5ARBA

Cooperative bio-metallic selectivity in a tailored protease enables creation of a c-c cross-coupling heckase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASCNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords SUBTILISIN SAVINASE
publication title Cooperative Bio-Metallic Selectivity in a Tailored Protease Enables Creation of a C-C Cross-Coupling Heckase
rcsb
source organism Bacillus lentus
total genus 103
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2015-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 5arbA00
3DW3X 1CNMA 1TM3E 1Y4DE 1JEAA 1SPBS 2ID4A 1C9JA 3DE5X 1Y4AE 3TI9A 3AJ9A 1PEKE 2TECE 5JXJA 2ST1A 1SCDA 2WUVA 1LW6E 3AJ8A 3A3PA 2DP4E 2X8JB 2ZWPA 4ZOQI 1TMGE 4GI3A 5B1DA 4AKTA 1TO1E 4CG0A 3DVQX 2W2PA 3BX1A 1WMDA 5JXHA 2W2MA 2Z56A 2SICE 3WHIA 2P4EA 2GKOA 3EDYA 3EIFA 1BFKA 1XF1A 1TM4E 1TK2A 1BJRE 1S2NA 1THMA 3DW1X 3Q5GA 4BWGA 1WMFA 4HX2A 2E1PA 3DDZX 4DWWA 5JMOA 1BE6A 1EA7A 2PQ2A 1TM1E 4Z2AA 4KG7A 4OV6B 4YN3A 1AU9A 1SCNE 1GCIA 1WVMA 1GNSA 1YJCA 1SVNA 1T1EA 3TECE 2PRKA 3OSZA 4CFZA 1C3LA 1VSBA 1SUCA 2PYZA 2Z2YA 2W2OA 1PTKA 1PJ8A 1S01A 4I0WB 1GT91 1A2QA 4H6XA 1Q5PA 1KE1A 2W2QA 3GT3A 5K7SA 3VSBA 1GTL1 4DJ5X 3D43A 4DZTA 1NLUA 3AFGA 3I30X 5JXIA 3EE6A 1Y3FE 1V5IA 1V6CA 1SBIA 1YU6A 5ARBA 4J94A 1OYOA 3GCXA 1CSEE 1C9NA 2HPZA 3I37X 5FFNA 1SBHA 4KB5A 1AH2A 3VV2A 1NDQA 1SUAA 1GA6A 1T1GA 4HVLA 2WV7A 1AF4A 3GT4A 1SCBA 1BFUA 2ZRQA 1EGQA 1OYVA 3DE3X 1SBNE 1C9MA 1SIUA 1GNVA 1SELA 1YJBA 3DWEX 4LVOA 4NE9A 1P7WA 3D9QX 1R6VA 3WIUA 5I9SA 3TI7A 3PTLA 4ZARA 1GTJ1 1Y48E 4C3VA 1MEEA 3DE6X 2DUJA 3F7MA 5B1EA 2WUWE 4OMDA 2SNIE 1Y1KE 3BGOS 4H6WA 4MZDA 2PKCA 5AVJA 3WIVA 4B5LA 1TM7E 3ZXYA 1R0RE 1NDUA 5ARCA 1PFGA 2XRMA 2Z57A 1MPTA 1KDVA 3CNQS 1S02A 3VHQA 3F49S 1SBCA 1GA1A 2HD4A 1BH6A 4K8RB 1T1IA 1AVTA 4LVNA 2PWAA 3LXUX 1WSDA 1DUIA 2PWBA 1DBIA 3QTLA 2V8BA 3DYBA 1TECE 3H42B 4WOBA 2X8JA 1AV7A 2IY9A 1UBNA 1Y3BE 1ZVKA 3PRKE 2Z30A 3GCWA 3DE4X 1Y3DE 2PMWB 1SUBA 1YJAA 3SQOA 1SN7A 1ZVJA 2G4VA 2QTWB 1Y34E 5ARDA 2SBTA 3VV3A 2ID8A 2Z58A 3LPAA 5JXGA 5FAXA 4RYDA 1SUPA 2ZWOA 1TM5E 3A3OA 1HT3A 4M1ZA 1P8JA 1SUDA 1IC6A 1SBTA 2IXTA 3DVSX 3DVRX 3QMPA 5AMXA 1AQNA 2B6NA 1GTG1 1R64A 3CO0S 3DE1X 4C3UA 1IAVA 4NE7A 1AK9A 5CW1A 5FBZA 3I34X 3LPDA 3P5BA 3ZXXA 4AKSA 3DE0X 3DE7X 3WQBA 1P7VA 4JP8A 4OMCA 2Z2XA 1ST3A 4WOCA 3BPSA 3VTAA 4NMXB 1WMEA 3Q40A 3DE2X 4FONA 1SUEA 1Y33E 3F7OA 1GA4A 3QFHA 1SIBE 3VYVA 3LPCA 1SH7A 2SECE 1SCAA 4CFYA 3UNXA 5AQEA 1TO2E 3A3NA 5AVKA 2DQKA 2W2NA 4KPGA 1KE2A 1KDYA 1KDZA 1Y3CE 1SIOA 1SCJA 3I2YX 3HJRA 3L1KA 1Y9ZA 4H6VA 5SICE 1OT5A 1BE8A 2WWTA 2XTJA 3SICE 1ST2A 2Z2ZA 3T41A
chains in the Genus database with same CATH superfamily
2I6UA 5IM4F 4KFTA 3W90A 1H0KA 4KFCA 3HP7A 4EUHA 1SWWA 4JT4A 3I92A 4JC5A 1JP7A 2NWQA 1EX1A 1QWSA 3DZFA 3NIBA 4QTUB 4GBGA 4ROTA 5FADA 2BFWA 3V8QA 1K7FB 4HTAA 2FPOA 4RHTA 4TV9A 2EZUA 5K1ZA 1E2NA 4HDOB 4O59O 3SYNA 1YUBA 1EXMA 1S8OA 3BICA 3K1TA 4UM7A 4MW7A 5DBFA 4EDHA 2XXBA 4C5CA 4O4LF 1DAOA 1SC3A 1G8FA 1VGQA 4ZJUA 4IIXA 4D9CA 1HK7A 3DWFA 3LBAA 5J4KA 1XLVA 3SR0A 1A8QA 1II0A 4JYMA 8OHMA 1L5MA 1NVAA 3IAM6 5KOJA 1XAHA 1HLDA 3KKNA 3F6BX 4RPIA 2WJIA 4DM7A 1QTIA 2REXB 1G8SA 3FZNA 3LWBA 1KAHA 5BUCA 3FYTA 3HLYA 5DKFA 5HK8A 1W2GA 1ZJZA 4ERXA 2W4MA 4HQ0A 1GQSA 2WAAA 4XSVA 1R8SA 1CQPA 4E5SA 1N8NA 1UJ5A 2VLIA 1E59A 3IXQA 1XDGA 2DP4E 2YFHA 3IR6A 1KMMA 3P4UA 4P31A 1M2OB 4DQUA 1HPLA 1L9XA 5AM3A 3W5JA 4YBRA 3G0OA 4CM6A 1LJ8A 2X76A 1NXWA 4YUVA 2WAMA 4RKWA 3AHEA 3DOUA 1JR3E 3L8FA 5CX1B 1COWA 2Q21A 3W7VA 4G5HA 1RI4A 5IJ0B 4ZO6A 5DISB 1TL7C 3KWJA 1PAUA 4PLGA 1DTSA 2X9VA 2C7OA 3HCPA 4C7OA 1TO1E 1UPCA 2BGMA 2UUPA 3RJZA 3D7LA 4IV5A 1XC7A 1HE5A 3MB8A 2RK4A 2Q4BA 3LKZA 1XMIA 1OCEA 2I1WA 1UZUA 3MILA 1YA8A 3OESA 4E5VA 2J3QA 3QJGA 3WXMA 4BYGA 2C5SA 4PC1A 5H4HA 1RC1A 1TA9A 2MSCB 3F9RA 2Q5QA 2ALJA 2EEZA 1DKPA 2F3UA 2JFXA 2B1QA 3DCIA 3G5LA 1JRLA 3L4EA 1U8FO 3O91A 4L8VA 4R8SA 4TOIA 3UKJA 5FOWA 4EY3A 1RZUA 4WFKA 2GD1O 2VAVA 4GI2A 1KQFA 1PV2A 4AX8A 3FTDA 3VM6A 5GVSA 2JLYA 5AIAA 3D2BA 3A4YA 1CP3A 2R1TA 4PS0A 1E20A 3WL4A 4YRGA 1H2EA 2XNCA 1JB1A 1Z6ZA 2HSJA 2CDRA 3TE7A 2B2XA 4JLOA 1UFKA 1GNPA 4XFJA 3UAOA 5JEEA 2NVUA 1MO4A 4FZ3A 2C20A 3LLVA 3UPDA 1G7SA 1VMKA 2ANBA 2JK0A 3E0QA 3F78A 1CNFA 1GCOA 3AQ4A 3BK2A 1N5IA 3KV1A 4U2CA 1XEAA 3VPGA 1QS0B 1CP2A 1X94A 3TUJC 3Q3GE 1ZWKA 1QTRA 1D2AA 1T4CA 5DLQC 4CJXA 3O83A 4DPKA 3FSJX 1NFFA 3WYDA 3BWXA 4E07A 3FIUA 3NHWA 1HZZC 4YDRA 3D8RA 4YRDA 5MF6A 4OXIA 4X93A 1XYGA 5FF9A 2AT1A 4LW8A 4OQXA 4ZMSA 2ZE7A 3EXEA 2IUSA 3NC1C 3SZUA 2HGSA 4IIDA 4URWR 4EW1A 1UZNA 4OV6B 1IQ0A 3NONA 1SHJA 1PJ3A 3EAFA 3I1YA 4H7FA 1PT9A 2GZHA 5TQ0A 4OHPA 2EP5A 2GN8A 2IEIA 4QVIA 3A25A 4Q39A 1K8YB 1IBCA 2W6MA 3F6RA 4NOKA 2WZBA 1ABBA 3KT8A 2ZJ7A 3GLSA 1W0JA 4IIEA 1KVQA 4UHEA 3VAAA 5AM4A 2BM1A 3Q8LA 2XB8A 4H18A 3ZGZA 2GYUA 3CNHA 2PYZA 4YRLA 1KAGA 4DG9A 1VHQA 4DREA 1TNDA 4I08A 4BLPA 1MOPA 4GPBA 1C9EA 3WDSA 4AMYA 2VQEB 4NXNB 4FI3F 1PTKA 4D45A 2X5XA 3E03A 1VE9A 1GNRA 1T2AA 3HP1A 1XVLA 2VHQA 4JEIA 1JFTA 3EDRA 1A2QA 4DR6B 1CR4A 4CDRA 2PX5A 3M4XA 3NRBA 3IBSA 1PG2A 4B4VA 5E6UA 3Q5DA 2Z9DA 4A6DA 1XZDA 4L07A 4QZVA 1E8MA 1BWQA 1FTWA 1PG0A 5DTEA 2QR3A 3GPIA 5DT9A 5EE9A 5ALVA 4MRNA 4YCJA 3WHPA 4HX9A 1A9XB 4D5EA 3BBPA 1QB8A 2XGGA 1CZUA 3K0AB 1OLXA 4MUMA 5CVDA 3RWOA 3D4LA 3O9MA 4DBLE 1GTL1 2VTBB 3R75A 1Y4SA 4QOHA 2JHCA 2O2IA 4JI3B 2Q7XA 2FNAA 3HGMA 4KAJA 3F90A 2IYTA 3P2JA 4C21A 1QAMA 2DOKA 5KCZA 2IOQA 4HH4A 2VP6A 4DMKA 2FP3A 2O2EA 1Y3AA 1QQTA 2G8LA 3GFPA 4K9NA 2VJKA 3O95A 3ODGA 1ESCA 3R7NA 2FLKA 4AS3A 3B51X 4UDOA 1M0WA 5IWAB 4HY3A 4Q9NA 1SBIA 3AR7A 3SPXA 4HGQA 1UBHS 1I4LD 3DGFC 4X85A 1JEYB 1HDZA 1FUEA 2IHJA 2WM3A 1RLUA 3GCXA 4OYYA 1QGYA 4MI6A 4ZYUA 3UEOA 2W9XA 3NHLA 2K7ZA 1W8DA 4N7MA 1W5EA 2MSWA 4NYJR 5FFNA 1TCUA 2X1MA 2CJYA 2H8KA 3DD5A 1N8KA 4DDKA 2JJ1D 3D4OA 3D8TA 2ZE6A 4N8SA 4YT2A 1KRXA 1BMFD 2XCIA 3A6GA 3WL7A 3GZNA 5J1SB 1ZU4A 4Z3OA 4Y7DA 1TZCA 1H85A 3CRRA 3NVMB 4JQOA 3CLTD 3HDJA 4OIMA 4I7EA 4N5NA 4YP9A 1ODCA 3EZNA 2OXEA 3O94A 2AVNA 1W5BA 3C14C 3AMVA 3MUNA 2JAHA 2EZ4A 4QTTB 1LI7A 621PA 3IDZA 2PSHA 4EF5A 2IS1A 4AKEA 3HA3A 1SZPA 5CM8B 2VJNA 3QENA 3FOWA 1L2TA 4POAA 3K6SA 2V03A 3PPVA 5BNFA 3GRRA 2TMYA 2YS6A 3NYWA 4W6QA 2ZBVA 4ODIA 2QRVA 2C8LA 1ORHA 2WF8A 2JA2A 1YZQA 4ZKEA 3U62A 2H4HA 2YIVX 1NOJA 2O0KA 2X4DA 4PHCA 3RU7A 2Q46A 3K6RA 5IUKC 3TSCA 4WLOA 4WK0B 4C06A 3PU6A 2ZRKA 1HF3A 1UPAA 2JF0A 3K71B 1DGQA 4OBBA 3ROZA 4RO0A 4B40A 2X58A 3B6KA 5JD3A 2JGKA 4EPXA 4U6SA 4DLRA 3F7MA 5IUJC 1ODJA 3KSMA 1TVKB 4BNWA 5HTOA 3PXBA 3BZBA 4JQSA 2DFVA 2GVZC 2G9UA 3NB0A 3OPYI 4KO3S 1N7HA 2QOEA 3FROA 1DV2A 5FBQB 1R0ZA 2MYNA 5FL7D 3VO1A 2JD1A 1UOEA 3QVXA 4IDFA 3DTVD 5HM8A 1VE5A 4Q3DA 4H7EA 2PGIA 1K7SN 3N70A 1T29A 3A1EA 1X38A 3CEMA 4HWOA 5A7GA 5KVVA 3BFPA 7REQA 3KYBA 2XDQA 4JEUA 2GRUA 4NL4H 1HURA 2Z4SA 4IMJB 3IP7A 1Z18A 1TTQB 1OX6A 1VPVA 3LPLA 2ZJFA 4X24A 1WE2A 1ZMXA 1JKFA 4BQQA 5JTUA 1ODSA 1Z75A 2F1KA 5JI2E 3RSCA 2L18A 3AR9A 4YMVA 3HJGA 3NGLA 4XJTA 1V3VA 1EK2A 3BH0A 2QD3A 3KJEA 5EWJA 1P5RA 2XVXA 2ZJ1A 4KV9A 2XRMA 3B60A 2Z57A 4NKRA 3VI4B 5KPDA 4E1BA 1JT9A 2OV3A 1BWPA 3DFFA 3M4NA 4CM7A 5JCPA 3KQKA 4KE9A 3STHA 2DXIA 1TQ2A 3GGPA 1O9GA 2OCGA 1XJCA 4G89A 1KZGB 3SFTA 4BO4A 2ROQA 3L1VA 3NW9A 5FWNA 1Z63A 2IHVA 4WLVA 4B8ZA 4QODA 3C3YA 1H69A 4EITA 3L0OA 4LS3A 2WAXA 5CH8A 1FW8A 4GEKA 3OJFA 2R6JA 2GVDC 3CY6A 1YJ8A 2O8CA 1BH6A 1V1MA 4BLVA 5JH7A 3KVRA 1ZN2A 3AQIA 3FYDA 2C88A 2RGAA 5A4MS 3I1FA 2GEUA 1DUIA 4JU8A 5A03A 1P61B 3DAOA 3ONFA 4PF1A 4PZ9A 5EIBD 1WNFA 5A0VA 3BQ9A 1P81A 2V7XA 3O7WA 4O2AB 1EG7A 4ZQCB 1TECE 1QIIA 2OCLA 3EH1A 5E95A 1LQTA 1TX4B 5CB0A 1PRYA 1UBTS 2D2IA 3O47A 4MRMA 4OGLA 5HQTA 1PDOA 4MR9B 4UQLA 5ITZA 5B3LA 5CBPB 3ISVA 4N47A 5TPWB 4GMFA 4AWAA 1EMDA 2C29D 2BHSA 1T5TA 5MDHA 1JQEA 4B6PA 3BMOA 3KUXA 2CLHB 3PQ2A 3I5AA 4O25A 1PGPA 1ZISA 4ZPXA 3BWEA 4I55A 4EGFA 1UQTA 1ID8A 3C1AA 4CKEA 4ZHSA 4HRVA 3F4LA 4QT0A 1ZAYA 4G5YA 2PG3A 9LDTA 3V7UA 1TEZA 2OUKA 1G9SA 5G1PA 4RQAA 5CA0A 1XZLA 5DBIA 3TM4A 5EP3A 2I03A 5TMPA 2DAPA 2XIJA 3JALB 3CIOA 2EARA 2B99A 3KEOA 2XDAA 4PG4A 1Z47A 4UDNA 4EEZA 4FLMA 2I2DA 4JGIA 5F12A 1GPMA 3L43A 1IZYA 1F5NA 1PJSA 1DRWA 2BHLA 1FTYA 3NWOA 3TJRA 4LHXA 1WRBA 2BJVA 3I9JA 2HSEA 3KPUA 4QVKA 4V0KA 5FOTA 1DAMA 4I9NA 4RIGA 1H1LB 2ZTVA 1YE8A 3RRFA 1PBNA 2QTWB 3D8HA 4F46A 3LT0A 5BW5A 2CFSA 1AQ6A 3MT0A 2NZXA 4TQAA 3ZY2A 5E6RA 3BFJA 4I9UA 2GX6A 4QTYA 2Q3JA 4B3FX 1E9DA 2ZULA 1EP1B 5BYBA 4F6RA 5C4IA 4WPGA 2ID8A 1D6NA 1EUCA 3HADA 1XA4A 2KWIA 4YJGB 4ZV7A 1LB1B 1NJFA 2FFAA 2VA9A 2P9FA 1EDEA 1U7DA 3FLMA 2GAAA 4GUAA 1Z39A 5ESXA 4NULA 1V8PA 2FV8A 1HZJA 5CD1A 1I0LA 2X3FA 1HEIA 2V8OA 4IQ0A 3UBMA 2PUWA 1IQPA 5JDIA 1Q7EA 1SAYA 1DEOA 3G1UA 2OXCA 3V1MA 3ZZUA 3ZWXA 1W5TA 1XZHA 3KSBC 1ZESA 4P32A 3EPLA 3O93A 1XA0A 3C7CB 1G3QA 2C4WA 3C3KA 2GGSA 1PGOA 3NIFB 4NEHB 5TEVA 3P96A 5JNSA 2BGIA 5M7EA 3Q8MA 3ZDBA 2IDJA 4FW9A 2WTEA 2FFBA 2YXDA 3QMPA 3T5DA 5C7YA 3STUA 2FJPA 4IDOA 4ZVOA 3MUOA 2HQBA 2XD4A 5F52A 2UZAA 3AUUA 5EP2A 3EIXA 3ZGLA 1QC5B 2WJGA 4JXJA 4AMVA 3ABIA 4CQJA 1CRPA 4TYMA 3LKDA 5C2JB 2F64A 3DBVO 3MIZA 1U04A 5JZVA 2W0MA 1Y5NA 5CVJA 1VFNA 2A5YB 2PKWA 4J43A 2X8AA 3EA5A 2DSNA 5G4LA 2C2KA 2OE2A 2ZU6A 4LZPA 4PAGA 4TT3A 5CIWA 3QV2A 1B6SA 1W1IA 2BOVA 2ZTUA 4KLRA 4W99A 3SC4A 3WK5A 3ANSA 4PN3A 5BSHA 3IPRA 2WP8J 1AG9A 4M76B 1O8BA 1RPZA 2DWQA 1Z29A 3JQDA 3S8MA 3H9JA 5BQPA 1VYVA 2XRYA 5ALYA 1HOTA 4AMUA 5AI0A 4D1YA 4KXNA 1RLJA 3U80A 4KH1A 1PR5A 1YHZA 3QUSA 3WKAA 4HPJB 4AZ0A 1SKBA 2EW1A 4WBNA 4M1OA 1M1YE 2AH5A 1NMEA 3ZXXA 4CHGA 2WU3A 4XWAA 3WYNA 2K6GA 4K3VA 1ZRNA 1A71A 4KDEA 5C4GB 3K70C 1P7VA 1Q0HA 2ZYSA 3PQFA 5PNTA 5C9ZA 2GJSA 4HQLA 3MFQA 3QG1A 2VJCA 1AGPA 1RRVA 1Z2OX 3AP2A 2HTEA 4HPWA 3EOAI 2P0YA 4JJKA 1KI3A 4IOJA 4N4AA 3EPRA 4RVNA 5H68A 1QAOA 1YMVA 2ZYTX 2PX4A 3AH8A 2EGHA 2VJOA 1AKTA 5D6NA 4DDMA 5FPTA 5CB4A 4OSEA 5K3DA 2C4TA 3R7WA 3EXFA 4MR8A 3EGIA 4TV8A 5JVDF 1VZ3A 4R2JA 4LTDA 3PXCX 4UD2A 1ZWLA 3DHNA 3GBSA 4S1NA 3U1TA 2R6FA 2V1XA 3A2NA 4UNPA 1DJMA 1TJYA 1ZIYA 4OHFA 5HHTA 1H0RA 2PM8A 1GRQA 1QK4A 2IXAA 1EFLA 2ZUUA 3CCCA 1XTBA 3FZQA 3MYYA 4PAOA 4XVRA 3QMMA 4DMUB 4QLAA 3PBKA 4EFNA 3WNVA 5E3HA 3HK2A 2AC4A 2NU6A 3BFKA 1YH3A 4O3FA 3W6OA 3S68A 4RVOA 4WRRA 1NSTA 1PJ2A 3AK4A 4L4XA 4RESA 5CFZA 4UHFA 2WIKA 1XHEA 1VRWA 1MX1A 4HDSB 2AYZA 8AT1A 5AVKA 4YHHB 2LVBA 4P2BA 4D4JA 4R98A 1V37A 3DGEC 3ZJ5A 2V4UA 1IQRA 4RL6A 1SIOA 2Q1UA 3WRWA 4JUCA 3K0HA 2X77A 3E9ZA 1DBWA 4TUYB 3DSRA 4NH4A 1NJ8A 2IV7A 2ZUDA 4QWWA 2NV2B 1N0WA 3U7IA 4KQKA 4DLLA 1MB9A 1V5WA 3F6YA 4QC2A 1VP9A 2MJLA 3KVYA 1YRBA 1FNDA 4WKNA 5CAEB 2E0IA 4JVOA 4ZRNA 1UXGA 5AM2A 4TYWA 4RTNA 1FW6A 1CETA 4HF7A 2R9VA 5L9AA 2RAVA 4EW3A 1OI7A 1KYXA 5BYAA 4LOKA 5LQCA 2C92A 5EXTA 2V98A 3DE5X 1X19A 3ZU3A 5K0BA 2RGWA 3IL2A 5J4YA 5L4LA 3LXMA 3B1XA 4Q6WA 3TI9A 2X19A 3OJXA 1N5MA 2RAUA 3D6TB 5I3CA 3L18A 4HADA 3EAGA 3RC3A 1PD0A 1VE7A 1P3JA 3GP3A 1JR6A 4Y8VA 3OPYB 4OA8A 4R68A 1IZ9A 4JLAA 2TECE 3IBFA 3TQOA 3JQQA 2FZ5A 2OYRA 3VTKA 5KDOA 1QNLA 4ZV9A 3B78A 4X8HA 3MWLA 1R88A 2V7TA 3NHAA 3PITA 4ZC1A 1NZDA 3W1VA 5JJIA 3GI1A 1T2FA 1UZMA 1N5KA 2FSUA 2X13A 4B84A 4O2RA 4UVGA 1HE3A 4OI4A 2J7PD 1WF6A 3PFWO 4OUDA 2VIIA 5DI9A 2H2FA 4AU1A 1X7YA 3CZ4A 3WL3A 1Y7HA 1BEZA 2R1ZA 4ZOBA 5T5QA 4DPLA 1NBIA 1QRRA 1M8KA 2JHGA 4N3NA 3H6KA 2BTEA 4UXHA 1WP4A 5AYVA 3G2PA 4I6JA 1VE6A 2XNDA 3ILYA 1TQ6A 2YHIA 4DA8A 4G5QA 1K5PA 2BDUA 2X8BA 2I3ZA 4QYSA 2GXQA 2R6AA 4RMIA 2A6PA 1RQNA 2XYHA 5DXAA 5SZHB 2XVZA 2P2DA 2Y4OA 2HMWA 4AKTA 2UUCB 1U7OA 4KK4A 4CQNA 4LHZA 1WXHA 4FMDF 4L16A 5EZYB 1VA4A 3H8WA 1EBUA 3OWOA 3Q6NA 3VR3A 4EYQA 5T67A 3T3NA 1QU2A 4PQFA 4IMIB 2FKAA 4JNCA 3GH1A 4OI1A 2QRPA 3OZTA 4BEVA 2B8JA 1LPSA 1NF9A 3ADDA 2CLSA 1J21A 4RKRA 3PHLA 1NLZA 3AVQA 1GVNB 2HA2A 2P90A 3EZ6A 3BE6A 4NJEA 2GPNA 2XB6A 5ULLA 5CTJA 3UGTA 3N86A 3VU0A 3TNFA 3WP0A 4CT5A 3DAYA 3ZX4A 2W00A 3TB4A 3EK2A 4E13A 3Q7SA 4WESB 2NU7B 1BFKA 3RYCB 3DEJA 3JQEA 5LYYA 1ORRA 5ER6A 2ZREA 1XYYA 1FIUA 2W71A 1V43A 2QRQA 3C5CA 2ENUA 2QMZA 4GIBA 3AFNA 1F3OA 2QTVB 4DR4B 4XDZA 1OXBB 1UJ4A 2VAWA 1JVNA 2AZ4A 4KRGA 5A5FA 1MHPA 2X22A 2MCFA 2PZAA 2QTFA 4O0MA 1G20B 1Q1AA 2IHYA 3KBBA 4IR7A 5GZ6A 3H5LA 4D0RA 2DBRA 1ODFA 2VDVE 1R5OA 4EI9A 3RH0A 5K0CA 4G4SP 2NSYA 3GQBA 4IOKA 3P2EA 3ZK8A 4WD3A 3ETJA 3QKSA 1A98A 1QH1A 4MYUA 2WIDA 4LUCA 4BNDB 1GGNA 4IQ4A 3LO5A 3FPAA 5BN5A 2E1PA 5DDIP 1XMXA 2GEDA 1EFTA 1WD5A 5LM3A 1OXUA 3QPUA 3RWBA 2WVHA 1DZIA 1H2WA 1MB0A 1UIRA 1Z5ZA 2P75A 3UQZA 4DMHA 4EKNB 5FWDA 1E2PA 2HKIA 3E2IA 1XVVA 5ALKA 5MGNA 4QT4A 1TADA 3PGA1 5D1HA 3RIMA 4XQCA 5K01A 3I01A 1LLCA 1VE3A 3BD8A 3LYAA 3NBMA 3JD2A 4RD1A 3UA3A 4N49A 4RMHA 3KFLA 5EA2A 3I6IA 2ZE8A 1H6DA 1W35A 2GI4A 2X15A 3F5SA 4IIFA 1OGJA 5SZJA 3V1UA 4RPHA 1Q0PA 3U3XA 4EY7A 3KWMA 4M99A 3BHJA 5JS8A 5LNK1 3QBJA 3UXYA 3AEQA 2OB2A 3QU7A 1XIVA 4MKHA 1C3LA 2XB4A 1GU0A 4Q4AA 4QIHA 1T15A 3JZDA 4UUNA 2WJHA 2PV0A 3WWOA 2JJQA 5JANA 5DCUA 4A26A 1KEPA 1FL9A 1M7GA 4LX0A 2UXBB 4X1OA 1T8SA 2PX0A 1E9CA 3ND7A 4B71A 4LZNA 4NATA 3CS3A 3OMWA 3AEYA 4O02B 4ZRMA 4A6PA 2RH5A 3KPWA 5IC4A 3ORHA 2B78A 4GECA 4Z1MA 4ZQIA 5LZ9A 2HXYA 1CLUA 2XODA 2ZR0A 5DYTA 4DQLA 3NX4A 5IMBA 2PR7A 4M0PA 1KYQA 3WGYA 1UFVA 1MGPA 1XTPA 2BTQB 5HA5A 2HAEA 1WCXA 2IPNA 2VBGA 1A76A 3N2EA 4P4GA 1Z9BA 3UV6A 4NBRA 1UXIA 4AQ7A 4XVCA 1CJSA 4H0CA 4V0RA 5AW1A 4RDXA 2BGUA 3W34A 4HN4B 1EWRA 3DKVA 3SFVA 1TUBB 2BC9A 4RABA 3T5MA 3EY9A 4PYNA 3ZNPA 2OK8A 3EISA 3TQQA 4X60A 3X44A 4PQEA 1BA3A 4CKBB 4XSGA 3ROGA 2Q9BA 3I39X 5AUNB 3GEIA 5EIWA 1W73A 1JIXA 4AIIA 5KTSA 1P74A 1FMJA 5FBWB 4ZHQB 2FQQA 4Q21A 3WXBA 2QVCA 1Q0QA 3CTMA 1XXHB 1IUNA 4QFDA 4RLSA 3R9KA 1XQXA 3T9BA 821PA 3A6KA 4MAAA 3U9SA 1G8JA 2BLLA 3TNYA 3W2FA 3DTTA 3EIUA 3UMRA 1P4AA 1F8YA 4IQFA 4ARIA 4ZOLF 2XI4A 1MVLA 4HZUB 3QV1A 1SVOA 3AY3A 2VPWA 3DL2A 3S2IA 3MBKA 1IDOA 1IHDA 3X1MA 4JCOA 3IBGA 1IB0A 2G25A 3F98A 3LC0A 4NRDA 4GYKA 2AOWA 1MC5A 3O6VA 3BFXA 1T5LA 3OPNA 1N2OA 3ETEA 3RAGA 1WQ3A 2F4NA 4NFLA 4MQEA 5JSYA 1OC4A 2A1TR 1E7RA 2VQDA 2H51A 4S24A 4ZAXA 3LQ1A 3AZOA 4V2UA 1FYXA 1DFGA 4E22A 1L7NA 1BFUA 1SXJE 2Q50A 1FFGA 4KDCA 5DN6A 3COWA 3ACCA 2ZRQA 5TXGA 3WB9A 4BNKA 2GJ9A 1JDPA 1H2HA 1OYVA 3WMWA 3L7NA 4GZ3A 1J70A 1VJ5A 5I9IA 2HO4A 2VI5A 1H66A 3F67A 2HRBA 5BN1A 2B61A 5CVTA 3ZD7A 5KHAA 3I83A 4B3JA 5G0SA 1Z5PA 2JIPA 2CFTA 3Q1LA 1GN9A 2O8DB 4LVOA 2O2ZA 3AF5A 1IPHA 1E94E 4FK8A 4HNHA 5EQDA 3VO9A 1W4ZA 2QNBA 3AWIA 2WPNA 1QORA 2GZRA 1NJ2A 1JNXX 1B1CA 4OG2A 4KIWA 2G6TA 3H2GA 3EAQA 1VKNA 2QUJA 1QF7A 1UMCB 5AK4A 3AF2A 5HE9A 1XELA 4E0BA 4AG5A 1BXGB 4TMZA 2B37A 4JLBA 3UMYA 2OYSA 1A8IA 1H2ZA 2O2CA 1BH2A 2D00A 3KP1A 4R3UC 4X1IB 5F64A 1G6OA 3OTQA 5HKAA 2CNWD 3GPLA 4JI7B 1T26A 4ZTZB 2X2OA 2XDWA 4RBNA 1A7UA 5I9BA 3S99A 3GF4A 1Z4QA 3M6IA 5EE3A 4EJMA 3DOOA 1E4EB 2SNIE 4MV9A 2Q5HA 2I4TA 1PNVA 4K86A 1IXKA 1RRKA 2JI7A 1F51E 2MINA 4R6XA 5B3AA 3KTAB 3KZ1E 1KO4A 1OBHA 3WBBA 2QY9A 4F7DA 4N12A 5JQWA 13PKA 2QN9A 4TWZA 4FC7A 4IH4A 3P4XA 4EB0A 4Q48A 2H11A 2ZYUX 1PLKA 1Q50A 2A88A 4PIVA 4QYIA 4TTSA 4U9HS 4NYMQ 3SF0A 1XFAA 1IN7A 3O38A 3VSAA 4ZMRA 1DTWB 2Y0EA 3I3SR 4FGSA 4A3SA 5AJHA 1BE1A 4W5TA 1C7IA 2R751 2V3CC 1VL8A 3P52A 4BFYA 1JPJA 5D5HA 3LI2A 5D8DA 3RVDA 2QTAA 3GCGA 3AT1A 3UAWA 2J32A 2PAAA 3F9IA 4L7QA 5CFOA 3EG9A 3DMNA 1MZPA 2G6BA 4AZTA 2BKEA 3UHOA 3FBGA 4ZYZA 3JSAA 3C6QA 3GFRA 5LVAA 3OG9A 2C9OA 3LUJA 1EM6A 4I3HA 2NO1A 2H1HA 5B30A 1JG7A 2FR8C 2I7XA 2J0QA 5CUQA 1CRWG 2VNIA 1RP1A 2CLOB 3BIWA 3F5DA 3FPCA 4R3WA 5E2IA 4HGZA 3STWA 3U4IA 1GRVA 3MS2A 4HZGA 2YUTA 1XVTA 1SCUB 4UPDA 1QU3A 3LV8A 3WWEA 4V38A 2BFFB 3BDVA 4IWYA 4O8CA 2Q7DA 2Q1YA 2EHDA 2O1EA 3JQRA 4LDNA 4WXEA 1Z7GA 5F5NA 4ARZA 4ZKDA 5AFSA 1WPGA 1IZ8A 2H1CA 3TJMA 4I4CA 3P2IA 3PDCA 4YUAA 3X0DA 1QRUA 4LGMA 1YTLA 4BLRA 1W85A 1X1TA 1ESNA 2P3QA 2LNDA 3HMQA 3T5AA 1YASA 1UDXA 1YNOA 1BXRB 1GGKA 4R2MA 4YAWA 4C76A 1GD1O 4N3BA 2ZWAA 4IKOA 1O8CA 1FJGB 1Z6GA 3ORSA 2B4YA 1DX4A 3WIDA 2QP4A 4NR0A 3ZVMA 1JKXA 4Q19A 2NTVA 3S5UA 5IC6A 3CW2A 3PICA 4MQ4A 4KWTA 5DX8A 4BJ3A 1GPAA 4OI0A 2FG7C 2YXEA 2UV8A 3EZ7A 4V39A 1SKMA 5J2UF 2X42A 5T57A 4ZYWA 1CZOA 2I99A 3I6YA 3ZDQA 4IICA 2Q3LA 1XALA 3IQEA 4PEVA 1VIMA 2CNBA 4RDCA 4YFYA 1BROA 2CE2X 1SVMA 1K92A 1CUUA 3R0ZA 4IMRA 5DHRA 3W5UA 5I3ZA 3THYB 1ZK0A 3A6HA 1EGAA 2PLNA 1NURA 3JATA 4F8JA 3H0CA 4LRXA 1XTSA 2ZJ3A 5C7LO 3RC8A 3HXQA 1ZJ6A 3ZOKA 1VCHA 3GYBA 4J29A 2G4CA 5CCXA 2KLHA 5EUQB 4BV8A 4F8EA 4TS4A 2E85A 4Z9YA 4IEIA 4BX3A 1XTKA 5K3BA 1JHRA 4U7JA 2IY7A 1FQJA 3GJTA 1Z08A 5DTIA 2ZBDA 1H2YA 4AP5A 1D2NA 3NNDA 1U80A 4OFWA 4HAYA 4LGVA 4KR7A 3M6LA 1J0BA 1J97A 4Q7MB 3G68A 3FMGA 1QQBA 1ZNXA 5AK5A 3OD5A 2HWXA 4JBHA 3AVVA 1VC2A 4WBSA 1FDSA 4IHKA 1VKZA 5TQ2A 4BZPA 4FI3C 4NJMB 1SBTA 3H2KA 1YU9A 2QP3A 4I14A 1HC7A 2NZYA 4EKEA 5BN3A 3I0ZA 5F7OA 1N2BA 3GW8A 4TKMA 3DVRX 3D2LA 3IVMA 2GCIA 5LNK6 1ZOIA 1Z62A 4EJ2A 3L41A 4D9EA 4UATA 2H8GA 2BGRA 5KBYA 4QVGA 5CHYA 4QU5A 1N5JA 1N2CE 2J1LA 2B6NA 4ZTUB 1TUIA 2OGZA 1F1JA 2PUCA 2LE0A 4RFSB 3WK4A 2C2ZA 2PRIA 2GFQA 2WI8A 3E5RA 3KVVA 2WILA 1ULAA 3IYLW 4FU0A 4L5CA 4TWIA 5AW0A 3PYXA 4Y2JA 4LE2A 4O2BA 1G5TA 3K0FB 5DMXA 1CUGA 1J39A 3B8EA 5C8DA 5K20A 2AQKA 3H6HA 3LPDA 2WSIA 4FPXA 2F8TA 3WX0A 3DL4A 4KTVE 1KH1A 1PIWA 2CB9A 5E4FA 1D5WA 1PL0A 4GUDA 3O5AA 4LEIA 1N36B 1I94B 2C7BA 3CZQA 1J8QA 3MGGA 1Z22A 5DNDA 5H16A 3HQ4O 3TF5A 1JIIA 4ABYA 5I9NA 2YJNA 3FJ1A 3OJLA 5KJEA 2J5KA 3IAFA 1TQ8A 4FLFA 4P3OA 3IIKA 4Z0HO 1GU1A 3ZBPA 4BX8A 1B3BA 3R5SA 1TF5A 1WW2A 3NU1A 1AS3A 4QBHA 1JI3A 5FV7A 5ITSA 1M6NA 4N5IX 1ZGGA 3B3JA 3CEHA 3CLVA 2OLJA 3IEUA 4J0GA 4DC0A 3K94A 1CS4C 2DTDA 3QXJA 4FONA 4KO2S 4ZOCA 1PE0A 4DADA 5EESA 1L8LA 3GGDA 5ED4A 1FJ2A 2WT4A 1IHYA 1US8A 2YY6A 4PM4A 1JX6A 4UREA 4EG3A 4W5RA 1TGYA 3LPCA 1O9HA 3JZAA 3MINB 4BQSA 3U19A 2RJOA 1VCIA 5TF0A 2HNKA 1KEKA 3ICEA 3CB2A 2ZIGA 1AGNA 1M72A 1PN3A 1C8LA 3O2QB 5ALRA 5FD8A 4LF9B 2H17A 2CVOA 1FUUA 1GYPA 2ZRHA 4R8LA 4WSOA 4RC9A 4JITA 5KQPA 3AM3A 3C3EA 3CLSC 1L7AA 3EVDA 1SVLA 3H3JA 4ZO8A 2H1LA 3TTUA 3ZH9B 3ZI0A 4D3XA 3RPEA 5BV7A 3SFZA 4U2KA 4O2LA 3TN7A 2GK3A 3D64A 3K31A 5D3ZA 1VYHA 3ND6A 1P1HA 1JJVA 1U0RA 4BJ5A 3A7EA 4M98A 1L7RA 4ZAYA 2MOKA 4PC6A 4GBMA 2WKQA 1BC5A 1LTHR 3FRHA 4BGEA 4OL0A 1OB2A 1DHRA 3FR8A 3O8OA 4YLGA 2WWTA 2FE4A 1DCFA 2PMEA 5D3MB 1ST2A 1HGXA 3SICE 5DO9A 4R3NA 2AVDA 1U2RA 2H7YA 4BNFA 2GPSA 5F7JA 2JAUA 2Y0PA 1A5SB 3HA7A 3EEQA 1W4LA 3ZJYA 1MVNA 1ZHHA 3CWZA 1SPBS 2R7LA 1N2CA 3KLPX 2A0FA 1E5VA 1GILA 4WTOA 5ICGA 5JHHB 2P5YA 4ZI7B 4K2AA 3UCFA 1N34B 1A1VA 5EUMA 1KZ4A 2A9PA 1JLLA 2HMUA 3A2MA 1L5HA 1SC4A 1UWKA 5CX4A 3JVVA 3IQIX 2ZIWB 3N8IA 3T7AA 2X5NA 3VOBA 4FN4A 1QHFA 2GKSA 5JYDA 2O3UA 1L7PA 2Y1OA 3ZHYA 1XTVA 5A4DA 4Z4EA 4ZCPA 1FFXB 1YS4A 5B7PA 4DA0A 2FPGA 1U0HC 1J25A 4ILKA 3GC6A 3HXOA 1LC3A 1XMQB 5JNWA 1WNTA 2ILTA 4CG2A 4FFWA 3FHLA 4QGHA 1E4YA 1RLMA 1VCNA 1A82A 3OC6A 1Z0IA 4AKHA 3RYIA 5CT8A 4F84A 5C8YB 5B1YA 1KQNA 3DF7A 2P2YA 3K9HA 1YL5A 3U09A 1AMOA 3BD6A 5BOVA 2O0MA 4NCHA 2X86A 3V33A 1ZI8A 4M88A 1KPIA 3WGNA 1COZA 1GZ4A 3F3KA 4E5MA 3ZGNA 4CEJA 3M81A 4L9WA 3ABOB 4O33A 5BR1A 4HEA6 5EHNA 4DKJA 1I2DA 2WSBA 2OXTA 2WLSA 1W25A 2FKNA 4F9TA 2HADA 3MMNA 4WGFA 1JE1A 4Y6QA 4ER3A 9LDBA 3TXYA 1HY3A 2AUTA 3OD1A 5I8ZA 4LI3X 4D44A 4DQ0A 4B85A 3DO8A 2W2PA 4FE7A 4Z8YA 3MMZA 3EGXB 3S2FA 1WQ1R 3IOEA 3KHSA 2O8NA 3N76A 1ZNZA 3JAKA 1J2UA 3OIWA 1A1SA 1P1BA 1E1DA 4DFDA 1EWQA 3B1FA 1Q1ZA 2J4FA 2DBZA 2CCJA 2RC5A 3EASA 4FKBA 3WNZA 1H5QA 3EIFA 3HI4A 2Q3HA 5BSMA 2XNJA 4KR3A 3HSYA 2DPYA 1U0BB 3QYAA 2XWBF 4CQMA 1J0DA 1CQIB 2VATA 4A1FA 1SKYE 4RF5A 4RSRA 3K5IA 4GG1A 4C2TA 3KXLA 4IINA 4G85A 4MR7B 1YS7A 2AE2A 3WLHA 4LIPD 2CHGA 2ESRA 2RGUA 2VK8A 2WQZA 3P9KA 4EUEA 3GK3A 5I7AA 5DLPA 4ON9A 2ZRFA 2J9YB 2ERXA 4LHWA 5KSPA 5AJUA 4B82A 4HWSA 4CNBA 2WWYA 2UDPA 4JKOA 3PPWA 2Z8YM 4HI0E 3D7KA 2X0FA 4BNMA 3ZTYA 1V8OA 4KWHA 1T6NA 4REMA 3KSUA 4XWGA 5HQ3A 1P1JA 1FP1D 3AHDA 1HXHA 1BQ3A 1SB8A 4M37A 3TXAA 4Y9SA 3QPWA 1QYIA 4GBJA 3CFYA 2FWMX 4BFTA 3LLUA 3ABZA 1CWUA 3I76A 5BPFA 3WGHA 4JB3A 2EX1A 4NLLA 4A7PA 1BMQA 3G0DA 2YBEA 3N2GA 2HV8A 4JIMA 3TDMA 3UFXA 4ZEOA 2XJ4A 2JCYA 3QPCA 3I52A 1RS0A 3NH6A 2IYRA 2QAGB 3T5GA 1E2LA 1U3GA 4O1HA 4PZEA 4XM2A 5H81A 1GCIA 1J4AA 4L6CA 5B57C 1GOTA 1GNSA 5JAIA 2G1KA 3UK1A 4RAOA 1YB1A 1L3CA 421PA 1AXRA 2P5TB 1FDOA 3IR7A 2PRKA 4F2HA 3O9ZA 5A5GA 5LZ7A 3CF2A 3RIEA 1FBTA 2O48X 2XWSA 3IT1A 4BP9A 2B9VA 5C7IO 2DJIA 721PA 3AV3A 5AO9A 3KUUA 3RM3A 3SQLA 1U3FA 3KQVA 2WIFA 2DPHA 3RRJA 1G8KA 4GF5A 3N2ZB 4FEGA 2NO9A 4N0MA 6YASA 3W5CA 4EHFA 4HDRB 1O4VA 4L4ZA 1GKIA 2Y4NA 1SHZA 3JASA 4ND8B 1Y8RB 4ZCSA 4XUCA 5K0NA 3N7TA 3PZBA 4OYHA 3U4AA 1XNJA 2XMBA 5JUWA 1SKAA 1MRNA 4EECA 1G21E 3SDBA 5CHEA 3HXTA 5BSFA 1BHO1 1MB3A 1EDDA 5M29A 4EG1A 3DLPX 1NW5A 2HEGA 3I1IA 1R6UA 2H0QA 2NUTA 1CJBA 3H16A 2O19A 3MUFA 4EIWA 2IU3A 3V1YA 3VR4A 1W9HA 4UNNA 4OBXA 1EM8B 1YJ5A 4DJ5X 3JYNA 4HRXA 3D43A 4RS3A 4CR8A 1YZHA 3AFGA 1M73E 4B83A 1R18A 3C7AA 3CEAA 5JXIA 2F1HA 1RLIA 3W3AA 4KLZA 4UXJA 2RH9B 4MVJE 5F4ZA 5SV2A 1LBQA 1WXQA 4MRVA 3V97A 4N03A 4D79A 1TCVA 3DD1A 3UXHA 3ILXA 5ESWA 4M2LA 4B35A 4D3DA 1OOEA 4B3MB 3QFRA 4LYFA 4HXEB 4XX0B 5KB3A 3TD6A 2CMKA 3VR5D 3V8NA 3WLFA 3D6VA 1QZXA 3QOWA 4EGSA 2HF8A 3K16A 4FXOA 3P9PA 3FYHA 3TLJA 1VJRA 1CSEE 5KKNB 3LMKA 3RVMA 5DBGA 3ZU6A 4FYYA 4NICA 1KEVA 1W19A 2XNKA 5KYWB 2XVMA 1JAHA 2JFUA 1EP9A 3CRMA 2WV9A 3OMLA 4LCBA 4XTCS 4AMBA 1AGYA 3O8DA 4BE7B 3V5NA 2XLBA 1YA4A 1MIOA 3C3JA 1DG1G 4LJLA 5KVQA 2DE0X 1ZN9A 2PPVA 3VPAA 4GOJA 2F43B 1DRKA 1T3SA 1H8ED 2VHZA 1B14A 2FA9A 1I0IA 2ZUBA 3KNZA 2PZBA 4H1HA 4Q7LA 3TBHA 3ZYZA 3OZSA 4C4PA 3FUCA 5IAEA 1BTOA 1XCJA 2O7SA 3P8ZA 4RHUA 1X0XA 3DKIA 2XV1A 3DNMA 1E5LA 2VZ0A 4I1YA 1O58A 5FPQA 5IC5A 3WTBA 2W37A 1AZSC 1C9MA 3CVXA 1C7FA 1A9QA 5L53A 3H7AA 2F1RA 4WKBA 5CPBA 1CDEA 1QHGA 4AJNA 2BM0A 2HJWA 1I3KA 3UHFA 4AJHA 2HMTA 2JVIA 1JDSA 4LRTB 2HPAA 1LU9A 5JISA 2FZLA 1KGSA 4BY9E 1QKIA 3R2JA 4YO7A 2BHTA 1P4JA 1U2ZA 1XTJA 4Q7JB 4ZIRA 2PUDA 2NNLD 1G9TA 1PT8A 1I1OA 3GVPA 2C4VA 2CSUA 3EXIA 3NZEA 3ZZ1A 2OAP1 2HRQA 4X7BA 2JASA 3LUDA 1S4MA 3ZVNA 3BHIA 4Y9TA 4DTCA 1DLIA 2OY0A 3R8FA 2COKA 4LJ7A 5B1EA 2W70A 4KO4S 1IXZA 2WF5A 4DYVA 2R96A 2Y68A 1X1RA 1Y6FA 3EGOA 5AJTA 5CP8A 4LC1A 2AKEA 3OO0A 3AEUA 3HZZA 4Q93A 2RHGB 4PG8A 2Q1WA 2Q3EA 4ZT6A 4NXMB 4UVDA 3F7TA 3ISTA 4IWXA 5IJWA 4IDQA 4YREA 4XM0A 4I6EA 4OK6A 4L0MA 2XWQA 3K4PA 4DB4A 1Z4PX 2V97A 3PNPA 3WBJA 5KINB 4QGFA 1X7WA 2COEA 2IKQA 3UJHA 1ZC3A 2A78A 5HUHA 4J16C 1OHHA 3NBQA 3LLMA 1SQ6A 4R9SA 4OHXA 3OX2A 2XNSA 3QFTA 3TQHA 4MVJA 4RIEA 3FH0A 4UNIA 2IYZA 4MX8A 3ZU4A 3HO8A 3BWBA 2WPDD 1LWOA 5FUXA 1I6LA 2HSGA 3LCUA 2J9GA 4OHCA 4CV3A 3LP6A 4R2XA 2ACVA 2GXSA 2IPOA 1G5IA 1BGXT 1N9GA 1U2EA 2A9KA 2VJPA 2W58A 3AEXA 2CJWB 2JGNA 3DMGA 2X9QA 4WN9B 4MV0A 1B74A 5HF9A 5GADl 4LRWA 3SKVA 2EFYA 3MT9A 1KKMA 4PR0A 4LNAA 3BH6A 4Z6KA 3RHSA 3PWZA 4H3SA 1V16B 4TQ9A 5E7MA 5GONF 3BEOA 1YRWA 3L05A 3ANXA 1ZH0A 2FN7A 5FYDA 4EUNA 2GPTA 2PA3A 3WJ2A 2O4UX 3HCFA 3MF4A 1FDVA 5DYIA 2I71A 1RWBA 1WXXA 2XKJE 2PWAA 3GGSA 5ESDA 4KOAA 3VPXA 4FHGA 3WLIA 3ZX5A 1ESMA 3O82A 4DUYB 1CVRA 6PFKA 3SXUA 1DIBA 4MQLA 5FT9A 5LD2C 4EKYA 4XGQA 2WT9A 3DYBA 4WJZA 4POOA 5MFPA 2WF6A 3VKGA 2G5CA 3QITA 1E6EA 4CNQA 2SCUA 3GG2A 2ZT8A 3W2GA 1AV7A 4QNNA 5ALWA 5TIIA 3CKYA 2DFLA 3ZE7A 4FP9A 4B7XA 3TGPA 1HDRA 3RHFA 4BN5A 1SZDA 4P86A 4B17A 3JWHA 2QT0A 3CX3A 4YCAA 1ZSVA 4DHEA 3B6JA 3R9XA 5JECA 5TGZA 4IS2A 3LOPA 1JHZA 4UVIA 1BS9A 2QLFA 1H1TA 3GLVA 3SDZA 4BCCA 2ZIXB 1YXMA 3PFCA 2J3HA 4PC2A 2Z30A 3DVAB 2P9GA 4RIHA 2BCGY 3HEMA 1DC3A 3AFIA 2YCBA 1WP9A 1E2EA 3MWKA 2VBIA 3SQOA 3VC2A 3KDPA 5DNCA 2HMYB 5FUVA 4D92A 4RIFA 4QASA 4PYQA 4LGYA 3AR3A 2A9QA 1T9KA 2D5AA 3CYFA 4PHGA 3SOZA 3KJQA 3G5TA 2QTLA 1H3NA 2ZPTX 1Y34E 3L0SA 1A9PA 1USGA 2ZP1A 4GPEA 3WRXA 3AHHA 1KXJA 2FYTA 3C1OA 3JX9A 5DNVA 3WYFA 3PR3A 1NFRA 1YHNA 1IOVA 1F60A 1S2DA 1WMAA 1AIPA 1A8UA 1E8NA 2R85A 2AFHE 2OCKA 4LBZA 1LZKA 1MC8A 3PPYA 5AJVB 4L78A 3UFBA 3VVCA 3TMKA 3I2JA 4D80A 4YRKA 3TIVA 4D97A 1HRDA 2QSZA 3D3WA 4YS6A 3IB3A 5E8JA 2GLXA 1A77A 1EE1A 2ZWOA 4KXYA 4IUBS 4OHBA 3IHWA 5GJCA 3WZLA 4MQ6A 4O4JF 5J2TF 1N3LA 2EC5A 2CCGA 1N5RA 4F3KA 3ID6C 3QLUA 3ANNA 4JQYA 1H2XA 4RHEA 2GM4A 4J0HA 5GIPE 2NSLA 5CLIA 4BNIA 3TOVA 5B58C 1PP4A 1S1CA 2FOIA 2FR8A 3HVUA 2PMKA 1MZVA 2O0JA 2TYSB 4GZ6A 2WDZA 4L28A 4TXNA 3UWKA 4ABTA 1WM1A 3KKQA 4MLZA 2ATIA 4JJ8A 4DEYA 3PFBA 1EDZA 1NW6A 4ILEA 1C7QA 4P82A 4ALIA 3BB3A 2XD9A 3DHVA 1Z25A 4JXKA 4J7UA 4MB6A 5K8VA 5EVJA 3A0UA 4C14A 1K9VF 2CMGA 4D9NA 3BJEA 2RGYA 3PDIA 5B3JC 4F92B 4PYJA 3T95A 4QD3A 2C3UA 2PUBA 4D02A 5DCLA 3JQFA 1JECA 3H3XA 4B32A 1CJUC 3GRYA 1QGDA 3JPWA 5LPNA 3U4QA 3R0VA 4MV3A 3TIIA 3IC5A 4WCDA 4GXTA 3QXHA 1Z56C 2E6UX 1J2JA 3RR2A 4CTKA 1MB2A 1R9JA 3OY7A 2QVYX 4RENA 3FLBA 4LF6B 3H05A 2PSSA 3HWWA 4JLNA 1E9AA 4QJ5A 5JO9A 1KAOA 2CL5A 5TF4A 3RTAA 1VXRA 3N0WA 1NT4A 4JZYA 3UMBA 4AROA 3UB4A 1FVHA 3O8QA 1KU0A 1KSJA 2DYKA 3G7UA 4QGBA 4UU7A 1V1JA 4AJKA 4DXAA 2WUEA 2JVJA 3O8RA 4P0TA 2QZPA 3PD7A 5F2OA 3RKUA 2QA5A 4CM4A 4S2UA 4WOCA 4R2LA 1NXTA 3GZJA 2FRDC 1GPDG 4Q9KA 4EGCB 2PLRA 1UJMA 2NZWA 2Y67A 2Z3ZA 2D7CA 3ESXA 3NVDA 4BZXA 3V32A 5IRCD 2BGKA 3PHIA 1M2JA 2LCFA 1SUEA 4KE8A 4MA4A 5EJFA 3TXXA 1T35A 1TJPB 1SGWA 3ADKA 4YRTA 1WEKA 2P6MA 1PL7A 2CXQA 3ZXUB 3NT4A 4C3ZA 1VIAA 1WUHS 2X41A 3ORFA 2VJMB 4MINA 5DTRA 4IH9A 1XKLA 4F5EA 3GLHB 4L4UA 4Q4CA 1NGSA 2OECA 3KO8A 1O5TA 3GJ8A 5BRAA 2DUMA 3PC2A 4DR1B 4IGKA 3EBOA 1Q20A 2BMWA 4Q15A 2W42A 2DEUA 4OLAA 1B3RA 2BZ0A 3HO1A 3M82A 5HOQA 2NG1A 3H4VA 2B4TO 4MW0A 4RQTA 3RRNA 1Q7RA 1NM5C 1RKUA 2DQKA 4GZMA 4X1YB 1G3UA 1KP3A 3VGPA 4D2IA 4MWSA 5FIUA 3M9WA 4LZAA 4EYOA 3WJ7A 3EHDA 1WDWB 1FPMA 2AKYA 1NMZA 1NI4B 3PHGA 2HY7A 4R2KA 1UKZA 4MVJP 1SUIA 2QF7A 1ONNA 1U7HA 4NYIQ 5AW7A 2YOGA 4FINA 1M34B 1SQSA 1GAWA 1KARA 3T61A 4BVAA 4JXXA 3QEBZ 2LV8A 2BSQA 2BEJA 1WCIA 1JKJB 3KR0A 3PIDA 3AW9A 4BBAA 4N6GA 1TAQA 2BCJQ 1JHAA 3FJYA 3GLIE 2FB9A 1U9ZA 1PUIA 5TMEA 2JD2A 1M2HA 4Q1AA 1JDBB 3IB6A 4QEDA 4WJKB 4D7AA 3LUBA 1ZM4A 3JZFA 1SU6A 1HI9A 2YJ3A 2L17A 2VNAA 1W44A 5DGXA 1JILA 3RS9A 3AHJA 1OYYA 3HNPA 4W5HA 5TSDA 3GELA 1X80B 4N3AA 4B73A 3QVVA 5EJ7A 4HN2A 4EHAA 1MV5A 3B82A 5JXJA 4D4HA 1V25A 4TS9A 1BHJA 3ZTTA 2J85A 2HSDA 3MAJA 4UJ3A 5CNJA 4ARAA 4E30A 1X7DA 1LK5A 2NXCA 5JBQA 5JDCC 2EDAA 1U5CA 3HXLA 3M0EA 1GSOA 1F8XA 3I4LA 5B1HA 3IT3A 1RE0A 2JPDA 2DH5A 4NYMR 3DBOB 4RVSA 4DCUA 3CF4A 5THQA 5AW5A 5IKXA 2XQJA 4DS3A 4ZI2A 5AXCA 3TW0A 1EG2A 2Z2KA 3ER9A 1FSPA 1E7MA 1S2MA 1SQ0A 1WV0A 5AWFC 4IF4A 2FZEA 1RZ3A 1EFUA 3PYLA 1N0HA 4IV8A 4BO8A 4CMCA 5HYVA 1OX4A 1M2VB 2NZ8A 2Z4TA 4C5AA 2QN2A 4HR7A 5EQTA 5TGDA 1WHSB 4N41A 1DSSG 1PZEA 3BFVA 5EXXA 3LK6A 4UBKA 2JAWA 2GFIA 4CKYA 3D4BA 1E60A 2GDZA 3KS9A 5B1IA 3WWCA 1AUQA 2WTAA 3DVQX 3LC7O 4KXVA 3V6MA 1Z36A 1MC4A 3BX1A 3F46A 1WMDA 3TLGA 2UYGA 3K5HA 2XRZA 5LZ2A 3FLAA 2XR1A 1QO0A 2C8VA 5I7SA 4HGOA 2VP0A 2QD2A 4MV4A 4CHTA 4DL9A 3DUWA 2P4EA 2CLKB 1V95A 1DC8A 2WF7A 1W76A 2RGBA 4LCEA 2FHPA 4WGGA 4MV8A 4WJLA 3L7YA 3K70B 2HRRA 3JQ8B 3ND9A 4RK7A 1J1IA 4JLKA 5BY2A 4M1YA 2JGDB 5DHFA 1K9SA 2CDNA 4ZZ0A 1K86A 2O5VA 3L7AA 4URZR 5JJKA 3ILSA 1EFHA 1EUDB 1Y7PA 1ZINA 2QLBA 2GTHA 2WIBA 4L4SA 1NQWA 2H6EA 2XTMA 3E22B 5ALNA 1Y9DA 1V6SA 3CG4A 4II3A 3E8MA 3UKOA 1L3IA 4DZRA 5DOZA 1AX9A 1H2FA 5C31A 3NIDB 1JWLA 2ACKA 3OEHD 3QMWA 2H29A 4NWIA 4QQFA 4XGKA 4AJ1A 4PLYA 1AMUA 4FS3A 1KSFX 1MOZA 2LPMA 3JARB 3CRW1 1XP5A 3L7LA 3V2GA 3VOTA 3H9GA 4FDTA 2ORWA 3AEKB 1PYDA 1TI7A 3VNUA 4YIHA 2HW8A 3C6KA 5B7GA 4MKIA 1HTBA 1LQUA 2A58A 2VDPB 1NKTA 2EVWX 1AN9A 1UMBA 4HL6A 3WYCA 2X7HA 3MJTA 1BE6A 4IIBA 3QELB 4YACA 1SA0A 1SQFA 3ZHBA 3PQ5A 2BHNA 4PQGA 4YLYA 4NENA 3ZGVA 3UGQA 4EHDA 2XXAB 4F3NA 3PLAE 5HILA 4BZQA 2MU1A 4AJPA 4QTXA 1A0OA 2C4KA 1FP7A 1MABB 1RQ7A 2DUNA 3OMXA 3TGWA 4CM3A 4ZXFA 1QCYA 3ZCUA 2OTCA 1R0BA 4NAUA 1GCGA 5DASA 1GPJA 1WVMA 1JDZA 3EGCA 1YJCA 2G9RA 4QRHA 3LTEA 1MNQA 2QIOA 2BFCA 4KIFA 3LF2A 4YBZA 2P77A 3N2KB 6Q21A 2LUOA 3GN1A 2IODA 3R8XA 1TYBE 1XEFA 6ABPA 1Z0ZA 2RGGA 4Y9RA 3T7EA 4I66A 4TKZA 1K75A 2W8BB 3ENQA 4JH0A 3T35A 3C16C 2RKBA 2RIPA 3FWKA 2OM2A 5EIBC 1PU2A 4Z86A 3MWFA 3N5KA 5BYKA 4M9UA 4Y2QA 4ZVNA 3IIJA 3GIDA 3PE4A 5ER9A 4AJLA 3PJGA 3OY2A 4HMQA 3VMMA 1RMYA 1H3EA 4OHUA 3DOFA 1PR0A 2Z3VA 1PJ8A 4DCMA 5BR4A 4MVXA 2ZVJA 4D8UA 5HJ7A 1JE0A 1Z4NA 2FPUA 1YO6A 2FFQA 4F86A 4S1OA 4N76A 3U3ZA 5KJ6A 1IVYA 5BQXA 1XJWA 3FDXA 3H8VA 2JEZA 2IX9A 2RCYA 1MQAA 4FGWA 1N2IA 3RUIA 3KLBA 4LA4A 4PPNA 5GJWC 3IAEA 1E2FA 5LOVA 1DC6A 4QREA 4HVAA 1SC6A 1HL7A 1YDHA 3ZKWA 1NF8A 2I66A 3UAYA 3FGNA 4ER0A 1TC2A 3NBFA 1ZNQO 4S05A 3T4EA 1RJ9B 1IBMB 5GAJA 1IULA 2ZJAA 3R7AA 2WZCA 3NM6B 1KKUA 4YXFA 1E1QA 1ZL2A 2JZNA 4URHA 5BNTA 1VG1A 1DJPA 5H80A 3CM0A 4C6TB 1YU6A 4G0ZA 1USIA 3C7TA 3PDUA 1ZCFA 3MGAA 4RDIA 4M0DA 3Q85A 3OE5A 5FTLA 1KMQA 4XAQA 5FBRB 1HFKA 1YQTA 3F2IA 3NHPA 1EDOA 2XSZA 5JSFA 4OH1A 1NHWA 3CW8X 3INYA 2O7VA 4RHFA 4CL3A 1NBME 4D82A 3OFVA 2I9KA 3T0IA 3U44B 3NEAA 3NBXX 2JL1A 1M9NA 1MFPA 2FSHA 3K8ZA 4FC6A 5E2BA 4BNHA 4PLWA 1SUAA 2I2WA 1T1GA 2JIZA 3FPEA 2J3LA 2E4UA 2QW0X 2WG0A 1B00A 3GDGA 3UF0A 2O59A 1PSWA 2FWAA 1U9IA 1SHTX 1NBOA 3U9TA 1GIAA 2B2CA 4UOZA 1SXGA 4RK5A 2OZLB 4RSHA 1JTFA 4BHTA 5L4NA 1YVDA 1JU9A 1I7NA 2B8TA 2B7CA 2OCIA 1M1ZA 2HHAA 2NXWA 1N78A 2QTZA 5DGCA 1G5RA 2QR5A 4JYCA 3TAXA 2A0WA 1NNLA 4R1OA 1WW3A 4LOHA 1TZBA 3GAFA 1GL6A 4RH3A 3SHWA 3AOGA 3QXXA 2ZWVA 3PNQA 1GNVA 2H5JA 4PVDA 1UANA 4W8OA 1EPUA 1EFVB 1W6RA 1Q3KA 4R40A 4PV7A 3RU2A 5IVIA 1VRVA 3LWNA 3I2IA 3ZGXA 3D9QX 2FETA 4BB6A 1K6XA 2ZXUA 4P7JA 2H2GA 3EVZA 4YK7A 2Q6LA 2C03A 2ZTLA 4IY1A 2M98A 2EFEB 1G0NA 2OO3A 4ZARA 3JW8A 4RTLA 4I5FA 1UEJA 2JDIA 4QQ8A 1Z6PA 2EWVA 4XEUA 3BB1A 3QBVA 4OXKA 5F51A 2FUG1 1KO7A 5CCBA 3ZXIA 3DDHA 4DV2B 1FRFS 2WYVA 1KDTA 2RI1A 4ZT7A 2D7DA 4BQOA 3DFKA 2YWGA 1P1FA 4PG6A 4WW0A 1NR5A 5GOZA 5IN5A 1ISIA 1QQ6A 1F17A 3BDAA 4MYDA 2GD0A 2YVUA 4UD6A 2ZM5A 2AA3A 3MJ4A 3CT6A 1PCXA 4GI7A 4HBZA 1GADO 4I1RA 3K8OE 2H00A 4BMZA 2AKAB 1HM5A 1SULA 1ANKA 1BOFA 1PJTA 4NSNA 2J6IA 3TO5A 4Q3NA 3ZCSA 3W5BA 3HXMA 3EPJA 3AYZB 1VI5A 5JTTA 4UASA 1WABA 2P0AA 2DM6A 1DWOA 3AFHA 2P6OA 3TDNA 2UYCA 5JVDA 1OXMA 1U3TA 2P3OA 3IVXA 2RJ3A 1WXWA 3H2BA 3PUZA 1FQKA 1DKNA 2HK9A 4UCWA 3LBYA 4KUHA 1YZTA 3CX8A 3ZXYA 1EYZA 1X13A 4QSMA 3N1UA 1SXHA 5D86A 2BW0A 3AWDA 3LO8A 3GFTA 3PGJA 5H9WA 3QKTA 2EU8A 3SIXA 2GNOA 2BJWA 1MPTA 1FFBA 1MO5A 1KEZA 3CNLA 3JD0A 3LY5A 3SC2A 4C3OB 1SEPA 5HS4A 4WX2B 3VHQA 4TSKA 3SNHA 4NTZA 4V02A 1M6HA 2ZAIA 1D4FA 3A1NA 3F6SA 3OQBA 4ZOEA 5DP2A 1LNZA 1LVUA 4YP6A 4P35A 3WK6A 3TB6A 4H27A 1TJ4A 4QDUA 3WHKA 1KI2A 1AHHA 4PSCA 5EHGA 4ALKA 5HJ5A 8ATCA 4AY3A 4IKEA 1XDBA 3T6KA 2Q3MA 1T1IA 2PZMA 3LT4A 4K0RA 4PWYA 2CWDA 3W79A 1MJNA 2RK6A 4MMXB 4JDPA 3RBZA 5HJ2A 1XF9A 4XB6B 4DR2B 4UCFA 5CYFA 5IZ4A 4RVDA 1DBIA 4L8LA 2QQ5A 2GAOA 2JLQA 1IN8A 2X6QA 2Y76A 3KKPA 3WWZA 2YVAA 1U65A 4JUFA 1GTZA 2K4MA 3ZWPA 2CK3A 4XGNA 1W49A 3TLYA 4Q3AA 4LV6A 1GFSA 4RD0A 1FFEA 1QE0A 2HA6A 1YE3A 2P2LA 2PKEA 4K03A 4Q1FA 1W581 2IIVA 3VAZA 2N46A 1XR3A 3GR6A 3OKCA 1GZSA 4PONA 5G53C 1KEUA 2OGUA 2YS7A 3RLFA 3COJA 1Y8QA 2VJDA 3IJRA 4QOFA 2G4LA 3OQIA 1VQ1A 3IAS6 3CXUA 4OFZA 1U4NA 3F2VA 3IO5A 3T7RA 3COZA 3KL4A 1FLAA 4DVGA 1TTTA 2YDYA 4HV4A 1RM5A 4IDHA 5DF1A 4JLDA 3TZQA 1PW5A 4EPYA 3NDBB 1JEOA 4OVKA 4ZT5A 3LL7A 2HA4A 3FWHA 1H4TA 4IG4A 1GLVA 3NP9A 3TEJA 3ZU5A 2POCA 3H18A 4RMJA 5ANRB 5TPZA 5E2AA 3T0FA 2UYOA 3RFCA 1JFRA 2HBZA 1XPRA 1JWAB 3GWZA 5J3JA 4ZYLA 4GLBA 1BIFA 2GESA 5K0GA 4KREA 1E9VA 1RMQA 4XEHA 2WB4A 3MELA 1N2EA 1KJIA 2Z95A 3PRYA 4LSWA 1L7OA 2O2SA 3MN1A 1KFKB 4J16A 3SLRA 2A5GA 2NO0A 4TLCA 5HFNA 4DARA 5AVSA 4JXZA 4TYPA 2N75A 5J9FA 2Q4OA 2HUPA 4PPYA 3IEVA 4M6WB 1F9EA 1PJQA 4Z7OB 1RLTA 1O94A 5FP0A 1MIHA 2GMWA 3ZV3A 2D13A 3FNGA 3KE9A 4WFQA 2GN2A 2JAOA 2VP5A 4GX5A 5CT5A 3B3AA 1GUYA 2JGIA 2ZSKA 1ULBA 3QZUA 4HN9A 3O31A 4M0EA 5FB3A 5KX5B 5FULA 1T2CA 4M1ZA 1JG1A 3D0OA 1ISMA 3EFHA 4XDHA 3TOCA 3KPYA 4RY9A 3AZQA 3CH4B 3UYKA 4A0GA 3QPDA 5I7RA 5CLLA 4N6OA 1J9GA 1UBFA 1Z74A 4MLCA 1CB7A 1L5SA 1Q91A 2Q9CA 4II2A 3WIEA 1ND6A 1XCPA 3FOEC 1RZRA 1MAHA 1U7UA 2BIFA 3DVSX 4INAA 1JDTA 2QX7A 3K3PA 2XA9A 3KKZA 1WHTA 2BZGA 3IVRA 2WKSA 4O4LB 3HE3A 4EVQA 1F6DA 5BV2P 1FE8A 3GAMA 4GPD1 4HTFB 3NHUA 4MWBA 4WVLA 4L0CA 3G79A 4J0DA 3F8WA 2GVNA 2ZIFA 2PGLA 4G1BA 5FR2A 4MQFA 4ZYVA 3KR9A 4RV5A 3ZZTA 3GOQA 3ANMA 1FS5A 3W4IA 2Y9PB 4GMGA 4OHRA 3GPCA 2W2LD 4Z4FA 1DL5A 3E84A 2GF0A 1FBNA 1Z7WA 2C98A 2F8LA 1K7CA 1A4XA 4HGNA 4ZTBA 3SZOA 4F9EA 4F93B 1IWPB 2Q28A 1RYHA 1G19A 4QOEA 5KJCA 4MIOA 3FDIA 1E5XA 1EK0A 2G09A 2PR2A 1OI2A 1RXEA 4YJFB 3ZWWA 1PFUA 4NQRA 3KTOA 4UBLA 5DBHX 4BNYA 4M8KA 2O8BB 2R8BA 4IDPA 1TKRA 4S1VA 2F9MA 3ZQ4A 1GYQA 3D7RA 2BHRA 1L0BA 3EXHB 5K51A 5H4GA 3LQFA 5KU7A 2GN4A 2OG1A 2QT1A 2ONCA 2QI9F 3GNTA 2B4QA 4HNSA 1ONPA 4UDXX 2WMDA 4XB2A 4KMOA 4WZBB 3X2FA 1C0IA 1ZK3A 3ZDFA 2CNKA 4FYPA 3DHYA 2R86A 4QGAA 3T15A 1CY4A 1TRHA 2XBLA 6LDHA 5LP1A 1P39A 2Z2XA 2J5RA 2HV9A 2PL5A 5K03A 1QHSA 1GPLA 1TQDA 2XCQA 3OZXA 2QXTA 1N5OX 1WZEA 4PXSA 4W5OA 3B6ZA 1R0YA 1JVSA 3VVBA 1DLJA 2ZCVA 5CGZA 4F9GA 3LY9A 1HMPA 4LRQA 5SYNA 5KC8A 3QKRA 2PJZA 4JP2A 4KXFB 3TR5A 1BG6A 1Q6YA 1DQNA 3M4YA 3U4HA 3KQPA 4WT7A 1WKBA 1F5SA 3HHPA 3L93A 1SCIA 3HABA 4BO1A 5BVHA 5BO5A 4H17A 2P4QA 4CMKA 3LUHA 2EATA 2B20A 1Z6TA 2SECE 3ME5A 1E2JA 3DXZA 1OASA 3TOSA 4RD2A 3N8KA 5LFAA 4GKKB 1N3IA 2WINI 3QHPA 1JHQA 1VKHA 2CC2A 2DQSA 2RKOA 2X1HA 4OIFA 1HL3A 5EHIA 4HFJA 3AKZA 1Z35A 1CT9A 1RTKA 1DT3A 2GSWA 3CEJA 3DBLA 4JKIA 2PUAA 1RAIA 2DR0A 2GXUA 3LQ2A 2YNMD 4RKQA 4ML3A 1WQ4A 3RUPA 1ILEA 4A03A 1ZO8A 3E5HA 3CX7A 1EBBA 3Q87B 4PO3X 1XAGA 3MCUA 2XHEA 4GL4A 4CUJA 5F21A 3E05A 1Y9ZA 4Y0NA 2ZJ0A 4WCFB 4B7ZA 4LYHA 1GUFA 2AFRA 3RUFA 2A0KA 2DHQA 4C4RA 5HNKA 2Q6IA 4ER5A 5SICE 3THXA 3GJ5A 4B4KA 3HDTA 4XGRA 2X4IA 4EA7A 2Y71A 3LCVB 4E88A 4TXHA 1O57A 3OCJA 3EPKA 1WG8A 3DNFA 1KOGA 2G17A 1CNMA 1LEHA 1Y4DE 1LC0A 2GA8A 2J3JA 3E7DA 3PHCA 4NV3A 3MG9A 4EB6B 2CY0A 3Q1KA 4UMVA 3NOVA 1G8GA 2B35A 3O4JA 4RZ3A 1P4SA 1MORA 1FFYA 1CUWA 4ZOLA 3W6UA 3JWIA 1C1HA 1IZZA 3AI7A 5EZYF 4ARUA 5JSZB 2R2GA 2R1VB 4QATA 3AL2A 5L51A 5KU1A 2ZJBA 3GARA 2XJ9A 1DPGA 2FUG6 2X5OA 3F6EX 3MIIA 1ISHA 3BIOA 3FDJA 4LWQA 1WY5A 3REFA 3SZ3A 5JPCA 3KELA 4QOSA 3C1UA 1UJBA 1Y9AA 3GEGA 1FRNA 1AS2A 2B9EA 1FRZA 3AINA 3KRTA 4XIJA 5E7IA 4AN4A 4YCLA 1FDWA 3WISA 1P31A 1MX3A 4FD2A 1YDMA 2DBVO 2JAPA 5LUAA 1Y80A 1OGIA 1E1LA 4J7XA 4KK3A 4PX5A 4R8MA 1A4IA 1NZFA 2CXTA 2EERA 3VSDA 4CKZA 4K88A 3ZE0B 2ORIA 3WYBA 4DW8A 3UT5A 4IVRA 1H65A 1NRJB 1VHLA 1MT0A 1WY7A 3D6JA 4OB7A 4R9NA 3C3PA 2PGNA 2IYWA 3DPUA 4FHDA 2HX1A 3GJ0A 1RYEA 3HYLA 2B8NA 2J5XA 3I9V1 1P2BA 3B9QA 4I4TB 2WP0A 3WRYC 2VHXA 1QRAA 5AK0A 5CA1A 1FC0A 3CEPB 4CR7A 1UP4A 2WFLB 1LDBA 1Z6AA 5KTPA 2E4VA 5HUJA 2ZB4A 1E6WA 3L0IB 3K73O 1TKCA 1DXYA 3DBHB 3EFOB 4BZZA 4FOPA 2VDMB 5I8WA 4BMVA 1O5IA 1X42A 2SICE 1R8QA 4GMDA 4L5JA 3HPRA 5EE1A 2QLJA 3GUHA 4PW0A 3SHOA 1KK2A 4UJ5A 5LQJA 3UC5A 1JEQA 3UXMA 3EF0A 5FBHA 2NNWB 4RGVA 1XCGB 2BFEB 1EVLA 2PYDA 5A1TA 2QNRA 3HXKA 2E4YA 1E0JA 1EEXB 1XF1A 1TM4E 4EA6A 1C4WA 3DV2A 5KQRA 4JA0A 3T0GA 2OXRA 3ZE2B 4ETMA 2HN9A 2ZUWA 5IEBA 1FP4B 3IP1A 5IK2D 4QX6A 5DM1A 3VMFA 1LNSA 1ZIXA 1N1DA 2DECA 2WK1A 3FWZA 1ECGA 1I8TA 2QV0A 3CURA 1RWOA 3LBNA 4QUHA 4R41A 4V3CA 5EP1A 3VO2A 4BJHB 4CCSA 4YMHA 2B34A 1TC1A 1KOLA 4GQAA 4OGGA 1JDVA 4JS0A 4JP1A 1ID1A 2IUTA 4F91B 2VWHA 2BKXA 4DSZA 2DPXA 10MHA 3PHBE 5FTJA 2XAAA 1SHUX 2NU9A 4B4UA 4B75A 3OI7A 1I3LA 4TKVB 1BX1A 4WUTA 2TSYB 3UW1A 4BV9A 3PFGA 3QYFA 2JJ1A 1HE2A 2VCHA 3DC7A 2II6A 1WVGA 3EIWA 1W7AA 4XPIB 3ROEA 1BMFA 3O4VA 4OOFA 3IP8A 5FKJA 4ALMA 1J56A 4RFLA 1B8OA 3LZ6A 5KYUB 1T43A 5L3ZA 4D8YA 3JV7A 2IPMA 1CZLA 1EFCA 2R3SA 2WTMA 4GMHA 2OKCA 4KG7A 2EJUA 1EB9A 2ZI6A 2BELA 4PGAA 4NBNA 1IHPA 4NDAA 5GINE 1LK0A 1TE2A 3TECE 1CJCA 1JBQA 1C2YA 1Z33A 2YXBA 4CFZA 2GPWA 1HQDA 3MLAA 4OJKA 4B2YA 5M2QA 4FJ0A 1DARA 1FOEB 5LLSA 4ZHQF 1N9KA 1M5UA 2EKBA 2YICA 4W9MC 4DAEA 1SUCA 4L2IB 1QNFA 1P1CA 1JHYA 4H3KB 1OVGA 1UBCA 4BKOA 5IAKA 3SEQA 4A2CA 2GZDA 3L5KA 4WNYA 1BGVA 1N77A 2QBYB 1EGVB 3PC4A 4EI7A 4FSHA 1MW8X 4LAFA 1E9FA 5JC8A 1PO7A 2HTFA 3TVYA 3AUYA 5ADVA 3E5MA 5D7NA 4HK4A 1Q5PA 2OFOA 4Z7QB 1L5VA 4BECA 1B6RA 4M22A 4M9CA 1GQOA 2C58A 4H3VA 1LWNA 4ZCIA 2CHUA 2Z1NA 5J2UA 2Q3DA 1L8QA 4GHWA 3GLGE 3DTVA 1VDZA 4LOIA 3QLTA 2A2ZA 5AKHA 3TIXB 3TQFA 2BBTA 3OCYA 4REQA 4PANA 5F3DA 1OTHA 1VJ0A 2W48A 3X1ZA 3QXCA 4C4SA 1S8AA 3BKWA 3RYFB 2BJHA 2VUTA 4FCCA 5ICEA 1VSTA 2EGUA 1FX0A 3KG2A 4XR9A 4YYZA 4NOMA 2VH5R 3DUFA 2F8SA 1WLYA 2ZAOA 1R6AA 5A9SB 3DEAA 3KQMA 5JJ5A 1F4PA 2FF5A 1NRWA 5D87A 5CFQA 1V6CA 3B5IA 3BGSA 1UAGA 3UOGA 2OCDA 5JY1A 2LIPA 5BURA 3D02A 4NS4A 3VPBA 4MV5A 1IUKA 1EWKA 1B0PA 2F48A 3ZLBA 4IOMA 4ZYTA 2O8FA 3Q7PA 1E3TA 5BSUA 1ONSA 1XZ8A 2D4HA 1EB8A 2R79A 3HU2A 2H4XA 4OXRA 5B3KA 1T2DA 3JCZA 3NHKA 3R4CA 4OLJA 4P4LA 2XCOA 5LC1A 4KBGA 3DP9A 2FZCA 2UVPA 3M2TA 4LJKA 5BUQA 5IHXA 3PVSA 1Y7TA 1HLGA 5FTMA 2Z8ZA 5LDDC 4ERNA 3GQVA 2FLVA 2VSNA 2VSXA 3BGVA 4TTVA 2N9UA 5SY9A 4CDGA 1L4EA 1NF2A 2P5SA 2XQKA 1B6GA 1IG3A 2ONYA 2NUPB 3VC7A 3ZY6A 4HDMA 3ICVA 2GJKA 1Q16A 2I3AA 3KAKA 1DBPA 3AR8A 1C7EA 2V4MA 3JVDA 2LP4Y 1AO0A 2Q5FA 3QPVA 3FYUC 3DE3X 4OM8A 4C2BA 3KDAA 4B6FA 4ZGGA 2IYSA 1GL9B 3S1AA 1D0SA 4A0HA 4Q4DA 1GTVA 4CM1A 1Q1GA 5D3KA 1YQEA 3BVPA 4W9NC 4G4IA 1PTJA 1GCUA 2Q5LA 1ZD2P 4G1FA 4DT1A 2ODNA 3HVHA 1MOSA 2RB5A 3U7FB 2VF7A 4MEAA 5BSRA 1VKRA 1Z2NX 4GU5A 4NYIR 5KHLB 4RZSA 3ROMA 4YT5A 5C35A 4QO8A 3G17A 3RIXA 3KTFA 3N0TA 3PQCA 2BGTA 3VYUB 2IIBA 3WO1A 1H5UA 1MEEA 3C0KA 2V0CA 3HUFA 4FGZA 4NF2A 2PFKA 3L1HA 5HKBA 1I7DA 1QOQB 3P9XA 5H1YA 1B8PA 3CUEF 3UUGA 4M54A 1IOWA 1NR1A 3K9CA 3KEGA 5DIZA 4HRYA 5DK4A 4OP1A 2XNHA 1HKHA 4PNZA 3CLRD 4MGEA 4CIBA 5KNCA 4Y2SA 4H08A 3JYOA 4G2TA 2Q1SA 2H7CA 3FWYA 3K4HA 2XMGA 2WD7A 1J1ZA 3BCHA 4ZWNA 3FDZB 1YF3A 1Q17A 1L6IA 2C04A 3I45A 3FF4A 4H6WA 2DLDA 3GLGA 3AXSA 2H85A 4D8XA 5K0TA 3KU4A 4MZDA 1V11B 2IYLD 4TXJA 4B48A 2FPIB 1YDFA 5AVJA 3AY7A 5IF9A 4P53A 4NBVA 4Q24A 5JU6A 2WA1A 4M0CA 4NECA 1ZKMA 1OAKA 4FFDA 5FI0B 1OGYA 1XZIA 4EGAA 2X5KO 3RC9A 1OZAA 3D5TA 2WFMA 3B53X 2IT1A 4I5DA 4KH0A 3M6MD 3QUCA 4B0PA 4JJIA 1LPAB 2Q6TA 4PFQA 3TM5A 1PFYA 3L8HA 3UT0A 3ZWYA 1R7RA 2V6JA 2Q41A 3NALA 3CT4A 3ZD9A 2WSMA 1GHTA 4AQDA 4WV3A 3GDHA 3CUSA 3WGUA 4PS1A 1N3BA 4AZSA 3WFJA 1KY3A 3EBLA 4YYEA 1S02A 2QPOA 1HETA 1S3SA 3HA2A 2WY2D 3VPDA 3C48A 3AETA 1XZEA 2XQFA 2XE7A 4LYAA 3AJRA 1PZFA 2XMQA 2HQSA 1NVXQ 3PENA 5DLEA 5F73A 2XUFA 1Y1RA 3N0RA 5EZ6B 1GA1A 3C8HA 2FMHA 1XCLA 3B20A 4TX1A 4X6YA 3ZNQA 3ZV4A 4EYEA 2IS4A 1E3LA 3TX6A 4M86A 5FNZA 2WYWA 3LXUX 1T5BA 3Q9LA 2V74B 1UK6A 2VYND 3LUKA 1ZW1A 4HNRA 1LRLA 3WGLA 4G0WA 3T5CA 1BSVA 3RB8A 3H1FA 3BSFA 1IM8A 1XB2A 2NQ8A 5KYXA 3I9V6 1IJBA 2E1RA 5ALUA 1C0EA 3O84A 5AJYA 2QM8A 5DRTA 4AS2A 4WNAA 4N48A 1DIOB 4AWXA 1T0JB 1WU7A 1T10A 4RHYA 3WLNA 4KYTA 4D74A 2GN9A 5FJIA 1U6JA 2CD7A 3CGGA 4JOSA 3UATA 3UG6A 2CMHA 4AN1A 4ND1A 4DVJA 3EEOA 1CYEA 4QFBA 2GOYA 2VT6A 2YWBA 3B7WA 2ZJZA 3L5OA 4JAVC 2FRXA 4J9VA 4XPZA 5A3VA 3SJZA 5C46F 3AUSA 4B76A 5EJ5A 1FK8A 3DCJA 3U13A 1EBFA 4OQNA 3L0BA 4BEBA 1W8IA 3WV4A 1J5EB 4B33A 2SKEA 4FZVA 4P4SB 4HLUA 3THRA 4G1UC 4CM9D 1RE1A 2QUZA 2IZOA 5IVKA 4XIGS 2NZUG 2VPYA 1XRRA 1JHVA 2OMKA 3DTYA 2H4WA 4I4NA 2VNKA 4B6GA 4RW0A 1YRLA 1XTTA 2PXHA 3LLSA 1NLMA 2HB6A 3BMNB 2ATVA 4UFOA 1KRWA 1R2QA 4MP8A 3GEPA 2JJYA 4X44A 2JANA 3KTDA 3OQNA 1G55A 5I47A 1G2OA 4R0MA 1YZFA 4C0WA 1ZSNA 4HWGA 3DDCA 1BU5A 1O7JA 5HKOA 1KJ8A 1UOOA 2R4TA 2VJAA 3UMMA 2REQB 1R6DA 1ZMTA 4EP1A 2ATCA 3EWIA 4XVUA 1LPNA 3ZLTA 5CFMA 1CFZA 1NT2A 1NW9B 2B30A 3IS3A 4H7KA 1TLLA 4GLFA 3KXDA 2FR1A 3ZN2A 5JAHA 1XLWA 1EK5A 5GOTA 4Q4HA 4KSCA 1OROA 3OJEA 4RZ2A 1G8YA 4B9EA 2NPOA 3M9LA 4MCIA 1LBHA 4GXNA 1QLWA 5AM1A 2H4JA 3BAFA 4GE3A 2ZG6A 2WM8A 3RSFA 4R69A 3TWOA 1O08A 1MQ9A 5SZKB 4A92A 2NO6A 4G5XA 3LDGA 4MARA 3G7SA 1E2HA 2QMHA 4P3KA 1IYZA 1CNEA 1SG6A 2OYCA 4FNAA 4YRZA 4M49A 3PCRB 3E8SA 4UAJA 1A50B 2B1JA 1M2GA 4YUYA 5LL6P 3FKQA 4GDFA 2I8AA 2GBFA 3EHEA 4G0YA 4Q4JA 1QB7A 3DEYX 1M1YB 4KGXA 4QLOA 3DLIA 2CW5A 1JJBA 3FKJA 3A0RB 5DX1A 3VA7A 1D6JA 3B6MA 3R41A 4XSHA 1UPTA 4JOBA 4J4BA 4CLRA 2WU4A 3HB9A 1FX1A 4MV1A 2Q5JA 3KXKA 3WGIA 2QE6A 5JCOC 1ZUNA 2X0IA 1ODIA 2H7XA 1TT5B 1E0SA 3QLEA 4OQPA 5AOBA 4B0OA 4IIHA 1WS6A 3O8CA 1G41A 2W4QA 1X1BA 5CW1A 2I0FA 3ZBQA 4Z9FA 2YOHA 3I34X 4CTMA 2ETXA 4I50A 5KDLA 1PNTA 2JCXA 1FQWA 2P3LA 3C3CA 2QRMA 3FHCB 1QAQA 3E8XA 2C9ZA 1UMDA 2HMVA 3EIOA 2JHFA 3G59A 4U5QA 1T9ZA 5GY7A 1R37A 2P9HA 1ORWA 2C9MA 3JQAA 2QLLA 3NR2A 1WZCA 4JP8A 4EUKA 4ZU3A 2R8OA 2R47A 2J7PA 3OHSX 4OO3A 2DPLA 3AFOA 5EWMA 4EY4A 4P7GA 5KS2A 1XMJA 1Z4JA 5DXJA 1QG6A 1UT8A 3EWAA 4L5AA 3FYSA 3GLKA 1HE1C 2GBPA 3L0YA 4LFBB 1YE5A 3A1TA 3DDSA 4P84A 4AO7A 1D4OA 1NN3A 1QDUA 1YR2A 2Q4TA 4MDHA 1UOQA 2IYPA 3K09C 1N7GA 2Y1XA 3AUAA 3K70D 3DL7A 4X97A 3BM5A 3ZD8A 2Q8PA 4CQLB 1CDDA 2OESA 3BCUA 2OHIA 4CM8A 2FG5A 5DNEA 4G0PA 2IYVA 2R8RA 4Q1CA 3OJOA 1VLJA 1AUVA 1CUZA 1SVUA 1ML4A 2LR0A 2ZW9A 3R3WA 3UTDA 3WLLA 4DBZA 3W8DA 4Z49A 1TMYA 1XWIA 4YP0A 1VKOA 2AMFA 4YJKA 2A14A 3PC3A 1TO2E 5AVOA 1FU7A 3MJFA 4ETIA 1NXXA 3KJFA 4N5HX 2FEWB 5M3BA 2YWFA 1NV8A 4JYAB 3JPYA 2Y1CA 4MHSA 5JG7A