5AQEA

Cooperative bio-metallic selectivity in a tailored protease enables creation of a c-c cross-coupling heckase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords SUBTILISIN SAVINASE
publication title Bisubstrate Localisation by a Tailored Serine Protease Allows Creation of a Heck-Ase
rcsb
source organism Bacillus lentus
total genus 100
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 5aqeA00
2HD4A 1EA7A 2Z2XA 1BFUA 1A2QA 1BJRE 1MPTA 3LXUX 1SN7A 3PTLA 3BPSA 1SUCA 1SBIA 2P4EA 1TO1E 1GTJ1 1THMA 5I9SA 3I2YX 4CFYA 3GT3A 4HX2A 1WMDA 3WHIA 3F49S 1WMEA 1VSBA 1IAVA 1TECE 5SICE 5JXHA 4LVOA 5AMXA 1CSEE 3I37X 3VHQA 4MZDA 2GKOA 2X8JB 1R64A 3PRKE 2V8BA 3WIUA 3VV2A 4Z2AA 1DBIA 1C3LA 1GT91 3VTAA 4C3UA 1V5IA 1S02A 1SCJA 1GTL1 1BE6A 1SUPA 3DW1X 2ST1A 2W2MA 4K8RB 1R6VA 1NLUA 2XTJA 1TM4E 1P7WA 2QTWB 3OSZA 4ZOQI 1BE8A 3EDYA 1KE1A 1SELA 2PQ2A 3WQBA 1OT5A 3HJRA 1Y3BE 1V6CA 3D43A 3DE1X 3H42B 4BWGA 1SUDA 1S01A 1OYOA 1TM1E 3TI7A 4AKSA 1KDYA 1AV7A 4H6VA 1C9JA 3DE6X 3DE0X 2ZWOA 2SICE 5FFNA 4C3VA 1YJBA 1SBCA 1KDZA 1SCBA 4KPGA 2ID8A 1SIUA 5AVKA 1YJAA 1C9NA 4J94A 1SCNE 1GNSA 1Y34E 4FONA 1GCIA 1GNVA 4I0WB 1GA1A 3AJ9A 1AVTA 1Y33E 2ID4A 3DE5X 1Y48E 5AVJA 4HVLA 2W2OA 1PFGA 2WV7A 1R0RE 4JP8A 4YN3A 3QFHA 3DVRX 3GT4A 5B1DA 3VSBA 1DUIA 4CFZA 3TECE 1ZVJA 1SBHA 1CNMA 1JEAA 2W2QA 5K7SA 1PTKA 1ZVKA 1NDQA 1MEEA 1Y1KE 1SIBE 1SPBS 1BFKA 3CO0S 1T1IA 5JXGA 2PMWB 2PWBA 3D9QX 3TI9A 5B1EA 3Q40A 2DP4E 3AJ8A 1AQNA 5JXJA 3BGOS 4DWWA 2ZRQA 4DZTA 1BH6A 3A3PA 5FBZA 2G4VA 1TM7E 2Z58A 2PWAA 4NE9A 1KDVA 2Z2YA 5FAXA 1Y3DE 1XF1A 3DVSX 3DWEX 3DE3X 3LPDA 3ZXYA 3CNQS 2W2PA 3I34X 3DE2X 1Y3CE 1Y4AE 1PEKE 3AFGA 3UNXA 3DYBA 4KG7A 2DUJA 5ARDA 4CG0A 1SCAA 1SUAA 1ST2A 2IY9A 5CW1A 1SUEA 4OMCA 3F7MA 1ST3A 1YJCA 4NMXB 3QTLA 3EIFA 4OV6B 3SQOA 1TK2A 5JMOA 1SIOA 3DE4X 1Q5PA 1UBNA 1AK9A 3LPAA 1WSDA 1WMFA 1SBNE 1PJ8A 3Q5GA 4M1ZA 2IXTA 3QMPA 2PYZA 5ARCA 2Z56A 1SVNA 4NE7A 1KE2A 2DQKA 4KB5A 3DE7X 1GA4A 2Z2ZA 1Y3FE 2X8JA 1AF4A 1IC6A 2ZWPA 2PRKA 1Y9ZA 3GCWA 2WUWE 3SICE 1SBTA 4H6WA 3ZXXA 3A3NA 3VYVA 1SUBA 4WOBA 3VV3A 1TMGE 2SECE 3P5BA 3DDZX 1SH7A 1GTG1 4LVNA 1Y4DE 4WOCA 3GCXA 2TECE 2E1PA 4ZARA 4GI3A 2HPZA 4H6XA 5ARBA 2Z30A 1TM3E 2WUVA 3I30X 3A3OA 1EGQA 3DW3X 1GA6A 4B5LA 4OMDA 3DVQX 3LPCA 2PKCA 1C9MA 3F7OA 4DJ5X 1P8JA 3T41A 1WVMA 3WIVA 2XRMA 1YU6A 4RYDA 2B6NA 1TM5E 5AQEA 1NDUA 1TO2E 1OYVA 1T1EA 5JXIA 1SCDA 2WWTA 1LW6E 2SBTA 3L1KA 2SNIE 2Z57A 1S2NA 4AKTA 2W2NA 1T1GA 3BX1A 1AH2A 1AU9A 3EE6A 1P7VA 1HT3A
chains in the Genus database with same CATH superfamily
1QLJA 2CFCA 4KUGA 3CG4A 1NA5A 4I55B 1DEAA 1RQ2A 4LXTA 2EZ9A 4YLEA 5JARA 2G36A 3A9SA 3EC2A 3VH4A 1SA0A 4EZIA 5J2TF 1F0PA 2WWWA 4BCDA 3HCDA 1GGJA 3BSFA 2VNHA 1QVVA 3GZ4A 3GT7A 4KLCA 2JIBA 4KR9A 2PNJA 1E66A 3LG2A 3THYA 4NECA 1LDBA 1ONOA 1SUCA 3G1WA 5JRZA 1WY5A 1PT6A 1Q7RA 3EG9A 4L7VA 1QRAA 1T5TA 2WPDD 4RACA 4EQ6A 5E6RB 4P3OA 3UUFA 2ZB7A 1G3IA 1XJ0A 5F5NA 2M1XA 2JIQA 1KFCB 1VSVA 4DYDA 1TUGA 1PR2A 2CFTA 2XUZA 1HE2A 5AOVA 3WRWA 2IP2A 1EESA 3AUTA 4UBKA 1OHHA 1SA0B 3SR3A 4QRDA 5ADWA 5JU6A 4J6EA 3MLEA 1QKIA 4WESB 5JLAA 1OKKA 2QRHA 1TFRA 1ZONA 4ZV7A 3THYB 1V1MB 3GZTB 2YH2A 2ZJ8A 3OFSA 1H9CA 4N65A 5D6NA 1OY1A 2PK3A 2XDWA 2W2XA 4O63O 3I1IA 2O4CA 2FG7C 1Q17A 4CKEA 4PHGA 4EQ6B 4JI8B 2G1UA 3A37A 2A94A 3AOEA 1VFPA 3NI2A 1W35A 2LGJA 2ZRGA 3C2QA 4EI7A 8ATCA 1FRQA 2Y76A 3KQNA 3D6UA 5HKKA 5K9ZA 2UVDA 4WEQA 1NRJB 2OZEA 2ZK7A 4L8GA 4OB6A 2J09A 4EDHA 1KAQA 4BATA 4E2YA 1GEGA 1RRPA 1S2LA 1UKBA 4U0JA 4BO0A 2H65A 3K6KA 2XQFA 3CRRA 3Q6NA 4N5LA 3LZ6A 2IYOA 3JQQA 4LFBB 3C8DA 5SZIA 5ITVA 1ECBA 4BEWA 3ZYZA 3K0CC 4OXNA 2Z2IA 4ZAWA 5IUJC 4A91A 1J0CA 2PYDA 3RQSA 3PB3A 5TGTA 2AQIA 4M0KA 1QV7A 2XODA 4CKEB 1XRLA 4WI1A 4ESEA 4C7KA 2VWHA 4HJRA 5J43A 4RD0A 4CEIB 2VEDA 2BD0A 2QHXA 4W63A 4C0SA 2BGMA 1NIPA 4AMZA 3PNPA 2EQBA 4Z7OB 1RP1A 3GN2A 1YF3A 4INJA 2ZWVA 4J0FA 4DMHA 1FIUA 3DOEA 1MJNA 1PD1A 1CZLA 3FPKA 1Y8QA 1P1KA 1R6VA 2QVXX 4OH1A 1PL0A 5JADA 3ZV6A 3SBDA 1P75A 1CW2B 3OJ0A 1KJWA 2HKIA 2V96A 2NXCA 4MEJA 2W8BB 1X9IA 4F4JA 2DWUA 1EBBA 3VZCA 4ZOQI 2XPCA 2VHVA 4ZMRA 2RJNA 4NCIA 2K7ZA 1BE8A 4X95A 1DXOA 4WLOA 4PICA 4XB1A 3KG2A 4EZEA 1PSZA 3DCJA 1XD8A 4BE7B 2CCJA 2R7NA 2HHHB 3ZKAA 2HSZA 5EPOA 3KVNA 2ZATA 5AXAA 1R5NA 3WQBA 4B34A 1O96A 5C9ZA 1JDTA 3SZGA 5C2JB 1XTBA 1JWBB 4QO7A 2IS1A 3KQTA 3VO2A 2CFOA 3KC2A 2WYWA 3OIFA 4UAJA 3WLHA 1IOVA 1G20A 5FL3A 4YWHA 4XGQA 5BR1A 3CVYA 2CT8A 2O5CA 2WABA 2YWJA 1SUDA 5AJUA 4DCVA 3WGOA 1GU7A 2XNDA 1WOMA 4CMKA 1QZZA 1NW9B 1G6Q1 3C45A 5LWHA 3U61B 4Z4EA 3O2QB 2VT3A 2ZCUA 3C97A 1RPZA 2RFLA 2CNOA 3R7SA 5I4KA 6REQA 2XUGA 3F74A 1P0MA 3ZXSA 4X41A 1MJHA 3Q8WA 5B3LA 3PD1A 4RGQA 1DEXA 4H17A 4IZ6A 4M1WA 1DIGA 4QBGB 4BYGA 1WHSA 4UBJA 1O96B 2JAOA 4XD2A 1T5SA 3LWBA 3AZQA 4D98A 2GRJA 3A36A 4KQIA 1I7QB 3UENA 1U0BB 3B6MA 2ENUA 4F0JA 3GLIE 3UKJA 4WBNF 4MIYA 5TVKA 3ST7A 1S2DA 3OQIA 3DEZA 4RPJA 4YNBA 1V7PC 3E03A 4JFAA 2YWDA 1B8PA 1IXRC 4W7SA 2JFUA 2ODWA 3S5UA 4EUKA 2IYAA 4B6OA 2Q6VA 3G8YA 4IRXA 2QTBA 4ENUA 1EB9A 1W59A 3L5OA 3W9UA 1XLVA 1RWWA 1GNVA 1PYGA 1Z5OA 2UZ4A 1I10A 4D2IA 1EUCA 1WHSB 2CB9A 1L4BA 3D4IA 3LUFA 4JLDA 4TL8A 4V0MA 5DHPA 4N18A 3RVLA 3USCS 4QU9A 3KKMA 5CLHA 1IWBB 2ID4A 5C7LO 1T9ZA 2FN4A 4WFQA 3HSKA 2ZAOA 4LWZA 5JSUA 2E82A 3CLRC 2ZJ7A 3OQIB 3I2IA 3MMSA 1FS6A 1YXMA 3E1SA 3LFHA 4LC0A 2RGRA 5CBPA 2Q5JA 2FR0A 1PFGA 4O4JA 4Q1EA 4V03A 2YJGA 4JYAB 1R0RE 2YBEA 4JP8A 3DVRX 1E5XA 4ZQHA 1F9AA 4IR7A 1M1NA 4C0XA 1T3SA 4HN9A 4FDUA 5F3DA 1EUCB 3K9LA 5B1DA 3I9NA 3ROMA 3SEAA 4H35A 1W0KD 2OCXA 4ZANA 5JALA 5TQJA 3JTEA 4P34A 5EA2A 3QY0A 4E3ZA 5JD6A 3RVRA 1U3CA 1UAAA 2A0FA 2C0QA 3RV3A 4AWBA 2YRXA 3UBTA 4NMWA 4ZVQA 3CZ9A 3TZHA 1PV1A 3IR6A 3I9FA 1EGAA 1A5SB 4NYIR 4CI9A 1BOFA 3INGA 1ZM3A 1NFRA 5I7SA 1QHIA 1IM2A 2X4DA 4PC1A 3WFJA 4XUDA 5JCJD 1MJFA 1XAJA 1IJBA 4O4JB 3ZBPA 5F76A 4JLWA 5BWLA 3F7TA 5E3IA 4HOYA 3O4RA 1VE6A 1M1NB 1A9ZA 1EVYA 2UU9B 4OUDA 5K7SA 1PT8A 1T8PA 5D7NA 2OLEA 1UK8A 3IUBA 2JAPA 1D9XA 2Y6UA 2XUJA 4KE9A 4G5GA 3HWWA 3JRNA 3UCEA 4BP8A 4DW8A 1P4RA 1WV0A 1W19A 4PTYA 5D2CA 1E2IA 4D3XA 1JR3E 2F48A 1USGA 2IX9A 3QENA 2JI9A 3NCHA 1ISPA 4M0EA 4YCDA 5DN9A 3SQNA 1PRYA 1XDDA 2D13A 2D5LA 3WNCA 4GVLA 3ZCUA 2PWBA 5WRFA 3M1AA 2OO3A 1AMNA 4KPUA 4HQ6A 5KYVA 1T9HA 1ZZGA 4FOPA 3DFUA 4IQ8A 3UK7A 4ZWNA 3D4LA 4DUYB 1BO6A 2H59A 1G8SA 2VJAA 3G0CA 2JGDB 4MKXA 4Q3OA 1UC8A 1M6NA 1NOJA 3G8BA 3H3FA 3IVGA 3IAUA 4US1R 3KXLA 4P7BA 3AY7A 4JELA 4NARA 2FNAA 4OUDB 1BS2A 2RHHA 4OGFA 3QPDA 5FTKA 2V1UA 3T3DA 4J1QA 3ZQKA 4FNAA 1U8TA 4QG7A 3REGA 3C7AA 4NHOA 4Y2SA 4EM6A 2G3YA 1JU4A 2W6JD 5A9SA 5C8XA 5K0CA 5K8TA 2Y4NA 2CXUA 4DCMA 2RHRA 3Q72A 1ORTA 1U3GA 1MA3A 4Y6LA 3A3PA 3X1MA 3ONEA 5KNBH 2CLIB 2C9MA 2PFSA 2WP8J 3KLOA 2O5EA 1VPLA 4PNHA 4M3NA 1QGUA 1X3SA 2HA0A 3GBVA 3DLIA 3ABRB 1C7ZA 2PUVA 2DJIA 1LLDA 3G79A 3QX7A 3R0VA 2PXXA 4KYVA 5L51A 3RK0A 4LMAA 4PZPA 5EVJA 3GRZA 4B79A 5LDHA 1G5FA 4TKVA 1Q11A 5D86A 2CMHA 1Z6XA 1ODCA 4G3XA 2BIFA 2XYQA 2A1UA 4E5MA 4OQZA 4ARIA 3LC0A 2QVYX 4TPKA 5G0SA 2R4UA 3G6WA 2LTAA 4BNZA 2PZAA 5A9SB 3V1LA 1QFZA 4RTMA 1KJYA 2VSOA 4X93A 2IEDA 1W581 1GPWB 2JGFA 3N58A 3ACCA 4KH1A 4HLQB 1A3CA 1BVYF 2W2PA 3GFGA 1ZCFA 2Q1YA 3QUCA 1KOLA 3VVCA 1XALA 3KWJA 1QGUB 4JEHA 1QLWA 3AEKB 3TQTA 4V2UA 1G0OA 3KKOA 2JAHA 4DEXA 1E6CA 4YO8A 2PJZA 4TKVB 1ZNWA 4GP9A 4JLVA 3PC4A 4NG5A 5FBHA 3TLGA 3FCUB 2AXEA 2GVNA 1MO4A 4EHLA 2KMLA 2RI6A 3GEGA 3QVJA 4ABYA 1SVKA 1N5OX 3C24A 3NTLA 2QTZA 1U0FA 2V6JA 1P5JA 3PUKA 3KCQA 5LBTA 3BB3A 2FW9A 2CNDA 1P17A 2VQ6A 1XAGA 4MUXA 1BYIA 3A70A 4RVFA 4Y2QA 5ALTA 3U37A 1QPBA 1K5PA 3F7MA 4Q47A 1ORDA 4Q4CA 1X1RA 2HIGA 2Q1XA 1ST3A 1X7DA 2BKXA 2QAJA 3TL6A 1T43A 4W9NC 3TF5A 3D6VA 1ZA2A 4UU8A 1Q2UA 3K5WA 2XVYA 1THZA 2E6UX 1ZUWA 1D2CA 5IABA 3B5IA 3DB2A 1I4TD 4Y2RA 2XB9A 2GN6A 3WHPA 2IZ1A 3TLGB 1JVSA 2V4ZA 3SX4A 1FTWA 2I54A 5BORA 1EU1A 4A8JB 4XFDA 4KO1S 3RRMA 1LU9A 5AW4A 2ZT7A 1COWA 3OETA 1JG4A 4CL8A 1DOHA 2B83A 4R1PA 3H7IA 1Q5PA 5HCIA 1N36B 1YR3A 2KI5A 1VCNA 1LA2A 2OBYA 3REQA 4C21A 5DLDA 4F2HA 5A4DA 3W3ZB 1U7HA 3CWQA 3IHTA 1CZNA 1EXMA 4Y6QA 2P9FA 2IXTA 4GMXA 4RQUA 5CG2A 2GNAA 4FP9A 1X0VA 4GUAA 5DHTA 5DX0A 5EHNA 4QJBA 4C01A 5JCZA 3U1BA 3MJTA 2Z56A 1Z5GA 2Q4RA 1G20E 2O2EA 3DZ8A 4M53A 4NE7A 4WK0B 2JFNA 4B3JA 2YC2C 1KE2A 3FKSD 4AURA 4KXFB 3MOSA 2GN0A 3DMPA 4GP7A 1HV8A 3U80A 4F45A 2V7PA 4J0HA 2D7DA 4ZT3A 2OPBA 1ZIPA 4MW4A 4IOJA 5CNMA 3H9EO 3BL5A 3M6UA 4X6LA 2IXDA 2V9CA 4P6VF 3J81A 1E3MA 3PCRB 2BKVA 1PT5A 1Z06A 4REMA 3REQB 2ZWPA 1XP8A 3K9BA 3AERB 2PT9A 3U4GA 5HF8A 5EJ5A 4JNKA 4BKUA 2A0XA 4I81A 4JBWA 4LRWA 1LNSA 1C4XA 1Y7IA 2BZSA 4Q34A 2RHDA 2LCIA 5BSMA 5LP6F 3OVMA 4Y30A 3U3MA 4Z54A 3TIVA 5KZMB 2ZKIA 4LXUA 3NQ41 2FA9A 1D6SA 4ZVMA 2JHGA 4HATA 3HM9A 4YALA 1P1RA 1OFUX 3UF0A 3EEFA 1G98A 3I2JA 5EQTA 4KACA 3SDSA 3ZWNA 3VR4H 3E9ZA 2MWMA 4BZQA 4Y3UA 4RTJA 1YE3A 2ZT8A 2R48A 3GVIA 3PWZA 4ZCLA 4YAGA 2JGJA 3IUSA 1QZTA 3PXXA 3GJXC 2F8SA 4KOAA 1M2HA 1OZHA 4PLGA 5IFLA 1YV9A 3VHRA 2GD1O 5BWBA 2G17A 3K4PA 3L9WA 3EXEA 3ZHZA 2GQ0A 3CH6A 4WJKB 1WZCA 3BGSA 3K9HA 4QXOA 1BH2A 4XVRA 5A71A 5ARBA 1XZLA 1ZI8A 2RKBA 2WUVA 3ZBTA 3T99A 4AY5A 3T0IA 4MUBA 1HC7A 2HLPA 4CQJA 1U6JA 2EBWA 3U3RA 4H1HA 4Z1MA 3FMVA 3K1JA 3B9BA 4DNOA 1R00A 3SYNA 4DUGD 1SQFA 5GJBA 1N2GA 3A9WA 1T4MA 3R5SA 5DCUA 3T94A 4JP1A 2FG5A 1NNSA 3KJHA 3U62A 5I9LA 1J90A 4C2BA 2V5UA 5DYNA 5K03A 4YUWA 1CDOA 3EXEB 3RHFA 3PUZA 5KX5A 2UKDA 1P74A 1J2RA 2P6PA 3MWYW 2RIRA 2ZUVA 1ESNA 1QHFA 4CEJA 2O8FA 3HJUA 2BF7A 3WL7A 4ZDJA 5KQSA 1N33B 4S1OA 2HK6A 1T9GS 3PLRA 1IPEA 3LLVA 4HZUA 4IRMA 5GMOA 1ZJWA 2FZEA 4LX8A 3EZ9A 4YXWD 2B0JA 1S0UA 1VBMA 2XOKD 3R5TA 4JHLA 4U4AA 4BMYA 2CKMA 3VOBA 2QRVB 3MTAA 3KDAA 3ZW9A 4B85A 3RK1A 2WK1A 1MX3A 5EZYF 1U2EA 3FOAA 5K3CA 3TRJA 4PWYA 3NH9A 4ZRMA 4PXYA 4BNWA 2PH1A 5KX5B 3BXXA 1Q92A 1XZAA 5T6BA 4M1KA 2CDCA 3V00A 2BWJA 1YZFA 4BPRA 4CEJB 4P9NA 3TKAA 1PLJA 2CV2A 1XCGB 3LXMA 1YDMA 4V0QA 4UDYX 2NV2B 5JPIA 3RGWS 5HIAA 1Z6TA 1YB2A 2ZIVB 5HFJA 5K0TA 2N75A 1D07A 3SVLA 1P2GA 1XTSA 2IELA 4YT5A 4OTZA 2LWIA 2Z8ZA 3INNA 5BR7A 3ZY5A 4A8JC 4KMMA 5JDIC 2NVUA 3BK2A 3Q11A 3ZWPA 3K5IA 1KMCA 1OBVA 3LL7A 3N1UA 4Q4JA 5ETJA 4OI0A 1EINA 2WD7B 3N75A 1CQXA 4HXYA 2NZYA 4IZHA 4WINA 5HNKA 3GB9A 1Y9JA 5DNWA 5EUMA 5BW5A 2Q1TA 4MVJP 5D8DA 1S96A 2HQ1A 2ECKA 2RIPA 4YUXA 1BJRE 3DAGA 1MPTA 1WPXA 2BSAA 1XMIA 4BTLA 2VBFA 1W5SA 2JVKA 4D9CA 4PSVA 2ZJAA 5EIFA 4Q16A 1N5DA 3ETLA 3IKVA 5CDFA 1VPVA 4QLOA 1VQ1A 3RBZA 4AO6A 2WD8A 3H04A 1KOJA 1KJNA 5FL7A 1QQTA 2IEBA 3BDIA 3KDPA 2FSUA 4LJRA 1Y1PA 4LC1A 2NVUB 4Q4JB 5A4FS 2JA1A 2YWEA 2JCVA 1XCJA 2G40A 5C35A 1H4TA 1UPXA 3AONB 4G84A 1SULA 4WT7A 4JUBA 5L95A 3QE9Y 3IS3A 2EX0A 4FGSA 1RI5A 2P2DA 2HV9A 5JBIA 2VUHB 1CRPA 3IEUA 4ZICA 1N2SA 1JKFA 3B51X 1PFYA 1NQAO 3FJOA 2GEBA 3BQ9A 3IUJA 3QE4A 4I4LA 4RV4A 3S29A 2GN4A 1U11A 2OZVA 1ONNA 2PMCA 2Q3HA 5KQLA 5G0WA 4N4AA 2DSTA 4WNYA 1DAMA 5EKTA 4KQFA 1KYTA 3WJ2A 2XECA 1BJTA 4R2MA 3ZS9A 1ML4A 3GRAA 2QE6A 3FFWA 1JQ5A 4UHJA 3JWHA 1KFBB 1SHTX 3JD0A 4TL6A 1E7RA 2AYYA 1U99A 3O9ZA 5FBWB 1BVUA 2ONZA 4OA8A 5HDBB 3TSYA 1IUPA 1OX6A 1RBQA 1OFTA 3HG7A 1BD3A 4AZ0A 4F3CA 1D2MA 4LKRA 1WX1A 3LK7A 4B4UA 4QM7A 1PJQA 1SRRA 3DDUA 3LO5A 3OM1A 2YV4A 3O4VA 4LHVA 3AF0A 4XJXA 2H1VA 3SXUA 4GE3A 5KHAA 3JSXA 5HX7A 4ZYYA 4TZ0A 2H08A 1ZK1A 4JJAA 1ZH4A 1DV1A 3NVMB 1T2CA 5AKKA 5DI9A 5KYXB 5J59A 4EG1A 2ZJOA 2OO5C 5BMVA 1UKZA 2PBZA 3VRHA 3S2EA 3VV2A 2XR1A 2ZIFA 3SI7A 2QTRA 4JWTA 4O2LA 2ZITA 3A04A 1DEOA 3VBEA 2VYNA 3GP5A 3JPYA 2C92A 5ALMA 3IT1A 3BD9A 2WVAA 4O3FA 3SAJA 2X0FA 2W6NA 5THKA 1KI6A 1QPGA 4NBNA 5JCPA 4OBEA 4AZ0B 1VB5A 3HA3A 3V1YA 5DN6D 2QRQA 2AOUB 1VLJA 3HCFA 3MCUA 3WRVA 1WXFA 2XH8A 4JH0A 2H1LA 1SG6A 2X5OA 3VPAA 3OIGA 1R9JA 2XTJA 5HF6A 5TARA 4RJ2A 3KQOA 2EARA 3LQKA 3VSEA 3PJEA 2X7HA 1WTCA 4NH0A 1NBMA 2H2WA 4OQMA 3ZOZA 2Q6LA 4C7OA 5BSHA 1Q3KA 1TB4A 2C2YA 1WMSA 4G26A 4LRXA 5G2OA 4XUEA 3EBLA 1D04A 2HK7A 4MV9A 4BLRA 4CG1A 2H5IA 3C39A 4ZOCA 4LZAA 3KT3A 1CYEA 4QFMA 3QA3E 4J4TA 5HUQA 5B2FA 4RDHA 1U0HC 2ZBDA 3DE1X 1ZGBA 2C7BA 4IHAA 1LQTA 1KI6B 1KNXA 2PVSA 4ZP1A 3E84A 2C57A 2Y1DA 5CHEA 1AA6A 5CFQA 3JQFA 4YQZA 4LJSA 1DOZA 1W5AA 2HW8A 4NCJA 4DLVA 2Y68A 5AJWA 4Z4FA 1JNXX 3WI7A 4B3DA 1JIVA 1ZKDA 5JNVA 3GMTA 4ZT4A 1JT2A 4RJLA 3OCWA 1ZRNA 5A4AA 1IG0A 2UUOA 3PXUA 4TM7A 2QA5A 4WBXC 5K6AC 5DYWA 2X0JA 4S1TA 3HVIA 1HY3A 3QP9A 3UY4A 3K9FC 4NMHA 5D00A 3L8YA 1TTQB 1W5TA 4TRJA 5A3VA 3SC3A 5J4HA 1BU5A 3CIOA 3WK9A 4JODA 1K8XB 5FFNA 4F8JA 5KNCA 4INOA 3AL0C 5EYPA 2ZBEA 4XUGB 4Q4DA 5FPKA 2AZXA 5EHQA 3EOAI 1QGDA 3TUZC 2CYAA 2GZDA 1T35A 2IPXA 1JVBA 3L0PA 2C2ZA 4MUKA 5BQFA 3MELA 5IAEA 3W2EA 2BM0A 1LV8A 3OOYA 1CUXA 4PCAA 3SZLA 4B2IA 3H1AA 4J03A 1KJ9A 3CLSD 4MMYB 4UCXA 1CETA 1EE1A 3RC1A 4H4DA 1CUGA 2AK2A 2GDZA 5BW6B 1QPZA 1H42A 3DVAA 1W52X 5F64A 3V48A 4DJEC 5L6MB 1J5EB 1D4FA 1E1YA 3JQ8A 1X13A 3DBHB 4Y2VA 2O52A 3RTBA 2HUPA 1V1JA 5DBGA 4IDPA 4FYVA 4G65A 1PKEA 2I5PO 5FUWA 2BGGA 2ORIA 4MP3A 2BMAA 3R0QA 1Q3HA 3BD6A 4XM2A 1JXOA 1W49A 2HPAA 4FZ5A 3CN7A 3IOEA 1Z5UA 2XVMA 1P7PA 4Q7LA 5MDHA 1Z0FA 2BFBA 2GPYA 1EFDN 4HMPA 3R0ZA 1VKHA 3JSAA 1GV1A 5LZ5A 1GFZA 1ZW1A 1P5ZB 3JQ8B 3QKUA 1LBEA 2AF3C 3ZHBA 3RV4A 2ZG6A 4KGDA 3AEUB 3LP8A 4WMLA 4Y6OA 2CCGA 4P80A 5TE9A 5I7EA 1JG2A 4RTPA 3A06A 1YULA 3FZNA 3A1UA 3A6ZA 4FYXA 10MHA 4P0QB 2AI3A 1ZCZA 3W4IA 2WJ6A 1H0RA 5A03A 1M1XB 4KWEA 2PKWA 9ABPA 1PZHA 1W46A 3DTNA 1RWNA 4II7A 4UTOA 2EX4A 4W5QA 4CEHA 1I51A 1R0ZA 5LN1A 4K9SA 5ALJA 1TW2A 3CPHA 3ZJ4A 1P6XA 2BFBB 1RJ9B 2PLNA 1JDSA 3FWZA 1RJFA 4WERA 2EU8A 2YXLA 5AUOB 3J80A 2PUJA 3VHXA 4CM8A 3DWIA 5CB4F 3NPAA 4YGXB 1GQYA 4YT4A 5IBCA 1WDLA 1UMCA 3ETGA 4R8VA 3AEXA 3L6CA 2W90A 4KIGA 3L8ZA 1BHO1 1JLRA 1RAHA 5P8WA 2A5DA 4JL5A 1B93A 3H2GA 4NFHA 2C4HA 2Z98A 2HL6A 3IH5A 1OXUA 2YY5A 4M1OA 3QSYA 4CEHB 5DXFA 4H1VA 3ZGXA 1Q57A 3H2SA 2OR3A 7MDHA 1ZM2A 1FTQA 2J9FB 2Q2WA 3G8AA 2HEGA 3HABA 2EWMA 3K1ZA 2JEZA 1E7WA 4DILA 5FQOA 4I5FA 4OD0A 3EZ6A 2F1RA 2VI5A 3D4NA 5ELXA 2P2GA 2R8XA 2X58A 1NJGA 4XWKA 1QP0A 1ZESA 2G6TA 3NKLA 4QOEA 1AQIA 5JSKA 3ER6A 2RBKA 4HWTA 3HYTA 5A7FA 4NMLA 3DAFA 3ZGNA 3KKNA 1E6WA 2RJOA 1ZU5A 2ZIXA 3N8DA 5DRTA 4CL2A 5CDFE 5IT4A 2XDQA 5DM2A 1NVUQ 2W2KA 4QBIA 4HADA 2WM9B 2WR8A 4DY4A 2CE2X 3DZHA 1HDEA 3K9QO 2D8AA 3L5KA 4FFRA 2WJYA 4J9UE 4OP3A 3BMXA 1YZQA 4QEZA 3MHTA 4RF2A 3ZDCA 3TVTA 2NP6A 1DIRA 1JPUA 1W44A 1C9DB 1IZYA 3N39C 3W9BA 5A0TA 3CO5A 3GLGB 3QOYA 5DCYA 1V5FA 3UK0A 4KVGA 5B7QA 3ET4A 1XNJA 3FVQA 2RE8A 3SYKA 1B3BA 1KERA 4WJLA 3ITKA 3E7XA 2E21A 1ZHFA 2GA9A 4IUDS 4L6IA 2C4NA 4TTTS 5EI5A 2XCUA 4JX9A 1N2ZA 3DYIA 3I3OA 3IC5A 5C4IA 1VMDA 2W2KB 2MDTA 2X6TA 3O7MA 5DASA 2PUGA 2IV3A 1Q0SA 1DWOA 3FSJX 5AQ1A 5C0OE 5ICSA 1B8UA 2Q6TA 5EY5B 3G2LA 1Z2PX 1JILA 4RKRA 5EMJA 1DLIA 3VNUA 4FW8A 2REQA 3F6BX 3HGTA 3JQBC 1SIWA 1L7MA 4XCQA 5C37A 2Q4DA 3AF1A 3P8ZA 1KJJA 3LOQA 2HV8A 4KG7A 3RSZA 2P5TB 2ZCVA 3NHJA 4RCVA 3THXB 4RELA 2OCIA 4MMZB 4PNPA 1JMVA 2B8WA 2FSHA 5DISB 5B3KA 3GEBA 1UBLS 3MGBA 3EGDA 4OQXA 5A6SB 3RLIA 2YMLA 2NSJA 1QIKA 3BWMA 1ZOSA 1GADO 2GJSA 2GBIA 2QRJA 2PIAA 5ALIA 4RTLA 3UA4A 3PEVA 4Y9DA 2IK8A 3LM8A 2C29D 4MW1A 5HFAA 2CUTA 3WKAA 1HMPA 1KH1A 1NFFA 3CB2A 1AE1A 1PS9A 2KWIA 2ZRFA 1E9CA 2DYKA 3QBJA 4F21A 4CFSA 1L5LA 4DL9A 1H8ED 2QQEA 1IVSA 4OYHA 2REQB 3DSRA 4K6OA 3VU1A 2UYOA 3BL8A 3D4PA 3OQ1A 1AQ6A 4C14A 3GFQA 2JLYA 3R6LA 2GPWA 4OLHA 1BN6A 5KYUA 3UW3A 1L2TA 4KR2A 4GOMD 1GG2A 1NBME 1X1EA 1JIKA 1GITA 1O8BA 1TYBE 2BKAA 2JA2A 3DZGA 3HVJA 3EGDB 3G0GA 2AHRA 5CDHA 4FZRA 3Q3JB 5TDHA 4ZO7A 2AOTA 5DSTA 4MVJH 4MXDA 3IAAA 3WKEA 1QGAA 5JH7B 4K9OA 5DGDA 4QXAA 3EK2A 3L6UA 3CVXA 2M6SA 5YASA 5HQTA 4PLVA 2I7TA 2ZJ0A 3VNAA 2C3PA 4EHHA 4Z0HO 5FB3A 4EHFA 2ZT6A 3QWIA 5TXGA 1I94B 1T8UA 4TMZA 1W29A 4O4HA 4DG9A 5K8JB 4NIMA 4YY3B 3G5TA 4BO9A 4LNHA 1VBFA 3MAAC 5KYUB 4O0LA 4ABTA 3DMTC 1LZLA 1VE7A 2W7TA 4UTRA 1BHQ1 5HP4A 3A4YA 3EPPA 3I6MA 5HM6A 1WETA 3AKZA 2HEIA 2GN9A 2EDAA 5JYBA 1NZFA 2XMDA 1J8FA 1P91A 1YS9A 4FEYA 3EAQA 4MS1A 1M74A 3E9YA 4RKQA 2QSJA 1YR7A 2E2WA 4RA9A 3ECCA 2QU8A 3PNQA 1N6IA 3LP5A 4TMXA 1DARA 5KVCA 2VR1A 3VYTB 3OO0A 4G4JA 4NDNE 4P8RA 1ABEA 5BSRA 2VAMA 1YI0A 2BCEA 2RGWA 3ZLVA 4JLPA 3AF2A 3PX3A 4O4HB 2WU1A 4A8TA 4RYLA 3V8PA 5JPCA 2ZJ4A 2EERA 3LT4A 1E9SA 3UAVA 4R31A 3CR7A 4OI1A 4X1YA 2IH2A 1Q15A 2P8JA 3I9LA 5ALSA 4HI0E 4L16A 1Q7BA 2Q4BA 4YMSA 4DXDA 3ESDA 1ZM4A 4MQ6A 4J1TC 4N0MA 4Q7EA 1NF9A 2PU7A 3RS4A 5JQGA 1XGKA 4MS1B 3UGKA 4C4RA 5J4YA 1K92A 3A6EA 4PPFA 5CEEA 4C9BA 5ADHA 3WIDA 2C07A 3HYSA 4G1EB 4QZVA 4TMKA 3IULA 3FIJA 2Y6VA 3WLPA 1DT5A 3INRA 5EL0A 3GOQA 5K5EA 3IAXA 1GU1A 1L7EA 2YNMD 4XKJA 5EVCA 5H5JA 1O95C 2VK1A 5BW8A 2MYUA 5TVGA 6YASA 1GA6A 2EG5A 2GPNA 3KU4A 3OJOA 2QTLA 3F3KA 4KYUA 4OMDA 3B3FA 4X1YB 5DGHA 3RRZA 3CJRA 1RQGA 3D8TA 3HYCA 2R1VA 4TRNA 1GTSA 4BC0A 5EE5B 3FGOA 2BJWA 4OFXA 4MQLA 4CKWB 5BSKA 3SIRA 3WXMA 5JQGB 3F7OA 1R12A 3VC3A 3IILA 1ZRSA 4DIFA 5IMSA 2I3ZA 3NWJA 1WDMA 3MCAA 3GUUA 3QQ5A 3WZMA 1J2JA 1O2DA 5FOQA 5TLSA 1KPIA 2DFLA 4N5HX 4OIMA 2DFDA 1BWPA 5EIBD 5KAMA 4B32A 1CT9A 1JLLA 4YWJA 1HORA 1NQOA 2LW7A 3BIFA 3QW4B 2AZMA 5TQVA 4LDQA 4QASA 1SK9A 5FULA 4DT1A 4CR8A 1H0HA 4BNNA 4QATA 3U4HA 2GF9A 1PJLA 3O83A 3RT9A 2EF1A 2VK8A 3MIIA 4PONA 3FPJA 3WWZA 2Y92A 2D7CA 2V7EA 3R5XA 3OE7D 3TX6A 3VU9A 1OIXA 2EL7A 3ZV3A 1TO2E 3CIFA 2IQIA 2Y1FA 1WCYA 4W8HA 1A7UA 4TVKA 2R1TA 4GECA 3BBPA 1VMKA 1MTOA 1ARZA 1K0FA 2XIQA 4RD3A 4TLAA 2NUPB 4U9HS 1SCDA 3SYTA 4D9IA 2GILA 1GPJA 2XA2A 3FH0A 4L28A 3CINA 1SUWA 5A5EA 1S9DA 4KUHA 4CRWB 3GLFA 4KQEA 3ZWKA 5LUBA 4RPKA 5J9FA 1JLLB 1UODA 5I7HA 4JSRA 1F2TA 3IIIA 1O3YA 1IY1A 4DT1B 5JUWA 3TB6A 4NCBA 2VOEA 4P4SA 3O9VA 3UIEA 3QHAA 3QXSA 4GMFA 3PPVA 2YVUA 2LUOA 2P6RA 1EB8A 1BWQA 2EZ8A 3VU9B 3SSMA 3HPQA 5DLQC 3A6JA 4UU7A 1WSBA 1FRVA 4HS4A 2R1TB 5JBNA 3J7AC 3ABZA 2ORVA 1XMVA 4P33A 4KQ2A 2QD1A 2YZMA 4ZEXA 2ENWA 2WAMA 3TLCA 2E87A 3B1XA 3LDFA 1EHIA 3P2OA 2ZM5A 2DFKB 5FNVA 4J0DA 3GLFB 3A1FA 4H2DA 2Y66A 4WA8A 4YIKA 3W2FA 1TKCA 3OLWA 1F2TB 3DLPX 3EQ7A 3W3AA 1WLSA 4GXRA 2ZBPA 2O19A 4FMPA 4P4SB 3BRSA 3U4CA 2PX8A 3D81A 4LYFA 3JU3A 2YBDA 3QHPA 1VG1A 3KJFA 2RGNA 1XEFA 2F8MA 2PUTA 1WTAA 1HI9A 2DY0A 1G9TA 4MRMB 4X5OA 2QZ9A 3MEQA 5EJFA 4B8YA 1R74A 4GYJA 2PRYA 5FPQA 1IY0A 1XZJA 3PGA1 3C43A 3UGQA 1OB5A 3JQ7A 2WSIA 1QONA 2Q5OA 3FHLA 1G8PA 4L02A 4RK7A 3IA2A 2PR2A 2BGTA 4MJXA 4E13A 2O8EB 3C1OA 2B8EA 1JDBB 2AI2A 3OY7A 1HDCA 3NNDA 4XQ0A 3WGTA 3DJYA 4ADSG 2D2IA 2PUCA 3V2UA 1CDZA 2PWPA 4KO2S 4DNQA 2MSNA 3TAHA 4IOMA 1GV0A 1U3VA 4E32A 3VR5A 1UC4B 2J5BA 3L0YA 4BGEA 4NV3A 2BI7A 2J08A 4DA0A 3T7AA 3GMIA 3ANYB 1KIFA 1E1CB 1KZ4A 2XBUA 5B3AA 3D0QA 2PZGA 2VNAA 1PLLA 2G06A 4A5OA 4DXHA 1GQFA 3Q3GE 2CC2A 4F3KA 1SC4A 4MYHA 1VHLA 5HMLA 3RTEA 3JWIA 1EX9A 1LPMA 2Z4SA 2VAPA 1Z0UA 5K3FA 3RWMB 3JQ7B 4WX2B 4C7XA 3ABOB 3IJEB 1WVGA 3SOZA 2BLLA 3BORA 3EVCA 1I9CA 2DPLA 1G3MA 2VNIA 3LGSA 4OA5A 4J0GA 3KIPA 4V24A 3WLJA 5KKNB 4BMDA 3OJWA 3PXGA 2EKLA 2YZ7A 4G8DA 3QU4A 3F90A 1TVKA 2QB5A 2F00A 1LX7A 5C8VA 1QUFA 1MHTA 2XTMA 1JSCA 1UEIA 3B9RA 2E5LB 3TW6A 5IANA 4Z2AA 3CF6R 4G1UC 2VDMB 4AK9A 3Q7QA 1XZMA 5I8WA 1U3FA 2FV8A 3PNYA 3VR6H 3IPCA 5BQ5A 4JYCA 4LV8B 2Y77A 1QIHA 2G0AA 1N1GA 2ZS8A 2IVZA 2X0KA 3CUVA 3NBAA 4RFLA 3BRWD 3H0EA 1ADBA 1A8PA 1XHFA 3FE2A 3L4BC 5FA8A 3RHSA 2X40A 1EP1B 3WLKX 2K4MA 1C1XA 1FX0A 3G3EA 3NV7A 4LCEA 4K8RB 4EW6A 2GK7A 4C7BA 4D9MA 3VA7A 2GCNA 4Y7DA 1U2ZA 1KAHA 4OAQA 4I9HA 4G89A 1P7WA 1ZHHA 1X7XA 1QCYA 5J3JA 5JLJA 1GZ5A 2XCTB 4U02A 1XHEA 2HA2A 2PS9A 3CNLA 4C0AC 4W7IA 2IW3A 1CY7A 3UUEA 4G0PA 1NSYA 2PQ2A 4WY5A 2GFHA 2C4KA 4QSHA 4B35A 3S99A 1KEEA 3K0AB 3HR7A 1FS5A 1IEQA 2HBYA 4YRTA 1OFIA 3AV3A 3I1FA 3QX9A 4Z49A 1YVPA 3D3WA 4BFZA 3FCYA 4R81A 3AINA 3CQ9A 5EMHA 2X4LA 4AG6A 1BTOA 1KKMA 2Z1MA 2I9PA 1G7CA 1C1XB 4P38A 1GNRA 1ODTC 2I4MA 3CSSA 3T5DA 4LF9B 1OROA 4HH0A 3M83A 4X20A 1BS9A 1CY8A 2R84A 1F2VA 2AXPA 5TPZD 2ODNA 2QYSA 3C6KA 3KFLA 4C0BA 2ZBRA 5JSZA 4WUTA 1JR6A 1R1DA 2UXBB 1M0WA 1RLMA 2QRLA 3S2GA 3W5VA 4RAQA 4BP3A 2POQX 2IEIA 3VXKA 3X1YA 3ZNOA 3WWPA 1KEEB 3L4SO 5J5AA 2EW2A 3C6QA 1LPNA 1JIIA 1YVUA 4PQFA 3DE0X 2JF0A 4PX3A 4EB6B 4UOQA 2QN1A 5FEMA 4DQDA 1XLTC 5FKJA 1RQXA 2GDJA 2YVKA 3D3WB 4YCJA 1OI3A 1EUDB 4D8TA 3E1KA 4ENPA 5KDOA 2CJYA 3GLHB 3L1HA 1DIAA 2C59A 3M33A 4KEAA 1L5NA 3IRUA 3L40A 1OXSC 5JNRA 1KAGA 1V8DA 5HE8A 1Z36A 5AESA 4DV7B 4X20B 1GO2A 1RXWA 2IOFA 3GX1A 2ZUFA 4BNHA 1YH3A 3SYMA 4EBBA 3BD8A 1YS7A 1YNSA 2OE2A 5JSZB 1XTJA 1BS1A 1N5IA 5A2GA 3HYRA 3RASA 4BO6A 1OX4A 3FBTA 3OOHA 3JQGB 4MQMA 3STTA 4AICA 1PWZA 2J07A 3HSYA 3M3PA 5JNUA 4F92B 1SO8A 4RXTA 3UA3A 3PF9A 3AJ9A 4JBIA 5DWVA 4ZZ1A 1EJBA 3KTFA 2J7PD 3LLCA 3Q2KA 4DLYA 2O8FB 1NVDA 3UJPA 1U7TA 1YJQA 4RY2A 1NVAA 2IHBA 4HK4A 2ODBA 4ZZ2A 1J07A 2DKFA 4Q7KA 5IN5A 3KB6A 1NN0A 2R00A 3Q1KA 3RVSA 5DM0A 4OHCA 4BVLA 1HNXB 3SY8A 1NXVA 1Q14A 3GEDA 3QEBZ 4GQBA 4E7PA 3PC8C 4DRXA 2H0RA 4NBLA 4P3NA 5FADA 3R24A 3KB1A 4EMSA 5LXTF 1I7SB 3B6IA 3AG6A 2V97A 4FE7A 3LXRA 1OX4B 2AYXA 1JQBA 4UNPA 2EIXA 2G9VA 3TMYA 5E1MA 3CCCA 4DUPA 5IDXA 3QPCA 4L0MA 4ARSA 3VZQA 4D4IA 1UPUA 3VTFA 4NPAA 2WQZA 3NV9A 1XRRA 2BFCB 1FU7A 2B9VA 2XKAA 2ZXUA 1P19A 1UPTA 3MPOA 2CCKA 4NRDA 3DZFA 3A4VA 3A2NA 2DBQA 1L4GA 2OQIA 2Y1CA 2CVHA 2ZZNA 4KXQA 3X43A 2XBMA 3K9NA 4BWVA 2A9OA 3PLAE 2IF0A 1HL3A 3JQEA 3AVPA 3OPQA 4OHZA 4DRXB 3TIGA 3B8HA 1MEJA 3LVQE 5J5CA 4KHPB 3QMWA 1YR1A 1MRZA 3N9IA 3OCJA 1NKTA 1E99A 4IVQA 4MJ3A 1TCBA 4D80A 4EK9A 5KCZA 4OHFA 4UKDA 5LA6F 3R7WA 1QS0A 4I08A 5HCUA 2G0NA 1NLFA 1CNEA 1XMJA 1XOIA 3GLFE 1J00A 2C82A 2ATVA 3LBFA 1NVVQ 2ESRA 4L5AA 4LNUB 1IMOA 2DR2A 3ROQA 1NDQA 4FYYA 1WB6A 1UJ6A 3URKA 3M5DA 1MEEA 2FPKA 2FSVA 2GLXA 2JHFA 2HSEA 1V3TA 4WKBA 4L4SA 3F98A 5IVIA 1X19A 1F8GA 2XUPA 2A9JA 4G4SO 3RABA 3RC7A 5DHAA 2I8LA 2P78A 3HZHA 3E81A 3F2VA 3KWMA 2WSSA 2EG9A 4DKXA 3T3HA 4K0KB 2NZXA 3M3DA 4OYYA 2DC1A 1H3EA 3MYRA 2BBOA 1G18A 2Y27A 3P2KA 4JSYA 3HZRA 5TSDA 3R7WB 5HJ7A 3AB3A 2EZ4A 2GAIA 1VKJA 4W6ZA 3IP5A 1K2WA 1KJIA 1JLMA 5JD4A 4RGYA 5CAEB 4ESVA 4PZEA 1ZYUA 4BS9A 2H2HA 5JAZA 2ZTUA 3DAHA 2Q1SA 1T1SA 2C88A 3BIXA 4R54A 1BEZA 1NOIA 1C9EA 2C4UA 1QCCA 1ND6A 1SKBA 3M6IA 4M8NE 3CG0A 3AQIA 4KOEC 2FPGA 4AWAA 1LF5A 3SMVA 1IEWA 2R7KA 2FFAA 2WT8A 1H1DA 4M89A 1WDTA 2H92A 2W6MA 3HWSA 4B44A 1UDWA 2QUJA 5L3RA 3GT0A 2DWCA 2CD7A 1W4ZA 4HBZA 3T3NA 2BKUA 4G0UA 4EPRA 3LVBA 1FDUA 3DV2A 1ACJA 9GPBA 4WCVA 3EZLA 1SXHA 2IWHA 4DRYA 3MRSA 4EG8A 2VSXA 1CQIA 3KHKA 4HQNA 1U0LA 4O2BA 4NICA 1HG0A 5TS3A 1IZ8A 4WKGA 3H5OA 2LIVA 3O75A 2DULA 1FYEA 3D4OA 3KPWA 4LDJA 1G17A 2OBLA 3I0ZA 5EJ2A 3PT5A 1P2UA 4IDCA 1MQSA 4KITB 1B16A 3P9NA 3C3YA 2AUMA 3I5AA 4OO3A 3ANLA 1SC6A 2FPGB 4PTLA 5GP1A 3E3LA 2A9FA 5IJAA 1S5PA 3SC6A 2X14A 3ZGYA 1QB8A 3N86A 4P2BA 2FP4A 3OECA 3GRPA 4K6KA 1W1WA 4F12A 1KAOA 1C0KA 2A0KA 4ZYUA 1L7VC 1BCRA 2CN1A 1NAIA 3L7IA 3N6XA 4O2BB 2I62A 2CMFA 4R71A 1Y42X 2ZBQA 4M55A 1DQRA 5KPJA 1F12A 4FCWA 2WF9A 4OL9A 3VR1A 4FDMA 3UH1A 2QLTA 2RAUA 2H4JA 4GZ6A 1RWXA 4C3OB 1O97C 2VP6A 4WN9A 4CKYA 1LJ8A 4A26A 4DZZA 1GZUA 3E70C 5BYAA 4QDXA 1TUIA 4OMCA 4C76A 2KW5A 3IE0A 1E5QA 3ELUA 1KP9A 1CNFA 1CV2A 2A4MA 3NDIA 4B40A 2PUBA 3GJ7A 1ISFA 3T4PA 1RAFA 4X64B 4A1OA 5DTMA 5NULA 3RHZA 5TNXA 2FP4B 3RKUA 1YIAA 2ZSFA 2X2FA 3IBFA 4LWOA 2Q7OE 2NV0A 3HC7A 3PXBA 1QSGA 4IW3B 4D44A 1BCRB 2FEOA 2BBSA 3CV3A 3ZCVA 1U80A 3EVBA 3ILSA 5H82A 4LF7B 2QLLA 4OU4A 5FUQA 3T7SA 5CITA 1E5LA 5JMOA 3P0EA 4EABA 1T9AA 3GFBA 3H3JA 3HB9A 1RPJA 1L7RA 1C9YA 1OXMA 2FHSA 3TXXA 5IDQA 5JY6A 1I0ZA 4Q6BA 5H0IA 3PHIA 2FJPA 3BC1A 2QQ0A 4DR6B 4PTZA 2X41A 3E9DA 3Q8KA 3F1KA 2E5FA 1YBFA 3GFVA 3VR2A 1SJ9A 2XA9A 5IZ4A 4Q9NA 1VMIA 1FF9A 4KH0A 5J40A 3GYGA 5BUZA 2UXCB 2I2AA 1G6HA 5KOHB 1FQOA 3Q10A 1ZGCA 5C3UA 1U5AA 2AFHA 2GD0A 5F2KA 4FOLA 5CW2A 4DHWA 4U0KA 2XYGA 4GKJB 3COYA 4HDQB 2C0PA 3ZTTA 1U1CA 3IPYA 4V3BA 3D2AA 4BU0A 1M67A 3ZCPA 5BYJA 3AL3A 4J0CA 3BH7A 3NEPX 3WO1A 2J67A 2X8JA 4I5DA 5FYQA 1NSTA 3UT0A 1IC6A 3L6BA 4X84A 1XU9A 2IYVA 2Z1NA 1ZQ1A 1YQUA 2A4KA 4JI6B 1J8QA 3H8VA 3FB4A 1NVGA 2HCRA 2JFQA 3U4IA 4H77A 3BF7A 1GSOA 3TIIA 3UXYA 2WVGA 1MVOA 1TMGE 3TR5A 1SXJA 3BSSA 4FUTA 5KNBA 2GVZC 1IBCA 4CM4A 2AFHB 2IT1A 1DL5A 4MAFA 4U7GA 1Z4JA 2CV1A 5IH3A 3KZMA 5HS6A 1U2QA 1CZKA 1UM8A 4PCUA 1HDXA 1RCUA 1G4HA 1TU3A 3LO8A 3DOFA 3RVBA 5DO9A 2QTHA 2OCAA 3QBTA 1AKRA 3QG1A 1G3UA 1O9HA 5COAA 3HYNA 1XNGA 3HU3A 1GFSA 1NYTA 2ZQYA 4ZPXA 3VNVA 4RAOA 3B12A 3BWVA 2ZYDA 2YY7A 4OXQA 4P22A 5BN3A 1AHPA 2HQBA 4KU4A 1YDHA 3FPBA 3SQWA 2WMYA 1LBHA 4CM3A 5C5IA 1ZCJA 5A2QA 1GOTA 3RIMA 5TY0A 1J56A 1WZUA 1LNQA 3V1MA 1P45A 3H5VA 5FA5A 2DZDA 1SOMA 4EUSA 3PWKA 1EGQA 1M2FA 3DW3X 3K16A 4CM4B 3JQPA 1AHIA 1JZQA 2VHXA 3GZJA 5C4MA 1A96A 1TVEA 2D5IA 4C6TA 1AS0A 5IK2D 1R16A 3OQHA 4MPJA 2P9BA 1DJNA 4QYXA 4BLUA 1JFTA 1PQ4A 3RCBA 3MPUA 3SSAA 4IVPA 4TTAA 2PKCA 2V58A 3I8SA 4RVGA 3TSAA 5JVDA 4ARBA 4GM4A 1IJEA 1WU7A 3F2IA 5TMPA 3C3XA 2O14A 3CZCA 5AVRA 1MX1A 5LQMA 1C4OA 1H9BA 4BVKA 2JI4A 3O3OB 2P2SA 3OFNA 4MWOA 5LQJA 1LJLA 3E8SA 3FBWA 2IGTA 4LQDA 1GL9B 4M9SA 1DCFA 4LYDA 5AJYA 3T34A 3NHKA 4F9TA 1AMUA 5T7BA 1CR0A 3VOSA 3B1FA 5IXYA 1QE3A 1RADA 2HHCA 4OBBA 1ACMA 1Z7BA 2H57A 4AZ3B 3L4EA 5CIYA 4R98A 2BEUB 4UXJA 2CWWA 2E4YA 5GOZA 2FVXA 5JVDB 3P9QA 3DD5A 4ZD6A 1ZNXA 5DM60 3T12A 5C7IO 4X7RA 1UF9A 4AJ9A 5JZBA 4O1MA 4RY8A 1DKQA 1GG8A 2O48X 3L1VA 2SBTA 4EH1A 4LTNA 1M8KA 2ZB4A 3JZDA 3T35A 3T1QA 1PT7A 1E2DA 2YXDA 2GX6A 4HAWA 5K3SA 4YRZA 1L5MA 2EJWA 1UBJS 3HDVA 4ND7A 3UMFA 2SNIE 4ZGBA 4AKTA 4Y0VA 5LR6A 2CSUA 3ZE6A 1U9CA 1WB9A 2J0SA 5F3RA 2W2NA 5LQKA 1YDEA 3BX1A 3PE6A 3U09A 1DPFA 3FWHA 2QRGA 3L6RA 3LMKA 5DT2A 2VUIB 4MW6A 2Z2JA 2VDJA 3T9BA 1EXVA 2FPLA 3E5NA 2BFNA 1KI8A 2AG6A 3KK0A 3KV3O 1CJBA 4F4IA 1Z4NA 1QUEA 3DHYA 2Z5GA 5AVQA 2RHMA 4H0CA 3BB4A 1IIBA 1DAFA 4M83A 1P4GA 5M3BA 1QXSA 3MAJA 3CW2A 3SJ7A 3TOVA 3WGKA 1SVLA 4FR0A 4BO7A 2O8BA 1FA9A 4FCCA 2PLWA 3JZIA 4LWPA 3AKEA 4UTNA 3FX2A 1NQTA 2G77B 3DLAA 2XT0A 2CHFA 3GPBA 4E1BA 1K8YB 4F7DA 3ETCA 3COZA 2CF5A 4TRRA 2P2NA 3O82A 2I6SA 1VP3A 4G0VA 4NWIA 2R2AA 1B6GA 3O84A 2X6QA 3OIVA 3ULKA 1XCMA 4HMQA 4HB3A 4O08A 1NRIA 1EWQA 1FVOA 4HY3A 2BYTA 2NPOA 3PFHA 4M0UA 4H60A 3TYXA 1MTZA 5JANA 4YJDA 1RWPA 3VR4A 4JLAA 1HZJA 3L6OO 2L0XA 3D7NA 4MB6A 3C5VA 3N2ZB 5FLEX 2D06A 2OSVA 4A15A 1YB5A 4GF5A 1PWXA 3GJ8A 2ZSAA 1I32A 2AEFA 2DTDA 4CR6A 4U6QA 2IZ0A 5DPMA 4ZHQF 1RJDA 2DUMA 2FWRA 3A3YA 3H5AA 4RD1A 5DW3A 4YAUA 3ZLBA 5IVPA 1ND5A 4NH4A 5EHIA 1KZHA 1BX1A 1NJ8A 1XMXA 2F3QA 3AOEC 4NBTA 4RIHA 1D5WA 4Y2XA 1L7QA 5U1PA 1QYWA 3PXAA 3IDAA 1JVNA 1K7FB 1SHJA 4IYJA 3OIWA 5IAAA 4TSKA 3UC9A 1CSEE 2R6HA 1UWLA 1WXXA 3BMOA 3G2JA 2P7IA 1JHOA 2XHZA 5JRDS 3KQHA 3D3KA 2BE7A 1BDHA 5TJHA 3KR1A 4G01B 4EJSA 1DBPA 1HDIA 1OAAA 1XNHA 4IMJB 5FFMA 4D79A 5C3MA 1P60A 4IGAA 4YP0A 3QEJA 1QR6A 1HPLA 3VX3A 2IEAA 1TZCA 3DGEC 4MOWA 1X92A 2NVBA 4FFMA 1RAGA 1GNLA 1L4NA 1A8HA 1CF9A 1P0QA 1UIRA 3KWFA 4H7DA 4JR1A 3WGUA 3VJKA 1C7EA 1U4NA 4S0ZA 5FQNA 5JS7A 3MIZA 4AM8A 4AULA 3L0OA 3TLJA 1B41A 4UQLA 4KQXA 5AI4A 1YZHA 1MZVA 2VXYA 2JZCA 4TV9A 5E9WA 4CLEA 2VTBA 2P40A 2E89A 3JPWA 1DB3A 2P41A 2W2MA 3BMOB 3DFZA 4JASB 3RGGA 4MITA 3FWNA 4K6MA 3FHOA 3TPCA 3VPGA 2JEOA 2WPNA 1DJLA 1A9YA 1TM4E 3UOAB 4NK4A 3KE9A 2BTQB 2C4MA 3RT7A 4AJJA 5LU9A 4E5KA 5PGMA 1C4WA 2CJFA 3DTYA 5BV1A 1J0DA 5EJEA 1XTRA 3HU2A 4CMIA 2JI7A 3L41A 2F6RA 5B57C 1EX1A 3K35A 2W70A 4LF4B 1IK4A 1JHPA 5CK4A 1NBWB 4JC4A 4GKAA 1ZXXA 2BMVA 3V97A 1LK7A 4FU0A 3OAAD 4Y6PA 5ALOA 1PK8A 3RS0A 3NB0A 2AFHE 3DHWC 3NRJA 4B46A 4Z3KA 4UE3S 4JJ4A 3GAMA 1SOAA 4M8LA 3RBXA 2AQKA 1Z82A 3OX3A 3FUCA 1PZFA 2C5LA 3CW9A 3LF1A 2F43A 3O3NB 3A4MA 4TV9B 3BS4A 3QMMA 1GPNA 4BWGA 2PGIA 2HA4A 5FTLA 1P2DA 2VDLB 1P4HA 3IE2A 2CD9A 1Z74A 3DHEA 4MVJI 1Z4OA 4Z51A 4Q01A 1Z0IA 3G9XA 4W5RA 2X7XA 1V6AA 4IDFA 3SQDA 5A4JA 1PG2A 2P1ZA 2QTAA 4CMIB 1U94A 3Q9LA 2XE6A 2JHAA 1DC4A 3L79A 1C0LA 2Y71A 2FUG1 2WILA 1OXXK 2FMFA 4QXPA 2ZRKA 2HREA 3NYRA 2ZDHA 4QICA 3MSXA 3SM3A 1SXJE 1R4ZA 1RLTA 3EMKA 5CYPA 1ORWA 4EF5A 3QKIA 1O0SA 2FPSA 4IDGA 4RVHA 4FMDB 3DDSA 1N4DA 1KDZA 4JC0A 3COPA 4LDRA 4B4DA 4D4KA 3U13A 2F43B 4UDOA 4DLAA 5MFZA 2WPDA 3QXXA 5FI5A 4RSRA 3G2QA 1UKAA 3BWBA 4JR0A 4L50A 1W6RA 4S05A 3QUAA 1NE7A 2NO9A 5G0VA 4RK1A 1NVEA 1SCKA 3P9CA 4N7JA 4F4HA 1DXYA 2H4FA 1D2RA 1NJFA 3FCXA 1TFUA 3H18A 4OY3A 4FGJA 5SZJA 5T4HA 2IOQA 3B3QA 2IYNA 5B7PA 1P33A 3UG6A 1ZRMA 1E58A 2QN7A 3GLUA 3UQYS 1VC2A 3ZD9A 2XGJA 1EVKA 4FMCF 1J8YF 4CR7A 2C78A 3TAUA 3V8NA 5G53C 1QGZA 3UT5A 3RAPR 3U7RA 1XZCA 3OEWA 1Y4SA 3T8YA 5JI2E 2HSJA 4MV4A 3ZWDA 3EC1A 5EXPA 3SJUA 2YIMA 4DS3A 1EE2A 1H9AA 1UBEA 1W0JA 4K6HA 3UW1A 4BXOA 1B0ZA 3BMNA 4S2UA 5KVSA 1NNLA 1RYBA 2PUDA 2BFDB 4QREA 4MKRA 1NJ5A 4FMBB 3K6JA 4EY5A 3TB4A 3HPRA 4NMMA 1C14A 1S8FA 2QX9A 4I50F 1AY0A 4GX1A 5AW7A 2JGRA 1V4NA 4GE0A 4BEBA 5BR8B 4UDNA 1W94A 1ISHA 2QQFA 3GT4A 4TXHA 1JDJA 1J39A 3PRJA 1YONA 2I71A 4D81A 2PAFA 4URFA 3UT5B 4TWRA 3GFPA 3PDCA 2CLCX 3OY2A 4IDBA 4RNDB 5L3ZA 5DYGA 3QTTA 1IXSB 4GOND 4ZYVA 8OHMA 1U90A 1PNRA 3TEFA 5LDDC 2OD7A 1QJCA 1MHPA 3NH6A 2BCGY 3GD5A 3EVZA 3GLQA 5IULC 2XCQA 1T6NA 3I6YA 3EMVA 3R77A 1DIOB 1KVUA 4IKPA 3C8HA 4K86A 3ZHRA 5AK5A 4D0LB 5BO5A 2ONKA 1R6BX 1MVLA 4JDUA 5HDQA 5BVGB 4OXKA 4HDKA 4M86A 3WG9A 5LKAA 2XCRB 4DC0A 1T2DA 3AUSA 3E58A 3PVCA 5L4SA 1YZTA 2X42A 4L8WB 5FBKA 4QUHA 1M10A 3SQXA 4JVOA 3BE6A 2WUGA 4TRMA 2J3DA 1I8TA 4DV0B 1JLHA 4EZBA 3C4QA 4Q37A 3MM4A 1D0SA 4N40A 3D6FA 4PHTA 3AF4A 4C6HA 5K0SA 3SNKA 5CT6A 1LUAA 1Y4UA 1L0BA 1PWEA 2XCIA 4IQ0A 3PQ4A 4ILEA 4PBRA 3L0IB 3KUCA 1N2HA 4KXYA 1O4VA 3BMQA 3A11A 2NO4A 3CF2A 4JHXA 2FZ5A 1K4MA 1HGXA 1EDEA 2ZBGA 4H1UA 4UBLA 1MMFB 4ALJA 5BSWA 2JIPA 4Q9IA 1DTSA 4CVNA 4IYRA 3L82B 1SKYB 4HSGA 3ABIA 3HP1A 3RVQA 3DAOA 4KYTA 1D7OA 4R1TA 1RKQA 4UQOA 3HEBA 5AK4A 3HK2A 3EZ2A 2L17A 2B5WA 2PY6A 1FFEA 2O0KA 2XVZA 3LT5A 4JI4B 3INTA 4MRVA 1QHHA 1CUSA 1QF7A 1Y5MA 2E48A 1C81A 1R3UA 2OGSA 2QUIA 1Z0SA 3GJ3A 5D87A 5TJ9A 2WFMA 3MMPA 4Q5IA 2PNFA 5B3JA 5JFGA 5DCLA 4J3FA 3S2ZA 1NLMA 3BMQB 3CRW1 4FBMA 2J5RA 5L40A 1Y3DE 2FPOA 3PZRA 2MSEB 3Q7RA 1KU0A 3WLRA 3HBJA 4YPVA 1XZPA 3HBMA 4E14A 2UZ1A 4OF4A 5IW8A 1C3OA 2QUHA 2VKQA 3ELWA 5BYBA 4MVJG 2JLWA 4QBFA 1FRZA 2P0EA 3FFBA 3Q41A 1X39A 3H9QA 3DE3X 3KZXA 4MHOA 2O06A 5AUNB 5CLJA 3ZDXB 4HWKA 3UMMA 5D5PA 5JW6A 3LH5A 1IVYA 1QHHB 3W0LB 2DTXA 4XSGA 1GL7A 2ZEJA 1FP1D 3L8HA 1JN0A 3L49A 1DKLA 2XQKA 1Z83A 2IHNA 1C3VA 1VCHA 1VP9A 3NHFA 3P45A 4BRSA 4F3TA 1MBZA 2EGHA 2O2JA 1FDRA 1L5ZA 3S7TA 2Y0DA 3NKFA 1SXQA 1DIBA 1GT6A 4WLEA 3FJ1A 4C5CA 4U2CA 1ZINA 2YV1A 2W6ZA 2AN1A 1Y7HA 1C8KA 2UZ1B 2AJTA 2H0AA 1C3OB 1MCZA 3EPRA 5ARDA 5GY7A 5BR4A 1J09A 4UHDA 3SC2B 3AVVA 5DHFA 1IHDA 3MS2A 2IY9A 4JLKA 1W96A 3RF7A 1CJCA 2BJVA 3HLYA 2JLVA 3ZGZA 1DMRA 1LFAA 121PA 2NZWA 3HY4A 4FYIA 1JALA 4NMXB 1PVOA 2GPJA 3FTQA 1AKNA 1JHYA 3EIFA 2PX0A 2GS9A 2OGTA 3TIFA 3HN2A 4Q6WA 5EIHA 1NP7A 2WTAA 3VYSB 5B6PA 1MFPA 4QGGA 1F7VA 1KHTA 3KHTA 1MAWA 1JT9A 2MJLA 2RGYA 1FFBA 2GEUA 2YXNA 2SHKA 4I46A 4HKTA 4JI7B 3B13B 1Q1BA 1E2PA 5ICEA 2Q9BA 4O2RA 3UK2A 2V7WA 1KO7A 4YRDA 3G0HA 2J9YB 5BN4B 1U7DA 2H7CA 1GUFA 5F21A 4QAJA 5KMGA 2C9DA 1FMFA 4C0HA 1AC5A 3UB2A 4QODA 1JQEA 4G4IA 1KQOA 1NSFA 4M98A 4DC9A 3DYVA 4JBGA 5DNUA 1AKVA 4YUZA 1UFVA 1LPOA 1XMSA 1SZJG 4ZAVA 3PJFA 5E0KB 2H0QA 1E9AA 4ZXPA 3PUHA 5GZ6A 5AW9A 3M4ZA 1CU1A 3T7JA 5IJ9A 2YJ6A 3HMKA 2CL7X 4U6NA 3RDPA 3BDVA 1FXUA 2YR0A 3TVYA 5DF1A 2WE7A 3DAPA 1BEUB 4PLZA 3ONNA 5CNKA 2WIKA 3V4ZA 2JGNA 1RHJA 1PQPA 2HWXA 5IC6A 3RJMA 3ANNA 3ZQ6A 3ZPXA 6Q21A 3AVUA 1K2VN 3NBMA 4MVJM 2NQTA 4TKUA 4E5PA 3IMEA 1QQBA 4QUJA 3C8UA 5FOTA 2ZE5A 2GCIA 3TDKA 1RYHA 3CX4A 2HMYB 1PI3A 1PHRA 1ZN8A 4ER0A 1U7WA 2XNSA 1WZ2A 4WOBA 5E7QA 4XD7D 1YZGA 2D4HA 4E31A 3IAFA 4ND8A 3MJSA 1PJ4A 1IM8A 1XA4A 2AC2A 3OJXA 1PGPA 1C7IA 3U5ZB 3TOSA 3T1OA 4Y2HA 4YCSA 1JEEA 4LQ4A 4B0PA 5IJ9B 5FORA 1HDYA 5J23A 4K6CA 1WRBA 2HJ9A 4M8SA 4OB8A 4RIEA 4E94A 3NPMA 4CMGA 1OYYA 1LLCA 1L4MA 1TEVA 4Q3BA 4EGCB 3HKDA 1FJHA 2XB6A 4EYSA 3PFNA 1KORA 1FFSA 1A69A 5G1PA 4C05A 1CUEA 3CX6A 2F9FA 3QHQA 1L1RA 4IJQA 4J76A 1KMMA 2ZXEA 4FD3A 4O5OA 4YO7A 5CYOA 3SQLA 5JROA 1LDNA 2NXJA 2HK9A 3EDCA 1E2QA 1OFUA 3I52A 1I6MA 5H4HA 1WSWA 2CMGA 4Y0NA 3PF8A 5AHOA 4BRUA 1ZR2A 3FSRA 1SBZA 3CVOA 1UMDA 4GC9A 2GXSA 3LUCA 2HBQA 2ZR9A 4IF4A 3THSA 3WWYA 5A9RA 2HCTA 2FK7A 4NULA 5E6UA 1TUBA 1XQYA 4PHHA 2H06A 3ZV5A 2JLQA 2CE7A 3EVGA 3L0CA 2V6BA 1F48A 3HKDB 3PEFA 3O91A 5LQCA 2E4AA 3PC7A 5J5VA 4RZSA 1X1AA 3FXAA 3QWFA 5KQMA 2EBFX 3AW8A 1VIYA 4Q4AA 1C1DA 3GRYA 3KZCA 1YU6A 5DBIA 2BGWA 1VKRA 2C9BA 2DQZA 2NSLA 4M60A 1N34B 1P9RA 2GTHA 5H4GA 3TSCA 4WOPA 4BJ3A 1Y5RA 3TBFA 3C5EA 5FWXB 1DKMA 3AHFA 4JI3B 4FC7A 4PO9A 1ZGAA 4AJIA 5IU6A 3CLTD 4XWYA 1DP4A 1UMDB 2ZAIA 5TPWA 4DKJA 2YCLA 1NDUA 2X9VA 1TUBB 2P9TA 3RC2A 4DYVA 1FSSA 4QL3A 5IJZA 4I55F 1KI4A 4KIFA 3HSSA 3PGLA 3HCEA 4W9MC 1XTQA 1LZKA 2Q5FA 1RRVA 3K6RA 3OTQA 5ER6A 1CR2A 1A1VA 4GXNA 5C46F 1T0HB 2EZUA 2WWTA 2VHEA 2VYQA 1SKYE 2ZBVA 3OLCX 4G0MA 4Q4AB 4UFNA 1C1DB 1HE5A 1P2BA 4X6UA 2I2DA 3WISA 4QLBA 1UDCA 2PTGA 4O0MA 1MT3A 1Z17A 4P32A 2UYCA 5DGXA 4MVJA 3LD9A 3TCKA 2ZB2A 2ATIA 4R2LA 3TNYA 4QTZA 2J31A 3JALA 3L7JA 2G5PA 4FKBA 4UUBA 1XEXB 2JKYA 5TPWB 5BWCA 1JEOA 3I92A 3QF4A 3Q8MA 3NC4A 3N0VA 3RFCA 1A8SA 2B3DA 3TBHA 2PEYA 4QC2A 1G42A 3RYCA 1N2CA 2CL6X 5JAMA 2IY8A 3OH8A 3K6SA 2VP0A 3PYMA 4BO3A 4KXWA 3BILA 4B6SA 4EPXA 3IEVA 4K8OA 5ALVA 1X80A 4RK5A 2R1ZA 1XQWA 3PUVA 1H2BA 5AJVB 1EVZA 2VDOB 3ANMA 4ZKEA 1U2PA 3FSGD 3IQDB 5REQB 2H54A 4ZQFA 4UCQA 4QT0A 3Q4GA 1T0UA 1ML3A 3U56A 4I1VA 3G7NA 3K92A 5F12A 5GIOE 1FCJA 1L4HA 2CNNA 2D5BA 3OMWA 4O6VA 4UUAA 3KQYA 1VG8A 1XZ8A 3V80A 2E3JA 3JARB 3E3OA 4CLOA 1GKKA 5TT1A 4Q15A 3F96A 2Z6QA 3I2YX 5BSEA 1NULA 1NYLA 2WRZA 3M6VA 3E61A 2ZJZA 2WTBA 3R6GA 3K6SB 1B2LA 1G38A 2JARA 3H9GA 3MZ0A 3H5RA 2QM3A 1HEYA 3IQXA 2OFFA 1X80B 4GMKA 4TT3D 2NZ8A 3KB2A 4KQHA 1WMDA 2Q29A 5H7XA 3SHFA 1EP3B 4FEGA 5LZ7A 1KAEA 3IBCA 1EAMA 3M49A 1C7FA 2H5LA 2YUTA 4M1EA 1K6EA 4PVDA 1HT0A 4QUEA 1I2AA 2VPXA 2WJAA 3LA8A 4KUEA 4N3GA 5F4ZA 1K6JA 4A0SA 2R8EA 4N9QA 2QENA 1X2EA 1DPGA 4PX2A 4MUHA 1ZOIA 3N28A 4CLOB 5HTOA 1P73A 4PWZA 3TXYA 2D0IA 3GRRA 4RMHA 4CCYA 1HL7A 2A3RA 3WV5A 2BUCA 1YMUA 2WIJA 1Z2OX 3NTRA 4S1PA 2V98A 1F4VA 1YS1X 2BISA 2LV8A 3EC7A 4JU8A 4L07A 4MR9A 3B70A 2M98A 1P0PA 2NO0A 3TSWA 3I3SR 3JWEA 5FBVB 2P62A 4KMOA 3R1IA 2MOKA 3KVOA 5KI6A 1YUMA 1ZH2A 5BQPA 2OVFA 1A5TA 3RADC 1EDOA 2WYVA 3ME5A 3NX4A 3QMVA 1DJOA 1SKMA 1YQDA 3AHIA 3LVRE 5F1PA 3PRKE 1XDSA 5C18A 1U6KA 2VCHA 4HH4A 3M5WA 4EGSA 1WS6A 4EPWA 1LBIA 3CNEA 4HP8A 4LZLA 4ZEOA 5CB4A 5C5DA 1QTRA 4Q1BA 1II8A 4FIDA 3ZHQA 4L3WA 4R0MA 4PAQA 4HEJA 4JXZA 2OD2A 4OSPA 4G5XA 1E1MA 2Q07A 3N2GA 4DDHA 1O5TA 4HTFA 4GPEA 1E2LA 2OP0A 1L5FA 3IDFA 1XZFA 4YXWA 2R5NA 4YAEA 3LC2O 2XGSA 3LIPA 1YRHA 1VPWA 5C1DA 3NVAA 3CE9A 3E82A 2K6GA 4N3NA 4PY2A 1KQGA 3GDHA 3HDYA 3LBHA 3HDHA 5AIAA 4PN3A 3ZDQA 2BZ0A 4C88A 1L4YA 1EVLA 1BWSA 1TCCA 4GSYA 4P7GA 2P3QA 4IQGA 4KTVE 1W5BA 3D2CA 4DTIA 4OHUA 4QDUA 4A2QA 1FVHA 1SELA 2WF6A 4QE3A 2DLNA 1IIRA 1NBOA 3GGSA 5TEWA 5LBIA 3SJCA 3PKJA 5EWJB 4AZWA 3NCTA 4UMDA 3WDLA 2OHFA 3N2GB 4DA7A 4A23A 4HTFB 5EKDA 3KQSA 3LGAA 4Q0MA 1HRKA 5BRNA 4NABA 1JXMA 5KB3A 3LX4A 4M6WA 4MKHA 4PYRA 3GP8A 2QPTA 3LY5A 4AJNA 2IS6A 1NVFA 2GZ3A 2VPZA 1O6FA 2PVCA 2BGJA 3NHAA 4UTPA 3VZSA 3UYKA 4I4NA 2Z5FA 1FDVA 1D1QA 1IB6A 3NM6B 3Q2IA 3QVTA 3JD1A 3T15A 1Q74A 4L4ZA 5DX8A 3NBFA 4Z0NA 3EGXA 4QYWA 2WKRA 5EXSA 1HG1A 4BDSA 2Q50A 3A6KA 3CNNA 4R83A 1R0KA 4HF7A 3M9LA 1XT6A 4HDRA 4ARUA 1RNLA 2Q9AA 2R85A 4G8CA 2QP9X 3R0JA 1IQ0A 2VLIA 1GGVA 1D9ZA 2X76A 3D6NB 2GARA 3UEOA 3V4VB 2H1FA 5EZQA 3QH4A 1GCOA 1RWOA 3MRVA 4JEUA 1Y80A 2DX7A 2ID8A 4M6WB 2VHQA 4QBHA 5KTTA 1OPXA 2PUEA 3ZW7A 5EJ8A 3LHDA 2ERXA 2V6IA 3RVDA 3SZ3A 1FBTA 3NOVA 2TMYA 2FZ4A 1FPQA 1YB6A 5JZOA 3R8FA 2IPAB 2PFKA 4GQAA 3RJZA 1Q7EA 1ULAA 2JAQA 2V4MA 4ACAA 2RGEA 2Q0QA 2D8MA 5FJJA 4UXHA 1V0JA 2VHCA 3PFKA 4I8DA 1GNSA 4LJKA 1PU2A 5I9IA 2OCGA 5DX1A 1UIMA 3DBIA 1EP2B 1PSWA 2OBXA 2V74B 3QRWA 2LIPA 4IIEA 1AKYA 4HDRB 4OGKA 4G81A 1NX6A 2H1RA 1QVZA 4MWSA 4BNIA 5AUPB 1CUJA 1IWOA 1WBDA 1ORIA 1QIGA 2ECFA 4ZODA 5FFFA 3B2EA 1HSOA 3BAZA 5B7NA 4O4JF 1J97A 2P6NA 1DVRA 4GSKA 1GAWA 4EIWA 1FTSA 4F5ZA 4YCLA 3IURA 1XKLA 4AY6A 1ZXLA 3VKHA 1Q0HA 2FTKE 2Q1WA 3R7BA 1N3IA 3PD0A 4AZSA 4CDRA 3ETJA 1GZ7A 3HJCA 5AOCA 4A6DA 4UTVA 1IBSA 3LT1A 2H51A 3L7LA 4E5DA 2G28A 2C20A 2BP7A 4BJ1A 4CM5A 2BI8A 1R4MA 3OWOA 4Z4GA 2PQ0A 3SLRA 1HYBA 2VJQA 4HB4A 4L0DA 3W9YA 3OESA 1AUOA 1KNQA 1XZDA 1RXYA 2FR8A 2QTMA 2Y9PB 2E6KA 1US8A 3RRNA 5LVAA 1TPZA 4RULA 1A9QA 2GTPA 4HNVA 2QLJA 4GOXA 3I0MA 4Y1RA 3RYFA 3TFWA 4MARA 2AOVA 2O05A 3DMFA 3GOHA 3QPBA 3TECE 4IIJA 4IDQA 1FOEB 4JJZA 4YMIA 3WHLA 1L9XA 5AK6A 2R62A 3ASUA 1G2PA 3OM8A 4ZTBA 1V4BA 3AV0B 1R0CA 3CH4B 4L5CA 2FMHA 1PFKA 4I2NA 1DFIA 4KO4S 1R8SA 1QFXA 5A5FA 2GSDA 3S40A 3VI3B 1NATA 1QO7A 1W93A 5K3EA 4DZRA 4AY2A 4DMCA 2QT1A 1E2GA 3F6EX 5DFAA 1JV2B 1DAOA 2QMEA 3NHLA 2B1GA 4GFDA 1ZIOA 2EZTA 2BP7B 2HTEA 1R4MB 3Q6IA 3RSLA 3FJYA 2ILTA 1A9OA 1N5KA 2PT6A 5AICA 4BX3A 3N2LA 3VI4B 3KVRA 1RKVA 3ODGA 4MVJE 5BV2P 3Q5DA 4O4LB 2CV0A 1ODSA 4A5SA 1N2OA 1YJ5A 5ENZA 1SIBE 4FQ7A 3RYFB 3W4JA 2P9CA 3NBYC 2ZYVX 3HBNA 4LY0A 4X1OA 1U2RA 3RRFA 1XWWA 2PL3A 3B1JA 3Q7IA 3QYJA 4HYYA 1QGOA 4C7MA 5AM0A 3F9IA 1N2CE 1U2TA 3NANA 4WCDA 3D7LA 4XA8A 2XXAA 3BMCA 1E63A 4DNXA 1NTOA 3PDUA 3LQ4A 1PJAA 2ASEA 2MR6A 3JQ9A 4G25A 5L3SA 1VPTA 3LCUA 1OVGA 4F38A 4EY7A 4URVR 1MIHA 1I4WA 2WHEA 3N8HA 5DNAA 1FFGA 2JW5A 1S2GA 2RBEA 3T5GA 1RVDA 1SC9A 2M6LA 1PVDA 2HJHA 2QTNA 4QUIA 3FNGA 1GVHA 1A4RA 2HRZA 3TW8A 1M6WA 1UBRS 3LX6A 1E9BA 2F3RA 4MUMA 4XOIA 4V0LA 4ZU1X 1Z34A 3TQIA 1GTRA 4B45A 1YZ3A 3TDMA 4RTRA 3DT9A 4B47A 1N1DA 4B87A 3HO1A 5FTJA 2AF4C 2ETXA 5KTRA 1N5RA 3KQQA 2XXBA 5HWSA 3IT3A 3GR6A 1S89A 2IYFA 2XXAB 5GGYA 1WXWA 1KDVA 4GT1A 3C14C 1NU6A 4JUDX 2NYAA 2OZLA 3MNFA 4AD8A 3LQYA 4M9UA 2LCFA 2HNBA 1T34A 2RCYA 4BVAA 3EAGA 3PFWO 1K3TA 1L1QA 3FUUA 2IOHA 3U26A 2E4VA 1X70A 4HYEA 5IP5A 4GL2A 3FKJA 1EYZA 2GUWA 4P36A 3U3XA 1B23P 4YPOA 3ZJYA 1G8HA 1RAIA 4M54A 5C7OO 1RQLA 3B3GA 3BGIA 4D9KA 3T0GA 1KJZA 4R40A 3V7YA 3H9CA 5AK0A 2C54A 3I34X 5ECDA 4WWHA 1F0NA 1QM5A 1DQYA 1QV9A 2RJ3A 5IASA 1HX7A 4CQMD 2VATA 3LCVB 4GI5A 2D0PB 1M6YA 4HD8A 3D0KA 2JCGA 3KD2A 1NUPA 1V26A 3CH5A 3LPMA 3OQBA 1T29A 4EHNA 4KK4A 5H9VA 2Y0PA 3ZLJA 4W1SA 1X74A 2FPWA 2JRLA 4OKIA 3EHDA 4X60A 4JR2A 2FB9A 3SEZA 1DAEA 5LMCA 2ZXFA 4LHZA 5ALLA 3O92A 1KSFX 5JECA 1SM4A 3B9QA 1TT7A 3MJRA 1WXIA 4R7TA 5JMTA 2BR4A 2Q5HA 1EXNA 3LDUA 4RHCA 3EXAA 4FGLA 4PFSA 4FS3A 3L8FA 3AR8A 3FGZA 4N39A 2UZ3A 1YBVA 2NUAA 1W2GA 2CXRA 3BYZA 4IH4A 1NF2A 2DPXA 2OORA 2HRQA 3QVLA 3ZX4A 3AEZA 1JFFB 1BAPA 3FYHA 2V5VA 1TK2A 2EP5A 2A30A 3CU5A 5TB5A 4JLMA 3RU7A 2R8RA 3DEHA 3SZOA 4ZCMA 1NN1A 2ZROA 3KHSA 3ELYA 4H27A 2VQ3A 4X8HA 3CW8X 4X6YA 3C5WP 1CEQA 3QIAA 3U17A 1F8YA 1EVQA 4IFIA 4BWYA 1WMFA 2ZR0A 3A28A 3JQAA 1DC6A 4LE1A 5FP0A 5AD1A 2D00A 4V38A 4NDZA 5IBPA 1RWBA 4JV5B 4IMPA 2EJTA 2J9RA 3KTAA 1KEZA 4JP2A 3WC4A 4QIHA 5DM1A 2CLDX 3UAXA 4QGHA 1GXSA 1AS3A 4PVCA 4LOKA 4XDGA 2AQ8A 1Z62A 2WU3A 4FFPA 1ZW6A 5A05A 4I4TB 2OYSA 4AQ7A 2ECPA 3EWSA 4FFBA 1L5RA 2CNWD 2WB4A 3KXKA 1QDUA 3I9OA 2BFFB 3EVNA 1CS0A 4N03A 5M34A 1CB0A 2GD2A 2VP2A 3CZ5A 4KL8S 4TZKA 4ZRNA 5ESRA 4ER5A 2VHJA 3H4IA 3LE8A 3ENZA 1SEPA 3F3MA 4RWEA 5CURA 4XPZA 5JO0A 2PRKA 3DDCA 2F4VB 3GRKA 1RRFA 4AS3A 4AMBA 2HT1A 1SMKA 3KTAB 1XDZA 2DHRA 1N32B 4R3NA 1X86B 1JQDA 1GXSB 1RLJA 2B8JA 4HGPA 4C20A 4EP1A 1DLJA 5L9AA 1T8WA 2BH9A 1RYMA 1VIAA 3CKMA 1NV9A 3SBXA 5IT5A 3ELDA 3G0OA 1PT9A 4OHYA 1L8QA 2V55B 3GD7A 4A3SA 1IM5A 3DZDA 3OT5A 3JVUA 2G0TA 5FO1A 3RWOA 1POXA 1L4UA 4F6LA 1M6VB 4WDQA 2Q7DA 3QNWA 4WOCA 4BHTA 2B4KA 3WLAA 5TV2A 4BAGA 3H1PA 3NJ8A 5J63A 5TMDA 3WLIA 4DMFA 5I4IA 5KYGA 1E77A 1S8OA 3RC9A 4HAZA 4EELA 3CKYA 4GI3A 3LCRA 1ZH6A 2Q21A 3UWDA 2AV6A 2FQQA 4HX9A 4S2EA 4EY8A 2PGLA 5HRUA 4RMNA 4BB6A 3PFGA 5ENVA 2PXCA 3QLJA 3LBAA 2B7LA 1LTQA 3WFIA 5L7TA 5AO9A 1NXXA 3WL4A 1FNNA 3BXOA 1JTEA 1P7CA 3BKWA 4IS2A 1T8RA 2DAPA 1GGHA 1GWNA 3PUXA 3QE2A 1Z33A 3NIFB 4J6FA 3V2IA 2OXRA 2PE5A 3KSUA 2ZUCA 2BR3A 2D62A 3LHIA 2F2TA 2BDEA 1V5EA 3B52X 4IJ6A 3NATA 2HMSA 3ROZA 5H59A 1RTTA 3KKEA 4Y2YA 5KX5F 1RLIA 4DJ5X 1SD2A 3NETA 4JBHA 3UXMA 1Z2AA 4XJSA 3CF0A 4CG3A 1ZD3A 2GYWA 1BQ3A 3EIUA 1GQOA 1S3GA 1J20A 3M5PA 4C0JA 1L1FA 1AGXA 1VHQA 4JB2A 5FUBA 4F71A 3VGJA 5AM1A 4CU5A 4D6PA 5I47A 1UPBA 4RLHA 4ND1A 4J2TA 2WSYB 2WNHA 3W8FA 1ZY2A 4HUJA 4M7OA 3W77A 4D42A 3EULA 2QL5A 1OAKA 5CCDA 5IEBA 5A0VA 1VRWA 4LCJA 4B7CA 1F0KA 2PS1A 4DF3A 3SF8A 3FTFA 3OOSA 3R41A 2A8YA 4JP5A 2QPLA 2H48A 1RTKA 2VHUA 4I1RA 3WQRA 4DAOA 3X1JA 4N8EA 5F7OA 4MUFA 4AY3A 4ZMSA 4LTMA 1V3VA 4V0OA 3W05A 1LDGA 1H5UA 1O6BA 3H9BA 1WB4A 3I01M 1CE8B 2JFZA 3E05A 3QE3A 1R6AA 3DF9A 2W11A 3L1KA 4MR7A 3V33A 5AVWA 1KZYC 5FI3A 5I01A 3DOIA 4RBNA 5IHXA 2P4QA 4XWGA 1BC5A 5DNVA 5ALUA 3UJ3X 1RI2A 4KDCA 3ZE7A 5GPBA 3AKCA 3NNSA 3P2MA 3RVOA 1YACA 3QJGA 3E48A 4UPEA 4H18A 3SF8B 2BKLA 3H6KA 3KAJA 4BO5A 1H8HD 3K0EA 2VRNA 4QYMA 4IXWA 4ZYZA 4L1KA 2HA7A 2X5KO 5AYVA 1HT3A 4HVTA 1C5KA