AZTA 1MRZA 4MCJA 4QGAA 4IS3A 1K7EB 1QIDA 3LTNC 1YZFA 5AUPB 2R0QC 3D81A 2HWKA 4QPPA 1Z6PA 5JS1A 1X15A 1BKYA 5BSGA 5EMNA 3U1BA 4FIZA 3AB7A 2B36A 2ZBVA 4Q3LA 2JH8A 4DJDC 4C7KA 1P2VA 4E30A 4UM9D 4DAEA 4YAIA 2HT1A 1NY5A 2C9DA 1T8TA 2FQ1A 4GX2A 2R1VB 2X9NA 3TOVA 1SXQA 1C1DB 4YUWA 1UP4A 3QWFA 1G20E 3CN7A 1XLTC 3UJHA 2PGLA 2BELA 5H4GA 2V1XA 1QH0A 1E3DA 1ZVMA 4WBNA 2PD6A 4NQRA 3GV0A 2IUYA 1NURA 1AQUA 5FX2A 1PFWA 4JUAA 1KSHA 4AMVA 5EIBC 5D5HA 1LRKA 4NNOA 3LG2A 4HB0A 4RAOA 1HMYA 4LFCB 3SHOA 4QVIA 2N42A 5GIPE 4C4YA 4M98A 2HQRA 2R11A 2TYSB 1U1FA 1WOYA 1G4HA 1Z47A 4J3JA 3B1VA 1E9DA 5I3ZA 5JPDA 2F8SA 1YQGA 2ZATA 2IHJA 1DZ3A 4CV2A 1GTJ1 2F1OA 5D1HA 3UUGA 4NIMA 4ENTA 1P9OA 1M2OB 1ZVJA 3P26A 1FS5A 2ZI7A 4Z3KA 1C1DA 4M7WA 2BHRA 1U3WA 1PTJC 3AUFA 4NICA 3IOMA 4I1IA 5K0ZA 2BFPA 1TM5E 4KWTA 1PU2A 3G2JA 4E88A 1JB9A 2ACKA 4MWEA 2OCYC 2EKLA 1VSVA 3W9YA 1TXGA 1F1BA 1LPSA 5DO9A 3WQBA 2IGTA 1XNGA 4RA6A 4B7XA 4TOIA 1HH4A 4F2GA 2B5WA 4IVNA 4FD2A 3IOEA 4RL4A 3WYNA 5DGCA 3H5IA 1VL0A 3PNMA 2FN3A 3A0RB 3LHDA 5G41A 2JIZA 1AKRA 3KJXA 4MLPA 1N1EA 3KJZA 5B3LA 4Q9HA 1U02A 2ZIEA 2J5BA 1I10A 4MDHA 1FNCA 1M2OA 5ESRA 3IKJA 1I4LD 4GUAA 2I2XB 5FXMA 4ZDWA 5KHOC 5LDDC 3Q8XB 3RBAA 3GFTA 2BBWA 3ROXA 1D9XA 2ECOA 2G36A 3A6EA 3NBYC 3PQCA 2XI4A 2Y1FA 2QW1A 3HN6A 1O6BA 5FHRA 1FYWA 4J0IA 1JFLA 3OF5A 3OJ0A 4C7VA 1L3BA 4D8UA 4F86A 4IL5A 1CDOA 3L01A 1DCTA 1HG0A 1XCGB 4N0PA 1QRTA 2QMUA 4LYDA 3OHMA 1W46A 2QRGA 4S24A 2IYOA 3BUSA 4D6XA 3IRVA 1N2IA 3V7WA 2YWHA 3NJRA 3OM0A 4CF4A 5LZ9A 1L5ZA 1E2HA 1TJ4A 4HNAB 4EMUA 4MRAA 3L4EA 1U0FA 4GBGA 2PVSA 2DT5A 4CLXA 1HEYA 2QAGC 4KXYA 4MLDA 1P61B 3HB1A 3L8MA 3V9AA 4DJ5X 3SS9X 5JNUA 4X84A 1SULA 3KDAA 4B85A 1LGYA 4M1YA 4PLFA 1JKFA 1WF6A 1XEFA 4GQBA 5FOXA 4TYYA 3DULA 1E0AA 4N6GA 5E0OA 1IBSA 3WNVA 2H57A 3SZRA 3DHEA 2I7TA 1AGNA 1JEAA 2J3DA 3JVIA 5ECYA 2R1UA 4HGYA 3U0VA 1I5OA 3UJBA 1JP7A 3U7RA 4MVYA 1PLLA 2G0TA 3DDCA 4M9ZA 3KEQA 4MDEA 2PS3A 3HR7A 3LYUA 4AN4A 3F0TA 2DUNA 2FPPB 4RS4A 1NE2A 1PZHA 4UMDA 1GFIA 2BZSA 1U1EA 2RDMA 2XUGA 3ONWA 3EJWA 4NK5A 2YWJA 4HNAA 1XZKA 2H8KA 2AN3A 4LWPA 4P84A 2IYFA 5ETJA 1U63A 2ZU0C 1RQ2A 1N5OX 2CK3D 2FN4A 2IHYA 2VDOB 3DCNA 4WXRA 3P27A 5I9LA 1UZMA 4B1FA 4YCSA 5DNYB 3H1AA 3NGLA 1FDRA 5L3ZA 3ZXIA 4PAMA 1X1RA 1U3UA 4WN3A 2KWIA 1JSZA 2PZKA 1XA3A 3ADDA 3NDBB 4I2NA 5JTTA 1H65A 4DABA 1OAOA 3HO6A 3TAHA 3UIEA 1T1RA 3G02A 4HRYA 1E2BA 1SO8A 2E1PA 3LF1A 2QN3A 4OK3A 2FPPA 4W8GA 2G1UA 3GLGB 1JMKC 4HNUA 1XNQB 1Y1RA 3V46A 2I8AA 2XA9A 1SEPA 4P4GA 4DA7A 5AVXA 3AR9A 5JUWA 1KMMA 1XTIA 4HPXB 1JKXA 3JYPA 4ND4A 1B1CA 5ICGA 3C6ZA 3FKJA 2K87A 2DPYA 1RI2A 3LKDA 4RMNA 2YR0A 1XZMA 1ZM7A 3GFFA 5FNVF 2X5JO 4AP6A 3O8RA 5EMKA 1FQOA 3I9KA 1JJAA 2Z4RA 4PX2A 3T9BA 1VTKA 4OJMX 4J0CA 4ZT5A 3GD7A 2IQIA 1QHNA 3ETCA 3NBFA 4R6WA 3SCZA 3TRHA 3WRWA 4DOMA 5A4AA 5EJ9A 1X39A 2QTVB 5FA8A 1SXJC 3N0TA 5KDLA 1WKVA 3WYGA 3LC1O 2JGJA 1QAMA 3PHIA 3RV3A 1IAQA 3NYRA 3PCXA 1ZD2P 2L2QA 4C3OB 3ZQJA 1DWPA 1SCKA 3HMKA 2DBQA 1YR1A 5FUXA 1PVVA 3GLGA 5JATA 3CGGA 2NP7A 6ADHA 3AR3A 3DWEX 1DZIA 2VFAA 3SSMA 3TVTA 3V8NA 2XUDA 3PHJA 1ZJ5A 4XOIA 5LWQA 1D2NA 2AOXA 4HFRA 1P5RA 3CT4A 4KQKA 2NSYA 4MX8A 5CB0A 2EKBA 4DF3A 2ZR0A 3L7JA 4DWWA 2JJ2A 4C78A 2HHLA 1S2DA 1TB4A 5CR9A 1KYTA 3SM3A 4DAOA 2I8LA 4EHIA 1G8HA 5JDCC 4S0XA 5BORA 4FR2A 2WAAA 4PYOA 2BKVA 1L9KA 2QTVA 4ZOQI 1I0LA 2PXCA 2G1AA 4FNGA 4DV3B 3JQEA 2VPWA 2G5CA 4ZHQF 4LMBA 1ABBA 4M1MA 1RM0A 3NVAA 5IMSA 3HFJA 3CH6A 3PVSA 3EWAA 3KX2A 1TM2A 3GGDA 4GVXA 2AJ8A 4TSKA 1PNTA 1P4SA 1UQTA 1CUIA 4UUBA 4RY8A 5J2TF 5ENDA 2CLIB 1WXDA 2WZCA 3NDRA 2XKJE 1ZG3A 3T5GA 4P86A 3B2EA 2PFSA 3TVYA 4FYWA 5CXSA 1PEAA 2CDRA 2IEYA 3FTDA 1DFGA 4HX2A 5AKYA 1BAPA 2I2CA 1K9SA 2XT6A 5KOYA 4IMJB 1KO4A 4XTCS 3NV9A 3SMVA 4RVCA 4YH1A 5J23A 2OV4A 4BWYA 4EUEA 3A9CA 1Q11A 3O6VA 3T54A 1UWKA 1YRWA 2V7EA 4F5EA 2P6UA 4XX0A 5JHHB 1I5EA 3NDIA 2B1QA 4FZVA 3G13A 1XMSA 3RYHB 2W11A 2ZETA 1OA1A 4X6LA 3L82B 1LPPA 4GAEA 4AULA 3AG5A 2HWXA 5KNDA 3H9EO 3WL5A 4LF4B 2I3DA 2EJVA 1C9KA 1BWPA 1BQEA 1DQSA 4G86A 3M6WA 3DEZA 4PTZA 1LI4A 1PKXA 1NFFA 2ES4A 2HIHA 4IVQA 4JVLA 5I8WA 5CT8A 4BVLA 1Y7PA 1QUEA 2DBYA 3GAZA 4G36A 5EE1A 4I1VA 1HRDA 3ACCA 4Y9UA 5EESA 5EJAA 5H1YA 1EINA 1K06A 1SBNE 4CIVA 4GVPA 2O57A 1T10A 3C3MA 4G67A 4OHPA 5HBRA 2XECA 2F6RA 3IIMA 3W2EA 2B3DA 3CH7A 4UZEA 1T4GA 4YJ3B 3U17A 1J42A 3TR5A 3P97A 2F2TA 1NAHA 3VJKA 4EZBA 3EG9B 2QYOA 5BN5A 4KXLA 1R27A 5CXQA 1U9JA 3RASA 4XB6B 1WSAA 4KAAA 1U90A 3OX1A 2NT3A 1UDWA 3ZH9B 3I30X 3OFNA 4W5WA 2R8BA 2RAFA 1SUEA 2RG1A 4DA0A 1FNBA 1AHIA 3ER6A 3SF8B 2VPYA 3PNKA 4JJKA 5JMWA 2XSZA 4U6QA 4BUJA 3MLAA 3H2ZA 4BRZA 1J7JA 3WADA 5ALVA 4XIIA 3ZU2A 4E3ZA 5TE9A 4ARIA 1P60A 1KBZA 3PWKA 1RRGA 1JDVA 2CFIA 2VXBA 3FTCA 3GX1A 3SS8A 4Z5XA 2O52A 4JOCA 4KK3A 4HTAA 4RWEA 5HCNA 1YD7A 1YZVA 1LPAB 3ND8A 4I81A 4ZGWA