5ARCA

Cooperative bio-metallic selectivity in a tailored protease enables creation of a c-c cross-coupling heckase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASCNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords SUBTILISIN SAVINASE
publication title Cooperative Bio-Metallic Selectivity in a Tailored Protease Enables Creation of a C-C Cross-Coupling Heckase
rcsb
source organism Bacillus lentus
total genus 102
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2015-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 5arcA00
3DE7X 1AU9A 1BH6A 1SUPA 3TECE 1T1EA 2SICE 1SUAA 1CNMA 5FAXA 2Z56A 1SN7A 1SELA 1WMFA 3EIFA 3DE6X 4DWWA 1SUBA 1ZVJA 3WIUA 1ST2A 2ZWPA 1TO1E 3A3OA 4NE9A 2WWTA 1WSDA 4H6VA 1P7WA 2DP4E 1KE2A 2Z2ZA 1KDVA 4WOBA 3ZXXA 1TM5E 1Y3BE 1AQNA 1TM3E 3AJ8A 1S2NA 3WQBA 4J94A 1A2QA 4M1ZA 5I9SA 3PTLA 4OMCA 3DYBA 1PTKA 1BFUA 3VYVA 5B1EA 1AVTA 3EDYA 1THMA 1S01A 4DJ5X 4HVLA 1Y4AE 1TK2A 3VV3A 1PEKE 1SBTA 1P7VA 2X8JB 1JEAA 2E1PA 1YJAA 1Y4DE 1OYVA 1PJ8A 4OMDA 1AH2A 2P4EA 2HPZA 1EGQA 3VHQA 4LVOA 2WUWE 4H6XA 3P5BA 5CW1A 4AKTA 1SBHA 1C9MA 1TM1E 1SCDA 5SICE 1GA4A 4CFYA 1Y9ZA 1GNSA 3TI7A 1WVMA 2WV7A 1YU6A 1YJBA 5AVJA 1V6CA 3BGOS 3GCWA 2PRKA 4DZTA 3DE3X 4OV6B 1VSBA 1SIBE 5AVKA 3T41A 4C3VA 4RYDA 1OT5A 1R0RE 4Z2AA 3TI9A 2XTJA 3QTLA 1YJCA 2WUVA 2SECE 3DDZX 5JXGA 3DW1X 2XRMA 1BFKA 4ZARA 3AFGA 4WOCA 3DE1X 2Z58A 4I0WB 2HD4A 3A3NA 2ZRQA 4GI3A 2GKOA 1Y3FE 4AKSA 3DWEX 2PYZA 2W2NA 1DUIA 1PFGA 2W2MA 2TECE 2Z57A 1AV7A 1S02A 4B5LA 1R6VA 1C9JA 1V5IA 3F49S 1C3LA 1UBNA 1Y1KE 1Y3CE 2SNIE 5ARDA 3CNQS 5FBZA 2PWBA 1CSEE 3DVRX 5ARCA 1SCJA 4BWGA 2Z30A 4NE7A 3F7OA 4FONA 2W2QA 5JXJA 1NLUA 3LXUX 3QFHA 3DE4X 1Y34E 1Q5PA 2IY9A 4NMXB 1T1GA 3I30X 3F7MA 1HT3A 2PQ2A 1GT91 1AK9A 1AF4A 1MPTA 3D43A 5ARBA 3SICE 2SBTA 3EE6A 1BE8A 2X8JA 1SBNE 5B1DA 1Y3DE 3WIVA 1SBCA 3DW3X 3DE5X 4JP8A 1WMEA 3CO0S 1SUEA 3DVQX 1R64A 2G4VA 2Z2XA 2DUJA 2ST1A 3I37X 1C9NA 1BJRE 3AJ9A 3GT4A 3QMPA 1NDUA 3WHIA 1KDZA 1TM4E 1SCBA 5AQEA 3SQOA 1KE1A 4HX2A 4C3UA 1WMDA 2PWAA 3BX1A 1OYOA 1GTJ1 4YN3A 3UNXA 1SUCA 3Q5GA 2ID4A 1EA7A 1DBIA 3I2YX 1GTG1 4MZDA 2V8BA 2DQKA 2QTWB 1TO2E 1IAVA 2PKCA 3D9QX 1SCAA 3LPCA 1GTL1 1T1IA 1ST3A 3DE2X 3H42B 2ID8A 3GCXA 1P8JA 2IXTA 3HJRA 2W2OA 2W2PA 3PRKE 3DVSX 1GCIA 5K7SA 5JMOA 3LPAA 4H6WA 4CG0A 2Z2YA 3VSBA 2B6NA 1SPBS 1GNVA 1LW6E 1SCNE 4KPGA 2PMWB 4CFZA 3ZXYA 1GA6A 1SIOA 3Q40A 1GA1A 3A3PA 1SUDA 3GT3A 1SIUA 2ZWOA 4LVNA 3I34X 4KG7A 3VTAA 1KDYA 5AMXA 1XF1A 1Y48E 1SVNA 3VV2A 1SBIA 5FFNA 4ZOQI 1BE6A 4K8RB 1Y33E 4KB5A 3LPDA 1TMGE 1TECE 1ZVKA 1NDQA 3L1KA 5JXIA 1IC6A 1SH7A 1TM7E 3BPSA 3OSZA 1MEEA 5JXHA 3DE0X
chains in the Genus database with same CATH superfamily
5AD1A 1JHPA 4LE0A 1BH6A 4Y6PA 4UVGA 2FW7A 2P9YA 1EG7A 1N6PA 2HJ9A 4MRAA 3IVXA 5ADHA 2GD0A 4O59O 3KOXA 4ZI7B 1Z2PX 1FTNA 2C4WA 2Q4BA 3H9CA 1QH0A 2ZYSA 3ESRA 4IOMA 5FAXA 3ZDCA 1A82A 3COPA 7MDHA 3PQDA 3L6EA 2OKGA 1USUA 3WL5A 4EF6A 3UMJA 4ATNA 3U7QA 4KK3A 3EEYA 3PFNA 4IPTA 4K86A 3MJRA 4LOHA 5DXJA 4R1LA 4V39A 3T3HA 3CH4B 2FP4B 4WEQA 1DCFA 1I13A 2CXTA 3NTUA 1B1CA 1WSWA 2O0LA 2QTCA 2X5NA 2VT7A 3D81A 4EDFA 1AD2A 1TQ8A 4ZEWA 3O8QB 2B6HA 1VRCA 2Q3FA 5TGDA 2FSGA 2WP8J 3DEJA 2A1UB 3F78A 3KE8A 3WISA 5BSGA 1B23P 5JVDA 3MYRA 1NMZA 3CTMA 1CVRA 3AZPA 2WHYA 4KU4A 1JQ5A 3LL4A 1JPVA 4I50B 1QRTA 4QSMA 1RLJA 3V97A 4D8XA 1ML3A 1N9GB 3NDPA 3OQVA 4L8WB 1WS6A 3QEMA 4XVCA 2WE7A 4A6PA 1TRKA 4Q1VA 3DDHA 2QPOA 2DP4E 1TAUA 4LA4A 1SOWA 4Y7CA 2YRXA 3DFKA 4ITVA 1SCKA 3E3AA 1IZZA 4Z0HO 3MW8A 4CMJA 5JQGF 1V7PC 1YDFA 3M5CA 3RAGA 2OENG 5CDFE 1OLXA 2CVFA 2I2CA 5K4HA 4R2XA 2I3ZA 4HZUB 1UPTA 2OB2A 3GJZA 4LISA 5CD9A 4Y6QA 3ICWA 2JIOA 1QYXA 4HRXA 4W7IA 3FBGA 4P08A 4WESB 4B81A 4C7OA 3K16A 4X7RA 3H3XA 2YXEA 2C5BA 2G07A 2L42A 4DQXA 4J7XA 2XUAA 2N0SA 4BB5A 3HUTA 1OXMA 2DFNA 3EWSA 2HK6A 1OFVA 2GJ4A 3ZIDA 3EWAA 1WOYA 4PFQA 4QUHA 3O03A 3A4LA 5DTRA 4JUCA 2PGXA 2MSCB 1RWOA 4JELA 1BOOA 1S01A 2CNDA 2J5BA 2X14A 5HE9A 4B4UA 5K8LA 1JI3A 1UBHS 3PUVA 3Q88A 4A0GA 5AUNB 3Q8KA 1XFDA 1BMFA 3M49A 1TVEA 1OXBB 5AKEA 4HVLA 2W5UA 2Q1UA 1VIDA 1YIAA 2Y1FA 3F8WA 3U7RA 1EEHA 2WWFA 2ZRLA 4G81A 1ZWLA 2FZGA 4JLOA 3L5OA 2GBFA 1Z5PA 4Y1RA 1DGQA 1AZSC 1MIHA 3NDRA 1ZOIA 2O8CA 1HEIA 2QMZA 1QPZA 1K97A 1MXFA 2VDKB 4LTNA 4A8TA 5SY9A 3ZYZA 3RF7A 3LCVB 3QLVA 5K8IA 1Y4DE 3E8SA 4IIJA 2AMFA 4XCXA 3UJBA 1EGMB 5G0TA 4WKBA 2VUUA 1R0YA 3NJ8A 4MW0A 5EIWA 3P2JA 1P1BA 2YYAA 4KQFA 2PUGA 1GG5A 3FCSB 5IBQA 3IUJA 1L1FA 1BQ4A 5DJ5A 2MIIA 5ALEA 3ZNNA 3NBKA 4DA0A 4C7XA 2DUWA 3NORA 3K1ZA 3EEOA 1VL1A 3L0IB 4IBOA 3S6JA 4ALJA 2C61A 2X2FA 8GPBA 3NT5A 1U0GA 3BSYA 3Q7RA 2DPXA 5J5CA 3NRCA 2AR9A 5IARA 2GPNA 5EHIA 2J85A 2IWHA 4B32A 1UBTS 4EJSB 3EQZA 4JASB 2IGTA 2QSJA 4BMNA 3N0VA 3THOA 4LQDA 3MNFA 2XUJA 4NYIR 3HKBB 4YMHA 1C9MA 3PHBE 3KEFA 4J1TA 4RNCA 1U2DA 1A2OA 2FMUA 2N1MA 3RDPA 3RSHA 3RAJA 1E20A 1TAGA 1QKKA 1W29A 3MSCA 2P5UA 4YAEA 3R7LA 1A9ZA 2RCYA 2OT3B 4EI2A 1O57A 5KJFA 2O7RA 4I1YA 1TU0A 1R6AA 3KKQA 4ZHQF 4OK5A 3VMFA 2GDJA 1MQ8B 3K71B 3MWKA 5L6MB 1JG4A 2XQKA 3NM4A 4WFQA 3A6DA 4J0EA 5KQRA 3LW7A 3P9RA 4B4OA 1GTSA 4QQRA 3VR0A 5AW8A 2QX9A 1MC1A 4MUYA 4C2BA 3LT4A 3C6KA 3AESB 4O25A 4KLNA 2OBMA 5HRAA 3G49A 4B35A 3OEEA 1TCAA 3OBIA 4YHHB 2PKWA 1DKLA 2W83A 4MRVA 2NZ2A 2X13A 3IAFA 3QLUA 3K20A 4PZ0A 5HILA 4LOIA 4KITB 2EZ4A 4UHDA 4JODA 3S8MA 4PPQA 4PZLA 2RH8A 1XEFA 2OD2A 2ODBA 1KPGA 3GLFB 1GZ4A 1G63A 1YJCA 2DLDA 4HN2A 3STXA 2XRFA 4N4AA 3O4JA 3ZU2A 4BC0A 2EKDA 3CX7A 3F6SA 2IX9A 2QJRA 2MINB 4D0GA 1VCIA 3L0YA 4CDMA 1QCDA 1AGYA 2XKKA 4CUJA 2NZUG 1EFVA 5DN6D 3AIIA 1DWPA 3RBAA 1T6XA 4G5SA 4PONA 5LXTF 1RZUA 4ZARA 1UXIA 2VHJA 2VK2A 4J91A 4N41A 3R7SA 1SXHA 4OSPA 4YCBA 1VI6A 2XADA 3FGPA 4Q9JA 4IQFA 2WM8A 3UA3A 3VU9B 4QU5A 1LVHA 1CEYA 3FFAA 4ON9A 1LI5A 1SHJA 1EUDB 4X64B 3DE1X 1IIRA 1O95A 3A10A 3BILA 5EY5B 4MARA 1M2KA 2VDRB 4RMJA 3OVMA 5BSMA 3WNCA 2NXEA 5CNMA 5AI6A 3SGLA 1UOQA 4FJ0A 5BN3B 2WSBA 5T3YA 1T8RA 1DQSA 3VGPA 1A8HA 1CU1A 5G0UA 2DUMA 4AYXA 1G9XA 5L6LB 4JAVC 1NQAO 4YALA 4OLFA 4ADSG 3WDKA 1TA9A 2C7VA 2RGWA 4EH1A 4QXOA 1P44A 4BPRA 5IJ0B 3AI1A 3F5FA 3ZS9A 5COAA 2F8SA 1NW6A 1TJ4A 4I6JA 5THKA 3FMPB 3IPCA 4D4MA 4MAAA 3SC4A 4HUTA 5KNDA 1EE1A 2NZ8A 4WLUA 5K09A 5K0TA 4BO4A 1CJCA 1JQLB 3WLJA 3WDMA 3G8BA 3OFNA 3UWMA 4ZC8A 2BZ1A 5B7NA 3NI2A 4PIVA 1A5TA 2XMGA 1QCZA 2RBKA 3CUUA 4OM7A 2AIRA 4D74A 3WWCA 3N2KB 4LHXA 5CBPA 2Q29A 3FYUB 3KVRA 1K6JA 2QK4A 3A6ZA 3AETA 3IH5A 4O2BB 2YUIA 1BDHA 3Q7EA 4RJLA 1JMVA 1RE0A 4XPZA 2VF4X 5C80A 4AKEA 4UVIA 4BQOA 1ODJA 1DMRA 2AQIA 3QJ5A 2DTEA 1TTTA 3EB9A 4QRHA 3DE4X 4LXXA 4UBOA 4KREA 4ESHA 3DYIA 2IODA 1ZRNA 2HWWA 3FNFA 4DUPA 2AFIE 3DMNA 3V8QA 5JANA 4Q00A 2ASVA 2FG5A 4MR8A 4CR6A 1P7CA 4BWFB 4EBBA 2NADA 2VP2A 4UM7A 4LPKA 1QQBA 3CG0A 3GRPA 4Y0AA 5E2IA 3MJEA 5KKCA 3AG5A 3IP6A 3DP9A 4MRPA 4RGVA 4XARA 3W7VA 3WQSB 3WLKX 3FOWA 1AK9A 1BDJA 3I9OA 5HPYB 4A5OA 4JU8A 1ZUD1 2D59A 3TM5A 1OILA 2HYIC 1NMSA 2LIPA 1VLQA 3CW2A 3D0KA 3IA7A 3ADOA 3OH8A 4QUAA 3MCUA 3WB9A 4ZXFA 3BD7A 5JDCA 4AY6A 2I2BA 4EUNA 2PUBA 3M4XA 4DMLA 3M6MD 1KZ9A 3UG7A 2Y1EA 2MOKA 4GWKA 1HY3A 1Y3DE 4TTSA 5IVIA 3BFXA 3E23A 2PBLA 4CM3A 1CLEA 1L9XA 3G0GA 3LQRA 2WILA 4KFTA 1R18A 1L5SA 1WEKA 5KIAA 2V6JA 2YBEA 3EVZA 3WKAA 1FDOA 2CBXA 4TXJA 1N34B 2EYUA 4BKPA 1SUEA 3SJBA 4GRDA 2R1ZA 5DHPA 1P2FA 2OZKA 5LZ4A 1T5IA 1JKFA 1EZZA 3KL4A 1BWRA 1KQOA 3MCAA 4MCHA 4Y2PA 5EE1A 1BJRE 2RK3A 1JQ3A 3QP9A 5FQOA 1Y8CA 2WMNB 4N0PA 4W7HA 4P7JA 2WSYB 1Z0JA 2H2HA 2JB9A 3WOVA 3MTGA 2DH6A 2FN7A 3HVHA 1XT6A 5I45A 2HX1A 1RJEA 2B37A 2F6RA 1JQBA 1NWCA 1L4YA 1ZNYA 3TGWA 4W5QA 5JR3A 2XXAA 1Z5VA 4GPEA 2I6UA 4UOQA 4JUAA 2G8LA 2FFRA 2DT8A 2SCUB 3JQGB 3ESBA 1CEEA 4LXTA 4FIZA 2P2YA 2X5JO 4NCHA 3QNUA 5AW5A 2PO7A 5KYNA 3CCFA 5DK6A 2EKPA 1DQRA 2FEMA 4J90A 5FLYA 2R8EA 1AKQA 1EBFA 3ABZA 3CU5A 3LLMA 2C20A 4HDNB 4HJRA 5DHTA 1KSFX 2FK7A 1QIIA 1JHQA 2G09A 1XGKA 2JD2A 1H1LB 4HSGA 4YASA 4B87A 2DC1A 2Q5OA 2XDAA 4RY9A 3IUQA 3LD9A 4GMDA 4YN3A 3FFXA 2CHQA 1W8IA 3N2GA 3RSFA 4PX5A 3C6MA 5CVJA 5EXEA 1MJFA 3S40A 2DT5A 4PX3A 3NEJA 2DQKA 2QTWB 1ZX1A 4RANA 3ZUPA 4UMEA 4PO1A 4EZIA 1P4SA 3VDQA 1RT9A 4RQAA 1CC1S 5KHAA 5K05A 2IZOA 2OAP1 2YV4A 4COKA 3LYHA 2OORC 3RVPA 2PUFA 1UXGA 4UNNA 1N0IA 2EATA 1FUKA 3HVUA 3EF0A 3INTA 3LWDA 4HPXB 4D9IA 5EJFA 1VI2A 3OQ6A 3L40A 1JIUA 2Y4NA 3MMZA 1XDWA 2RAVA 1C3VA 1NT4A 3FD8A 1UPUA 1YQ9A 4S05A 5EHXA 3O9MA 3UC9A 4YAKA 3JPYA 4RF4A 1XMOB 3D8RA 3ZGLA 1OIWA 3B1XA 3FRHA 3ANYB 4GBMA 4I4IA 4ZODA 5D7BA 5ENDA 3F7TA 4PSKA 3RIXA 3T4EA 4LWZA 1YUMA 1Q6ZA 2QYHA 4GOLD 3KETA 2VDWA 2BHSA 4Q9IA 6REQA 3DZBA 4QUJA 3W34A 1P33A 2JEZA 3PRKE 1GM5A 1JHMA 3HO1A 1A71A 1DAGA 2EWWA 1W0KD 3DL2A 5K8VA 1TYCA 4AWBA 5JMOA 2Y0CA 1Z7GA 3AM5A 3GRZA 2YNMA 3LIIA 3P9KA 5GJVC 2G9QA 1OFUX 4M54A 2RHLA 5TMPA 2DUUA 3WS7A 1AUXA 4LJ9A 4S2UA 4KYTA 4AZWA 4YV2A 5FV4A 1ZH4A 3R8FA 1MAUA 1OPXA 2HUNA 4NOMA 4N9WA 1HXHA 4JLAA 3QYJA 3MRTA 1HH4A 1W1WA 3RHTA 2B83A 3QYPA 5LUBA 1ZJYA 3TVYA 3PHGA 3BREA 3HCBA 4TT3A 1JG1A 2XCLA 5EZ6B 2FW1A 5E1BA 5TDHA 3L7LA 1C1DB 1QK5A 1U99A 4ERNA 4U63A 1KH1A 3L8CA 4MEJA 3ZHOA 4UHJA 2HTFA 2BM9A 3SM9A 2WUDA 2DXIA 1SC9A 4GYKA 1OQAA 1R0ZA 1SUDA 4EARA 3F2IA 3LVRE 4WW0A 4DQDA 3S28A 1GTRA 4A6DA 4EM6A 3KQUA 2PVCA 1LQ2A 1KWKA 4AL4A 1NQWA 2YRWA 3ZWQA 1YIDA 1PD1A 3C5WP 4UHFA 5JARA 1SZJG 1K0FA 3MZ0A 4UEOA 1W30A 4UW9A 2PD6A 1TMOA 3H2HA 5F21A 4X62B 1RYYA 5IVPA 4JUIA 2O8DB 2WM2A 3KS9A 4I36A 4EG0A 1ENYA 5CXXA 1R74A 2XBUA 3U17A 1LBSA 3QKRB 3FMGA 1C7RA 1I5EA 2L17A 4NV3A 2OO5A 3O3NB 4WNAA 4ZQBA 4ER3A 3KQNA 3D8UA 4U39A 5DSTA 1EP2B 2ZXEA 1VL2A 1BCSB 1D2GA 1V5FA 3SFVA 4RTKA 1YDMA 3UT0A 1LD3A 1RYEA 3CNEA 4FHEA 3DCNA 5B53A 5UKDA 4LYJA 2YZGA 5JVDF 2IX3A 1U6JA 3ZHSA 1W5SA 3JARB 3L0BA 1NNI1 2F9MA 4HGZA 4EYSA 3NOOA 3R23A 5JD3A 3UV3A 5EMHA 3KTFA 2EAUA 3AUFA 2HJVA 2NLOA 4INAA 4TMVA 3GBPA 2PS3A 2C07A 4NK5A 4EUEA 1V3UA 1WJGA 2GN2A 5I7RA 3OEHD 1QGAA 5HJEA 3K0CA 4KHPB 2ZYRA 3ROMA 3IUSA 5EYPA 3DOHA 3FCXA 4ZEVA 3BBLA 1J97A 3RC8A 2UXCB 1X74A 2QMUA 5EZYA 1GG8A 4LTDA 3RYFB 4K26A 2H59A 3R3WA 4W8OA 5EPOA 2C9YA 3NC4A 3F6PA 4J9UE 3W5UA 5BN5A 4DSTA 3ZE6A 3T3PB 2DFKB 2OCBA 3U2QA 3MYYA 3SC3A 1DTWB 3LT0A 2IE0A 1AXRA 2X22A 3X1WA 3ZLBA 3DE0X 1GQFA 1DRUA 2PSDA 3BXEA 4A8PA 3ZXIA 2VJNA 4ZDWA 1XXHB 1ZW6A 3S44A 3EG9A 2GYUA 3Q2IA 1GTVA 1X9HA 1CR1A 1SUPA 4WECA 5IDYA 3RT7A 3QXCA 1KRXA 1QYIA 1D3AA 2Y9PB 3IOEA 3HR8A 5DKFA 3T5BA 1QHIA 4YRMA 2J6BA 2JGDB 4K6MA 3CJRA 3GRFA 1KOJA 2IIBA 3N6VA 4FVTA 4I1RA 4WUVA 4KVZA 4F91B 5HQTA 2AZ4A 5K03A 4Z4IA 2XSZD 4ND1A 1XMIA 1LPPA 4B43A 3BMOA 1FFEA 3EA4A 5L3VA 4NBUA 3CNNA 4Y1EA 2CJYA 4NCKA 4PTLA 1D1PA 1FP2A 2Q5IA 2BDEA 4OA8A 4YLEA 4E5VA 3EASA 1R6UA 1C9KA 1WA5A 2ODPA 1QGOA 3SC2A 4ARIA 2HJRA 4WBNB 5AI0A 2JGEA 2ZXUA 2BM8A 4OJQA 3TW8B 3H5RA 4MXDA 3DLTA 1CQJB 4E32A 2ONJA 4AI6A 1DAMA 4J49A 1J49A 2WUFA 4IIJF 3EPKA 4YYEA 3H9QA 1KFJB 1WDMA 2OA0A 3G0HA 4MW6A 4YQEA 2PA3A 4FQ8A 2WWTA 3IVGA 1OH6A 4HEHA 1T6ZA 3BFJA 5HF9A 2XUPA 2E4AA 3FDZA 2VNJA 3O2JA 2P9TA 3WIEA 1CY7A 1Z37A 2V5VA 1A1VA 3LLSA 3OHPA 1P18A 3PT9A 4PX2A 2Z2ZA 3BXHA 2B1JA 1EUDA 4ZVQA 2ZGVA 3JYHA 3KVOA 3L0PA 1FEZA 4YCNA 3DBIA 3P0FA 5ALXA 2YFYA 3WB1A 4L6AA 4U2DA 1NJ5A 3GROA 4KN5A 3TD9A 1ZY2A 4R16A 2WE8A 1YE5A 4L16A 4MAMA 3Q10A 2J8ZA 4G97A 4TKLA 5AW6A 3AWDA 2EGUA 1E1CB 5AESA 1JVSA 3CUEF 4Q6BA 3Q3CA 3GLSA 1VJ0A 3IEIA 3B7PA 4AB1A 4YP0A 5JPDA 3AHCA 1G8HA 1W581 3OOEA 2BDTA 4B3TB 2WSIA 4BJ1A 4ZHSA 3KZNA 1IQUA 2X0RA 1DAOA 3BB4A 3DLIA 3T3GA 3U37A 2Q6KA 4MX8A 3FLAA 3V4VB 3IQGX 1T6BY 1VJRA 3W5HA 1SURA 3OE7A 4F86A 3Q7IA 3DAGA 5JO9A 4MKRA 3CUYA 2O8NA 2J6CA 5BOSB 3AX6A 4ROSA 3ABRB 3FZNA 1L4NA 1YBMA 3SE0A 3IL2A 3QQPA 1KO1A 4FR0A 1NQTA 2WTBA 1NYTA 4WOKA 5LM3A 4JI4B 4PQRA 4TVOA 1KEEA 4MYTA 3KP1A 3BIJA 3SF8B 4G5YA 3SBOA 1YQGA 4K28A 2NU9A 3O4RA 2JI9A 4URYR 3BJIC 4UOZA 1DEOA 3OJFA 2QPTA 4JHLA 3MM4A 4IFEA 4N7JA 4P92A 5M34A 4ICIA 5TQVA 2D2VA 3DCJA 2QZSA 1PNOA 4FC7A 1S3IA 1OBCA 4PN7A 1B0ZA 3ULKA 5FPKA 2F43B 1L0BA 2JFUA 4FQ7A 2ANCA 3DOFA 4RV4A 4BQQA 4RIGA 5IH7A 3GUZA 1S2LA 4LJ5A 1XU4A 3AFIA 3A9SA 3OESA 3QE4A 3TNFA 4N3CA 4J4BA 5GPBA 1BN6A 3RS2A 5J4KA 1D9ZA 2B5OA 2C2YA 2X5KO 2Z0MA 2LIVA 3PXAA 4NPCA 2IHZA 2BRUC 3SBDA 4B7ZA 4RZHA 4GM4A 4C08A 3HGTA 3TMYA 1IJBA 1AK2A 4LAFA 4LBYA 3SEZA 3JVUA 4DUYB 2PFGA 4QVGA 2R66A 4KRFA 2VHTA 2AQKA 3DTVB 1PI3A 1QV6A 2LGJA 4XDYA 1P7YA 2O5EA 3VJRA 3WGUA 821PA 2O1EA 1XRMA 1NF8A 3FNHA 1KPIA 1A8PA 2M6LA 4C5CA 4R1SA 1SU6A 3MD0A 3SYLA 4NCBA 3NDBB 4LXQA 1EFCA 4HNHA 4OUDB 4LDQA 2V0CA 3B1JA 1JIXA 3E9YA 3PR3A 2ZWVA 3KTAA 1SUSA 5HP4A 2PL3A 5FOVA 1FYDA 2WV7A 5MN6A 3EPPA 3HO6A 3LK7A 1Y3HA 2C2KA 3U16A 2XJ4A 4AJIA 2I33A 2H65A 3B38A 1FJXA 2VBGA 3OTGA 2ES4A 4DZTA 2X0JA 3V2UA 3GHHA 5DTQA 4C7JA 3LQ4A 4YDSA 5JEEA 1U7XA 1HYQA 4TQGA 5IHXA 5CB4A 1FUIA 4X8HA 3NGLA 2Q46A 2B4TO 4ME6A 2ACVA 1AQUA 2ZB7A 3UPUA 1OBHA 3UMBA 2HB6A 1TLFA 4UKDA 1KP9A 3L46A 3DGFC 4YECA 3S2FA 1ZLYA 3CVVA 2WD9A 1WVGA 2DH5A 2IIVA 3IOCA 4I2NA 1NC3A 1PZHA 5KU7A 3QHQA 2ECPA 2XRMA 5BWNA 1K3FA 5JCJD 1WD7A 2Q3BA 3AOEC 2P9JA 4XGIA 4BMXA 1X7XA 1J09A 4S1VA 4MTLA 1PHRA 3GP5A 3L8ZA 4KOEC 2X3YA 4A5SA 2JGAA 4QOEA 3UAWA 3GDOA 5BURA 1CKEA 2O7VA 1VMIA 3ASVA 4EG6A 5E4TA 4CCYB 1KYXA 1RCUA 3ZHBA 2VP3A 5BXQC 1FXUA 1PDVA 1PR1A 3GDFA 2AN1A 3LZDA 2I6QA 4NBNA 2VEDA 2R6CA 3DEAA 1PEYA 4A0FA 2ORED 4EGFA 4KJXA 4KDRA 5F2NA 4C4ZA 1DIOB 3GAAA 2YWHA 4YRIA 3Q4GA 2HJWA 4NV1A 2V55B 3TOSA 1PT9A 1ZCZA 2ZAIA 2NXCA 3WRXC 4HQFA 2VHQA 3I6QA 3D3JA 3TZBA 3Q6NA 1GTMA 4U4AA 1PFGA 1VJDA 2QRZA 1YNSA 2W2MA 3JQ9C 4U5QA 5ELLA 4DCOA 3GFFA 5TIIA 2YOFA 2ZIXA 2QX7A 2R85A 1KA9H 2IEBA 2B82A 3MJDA 4MW7A 4P81A 4TTQA 1Q0PA 4M3NA 3OO0A 1PK9A 2ZRJA 3THRA 1E1DA 2I66A 1SFRA 3HCFA 1NL3A 2EZUA 3CQ9A 4GLOA 4S1TA 2XMPA 4P80A 2IXAA 1NU6A 3LRPA 1CR0A 1AB6A 1E66A 1Q0UA 1A4UA 1TT5B 1E5VA 2WJIA 4ZVNA 3U7EB 2R1UA 4A0RA 2QAGC 3OJXA 3VX3A 1NXXA 3CVUA 4XIGS 2VHVA 3E7DA 4V3BA 5E4FA 2Q2NA 3B78A 4B4WA 1RWBA 3I53A 3M8KA 1HBJA 4TZTA 3T3EA 1FYEA 3WTCA 2WT9A 4P4SA 3ZCXA 3TG2A 2RGRA 1FNCA 1QIHA 3AUTA 1M8JA 3PR2B 3GBVA 4BWGA 3LFUA 1AKTA 2A57A 3C3CA 3EY9A 2X4DA 1AQIA 1M34A 4DJJA 3D2LA 2D13A 2CW5A 2Q9AA 1CD5A 3IMKA 3MBOA 4Q39A 1NNLA 4Y9SA 4HWSA 5ED0A 4DCGA 5I9NA 1PSDA 1L4EA 1Q57A 3ESQA 4FGWA 2WT4A 1MQAA 1NSYA 2AF4C 3GEIA 4LNAA 3FFTA 3AGPA 1Y34E 4JP5A 3CY6A 3DB2A 1KAMA 3K3PA 1V7QA 1Y7HA 3KOYA 3LT2A 1SK9A 3LPNA 3NNNA 3EAGA 4IV5A 4D3ZA 5AUPB 2OMKA 2E21A 3A36A 1FYVA 1Z9BA 3GFVA 3LLUA 3MFYA 4IQ0A 1ISHA 2O14A 2EBUA 2Z4SA 4KYUA 2ZPUA 4X8LA 5DEIA 4JP3A 5FA5A 2MSDB 5T4HA 2GTIA 1ATIA 1Q11A 1JLHA 3DV2A 4DFDA 4GI1A 1XXLA 1NZFA 3TTYA 4L8YA 5EXXA 3WGNA 4DV1B 2VTBA 2Z83A 3N8DA 1F0PA 1BVYF 4HG2A 4KXXA 5TB5A 3HZRA 1UFQA 2ADFA 5LYYA 5LQUA 1YKGA 3GVHA 1P0IA 3PXEA 1QRUA 4N49A 4NXNB 4WADA 4UBMA 3HHEA 1ZXLA 3CSUA 2ZR8A 4IQGA 3P19A 4JR2A 4ZZ0A 2WP0A 3AHHA 3OJLA 1FS4A 1QK4A 2JCGA 1X8LA 1OBVA 1X1TA 1NTRA 3AKYA 3PHCA 4JT8A 3UHOA 2R6AA 2VPPA 4AZVA 5AVUA 2YMMA 3B3JA 4CF7A 4PG4A 3ZWCA 1I24A 2EQAA 2RGNC 5BQFA 2R47A 1KWGA 4C0WA 1OX6A 3NCTA 3QV1A 2O2YA 4M76B 3SLKA 3HHPA 1VL5A 1E77A 3GT4A 4RSHA 3FSJX 2W6ZA 3A6EA 5A3QA 1NY6A 4HAUA 3ZJYA 2ZUEA 4ESVA 1T4CB 4UATA 4NR0A 4QQNA 1KXZA 3FDIA 3MERA 3KELA 1O5TA 4TROA 3SEAA 2ZIAA 4JC5A 3VNRA 1XU7A 1Z18A 2B4KA 2VJMB 3L0CA 2O50A 4KUHA 1FDSA 2C96A 3PE6A 4LY9A 4B09A 4EI9A 3ZVKA 5CD1A 3N87A 4MUKA 4U8HA 3WYAA 1KE1A 4LPSA 1IIBA 2HUPA 2HQSA 4I55B 5EUBA 4AP5A 1G8JA 1WDTA 4LYAA 3GLGA 2ZSIA 5CNJA 1OA0A 1GPH1 3CRW1 1JEYB 5IJXA 1ZMXA 4ZVMA 3KB6A 4D3YA 3VU3A 3QXJA 2H7XA 4FFSA 4V38A 2IYRA 4G9GA 3IB3A 1W34A 2CLOB 1FRNA 1M7BA 3GJ3A 3P0EA 4DV2B 3CS3A 1FYWA 1Y9JA 3MQ4A 5LU8A 3UFXA 4ED9A 4FEEA 2HQOA 2IHUA 4MUEA 3ZCVA 4ZEMA 5AVRA 1CIJA 1X7WA 4YUWA 10MHA 1BYIA 1PGJA 5IS2A 3LU1A 3H2KA 4L0QA 2HJGA 4AUNA 2PKCA 4JBWA 2G0NA 2OV4A 5EI5A 4RMNA 4ZAGA 3RLFA 4A1OA 3EXG1 4CNBA 2AUNA 3LPCA 1IE3A 3FNQA 3JPWA 3IUEA 5LU9A 1Q0QA 1XQWA 2O5VA 1UC5B 1T1SA 2XB8A 3ONVA 1T4MA 4H16A 4LG1A 4WKNA 5TPZD 4E1BA 2V7EA 2C2WA 2UYOA 1YU9A 3U31A 4XFDA 2QHXA 2GCEA 5A4MS 2ACKA 4FOOA 2O0JA 1RYDA 3CT6A 1MLDA 1XTQA 1AB5A 2EF1A 1UPCA 3VR5D 1X80B 4BYMA 3R77A 1F9EA 2DB3A 1RIFA 1S8NA 4XD2A 4Q1DA 4BX9A 5A4AA 2JCYA 2BFAA 2HF7A 4GO1A 3U13A 2BELA 4E70A 3AW9A 3AJRA 2W2VA 4B8ZA 1NV9A 3WHPA 1GNPA 4F6LA 2WYIA 5DIZA 4KR7A 3B89A 4EFKA 3FOZA 4REMA 3DWGA 1V1RA 4X6YA 3UWPA 3MINA 3ED5A 2PX4A 4HF7A 4PAOA 1JKJB 3JD4A 3ZV7A 4DJFC 4BLTA 4UTRA 4QE3A 2YQZA 3GFGA 6LDHA 1CW2B 5CA0A 1YFZA 3I2IA 3M6WA 3OE5A 3MOIA 4B2LA 4BAGA 1KEWA 3S8YA 2NV2B 3EIWA 4DCMA 3ZVNA 5F33A 4N3AA 3BE5A 4LK2A 4BMPB 1GPJA 4BP1A 5I3CA 5GIPE 4LRUA 4U7TB 5CH3A 5DBFA 1AOXA 2FSPA 4RXTA 3RU3A 4EECA 1MH9A 1CRQA 2CL5A 2EEZA 2WKSA 3EJWA 4RH3A 4ZYYA 4RV5A 5HMMA 1GPWB 2GRAA 2UXDB 2NQ2C 1JEJA 2H92A 3ANSA 2EDCA 4U8GA 2GUWA 2Y1WA 2YOGA 5ALOA 1SIUA 3QU4A 5IANA 1U5AA 2A88A 2MSNA 2B30A 2XGGA 3OLCX 5MGNA 3LCRA 3F5QA 4XVHA 2I1VB 5F73A 4HDRB 5HUQA 3E0XA 1D4OA 4C07A 5CXQA 3ZI0A 5H68A 5JH7B 4IDOA 5DM70 1JVBA 1QR6A 5ICFA 1PNRA 2X1MA 3EIQA 3WR5A 2C92A 2P7IA 1J39A 2HCFA 2JLQA 5GTDA 2AFHE 3SZLA 3BL6A 3NT4A 3V4OA 2RBEA 1TU4A 4C01A 5JBQA 1GILA 2WIBA 2WW8A 4B3HA 2OORA 5KMGA 5CLIA 1YAHA 3DFFA 4HLQB 1ZCAA 3FHTA 3EGIA 3KALA 1VECA 3PJGA 2CV1A 3E9RA 4KB5A 4J0HA 5GY7A 4DARA 5B57C 4JCOA 2E3JA 4AZ3B 3CEJA 2C4VA 3E3LA 2PS1A 2FEXA 3MD9A 1ONPA 1RI4A 4K6GA 4O63O 1G0OA 4QTYA 1VLMA 1FZTA 4RLFA 1UFVA 3B9BA 4XX1A 4L8VA 1LLCA 2W2LD 3PFIA 4NYMR 1MRNA 1RCTE 1CIPA 2OGTA 3TLMA 3BXOA 4LCBA 4WK4B 2VH1A 2MR6A 2PA0A 1GZDA 1NW4A 2CKDA 2FUKA 2KS6A 3IBTA 3LBYA 3LGXA 4KXYA 4CHGA 3HKCB 3BPSA 3PUJA 1MA3A 1MEEA 4OQLA 4ZVSA 3MS2A 4A03A 2EKLA 2ZBEA 4V24A 2VS1A 3K9WA 3KWJA 3R44A 2EQ5A 2IOHA 5FUWA 1E2HA 2F3SA 2R11A 3ND7A 1ID8A 3R8XA 2WQ6A 3O47A 4PLPA 2AK2A 4CMIA 4HDOB 1P74A 3AI3A 4URVR 3QUCA 1E59A 1XZGA 2QVYX 4PO3X 4MUFA 3SZMA 1L4LA 2Q0HA 2PLRA 4YS6A 1KBQA 2VOJA 2PVSA 4C1NA 4HUQB 2F59A 3GN1A 3DHYA 3QVXA 5T67A 1Z7BA 3N53A 4H3KB 4OB7A 1Z5UA 3RSSA 1CJBA 5F1PA 3ESCA 1O94C 3T9CA 4DMCA 3T5AA 4KODA 1DELA 1FS5A 1FDUA 2GYYA 3LE8A 4FR2A 4YONB 3UATA 5JE8A 2NPIA 4RA6A 5A6SB 1XRPA 3FPCA 3EEQA 1TAQA 2HHHB 4HNVA 1CRWG 2FZWA 2B8NA 2JAPA 1FX1A 1RRPA 3H9UA 3BE6A 2V6IA 4CM8A 421PA 5IYZA 2C83A 5ETJA 5FNVB 2KX7A 1MOQA 2FJ0A 2OC9A 4E31A 2X4GA 4ER0A 4YLYA 3H1GA 4L5JA 1ODIA 3UQZA 3VH3A 3GFOA 4RPKA 1HE4A 1Z26A 2V7TA 5EJ5A 2YHBA 4PGAA 3TZCA 1EINA 2J0UB 1JB9A 3GZNA 3NHLA 4AY4A 1ZD4A 4CR8A 1QX3A 4AAYA 5KOIA 1ZEMA 4PBSA 4U02A 4HQNA 1A76A 2O2XA 4GEGA 1HRDA 1SR8A 4RMGA 3FNGA 5DTIA 3SWWA 1H1DA 3I0NA 4WEOA 4PHCA 1CDEA 3F3YA 4N0EA 4L50A 1WXGA 2GEFA 1S5PA 5AOVA 3RO7A 3SYNA 3ZNPA 2X2OA 1Z29A 2ZIWB 4PC2A 3FOFC 3G5UA 4Q01A 3KAJA 1NBMA 2FW9A 3ZCSA 3WNVA 1E3IA 3NOQA 3KKZA 1QP8A 3AL2A 4FOTA 3AJ8A 1L1QA 1PT6A 1VCOA 3G8AA 4Y98A 3IEMA 3ZCQA 3TMKA 3PKJA 4BMYA 4DLBA 3SOZA 1U8ZA 1JR3A 1OX5A 1CBUA 1J1IA 1UWLA 2HMSA 2JI8A 3VVBA 4F2WA 4UOEA 1RWKA 4AJKA 2KB0A 5DN9A 1RXVA 4NXMB 1FMJA 2CVZA 5K4AA 5CX1B 2Q0QA 4C7MA 4IS3A 5IDVA 3X2SA 1EGVB 3KKNA 3H1PA 4B9EA 4Q1FA 2HXYA 1IZYA 3CURA 4RZXA 4X41A 4G5QA 1H9CA 1ZUNB 4IIGA 3RRJA 4RIHA 5G2OA 1WLYA 5CFLA 3DQQA 3R6TA 4UARA 3DOIA 4CMAA 3M70A 3H16A 5C81A 3A1UA 5CB4F 3VNBA 3WLOA 4RFSB 4UAVA 2QJFA 2FX5A 3BVPA 3ESXA 4IO1A 1J5EB 1GIAA 1S2DA 1U94A 4KDEA 4L3VA 5H82A 3D7SA 4RQBA 2ATIA 3LKBA 4MV5A 4E2XA 1JEAA 2CF6A 3TJRA 3WK6A 3IVAA 2JA1A 3OKAA 1G5QA 1IY8A 3H8VA 1DL5A 3R3VA 4IF4A 5C0OE 4LYEA 1M7GA 2NQTA 1H2EA 2FX2A 2QLBA 4PGHA 3QJGA 2F1OA 1G16A 2OHJA 4FKBA 3VGJA 2P4EA 1QVRA 3HXLA 2HC9A 3QOXA 5GIOE 4LF4B 4O2AB 3L8FA 2RK6A 2O23A 2YXPX 3DXYA 5EUQB 3CLHA 4BQEA 4OHRA 3S55A 1O0CA 3OJWA 1AHNA 3WY9A 2DECA 1BQ3A 4JJ8A 4XDGA 1DC3A 3FZEA 2UUCB 2C5EA 1RHRA 1J2RA 2LDBA 5L3ZA 1Z12A 1MFPA 4RHTA 4ETIA 2GUGA 3K2BA 2HWUA 1PJ3A 2X8AA 1E6MA 1MNAA 1A95A 2ZI9A 2JFOA 3TB6A 4YRBA 3KYBA 4G3XA 4KWTA 5D5PA 4B46A 4DLSA 3VI4B 1E2GA 3DDUA 1FDRA 4WK6A 4AM8A 4BQNA 1XCBA 2G06A 4MO9A 5ALDA 1YZLA 3EXAA 4PR0A 4DLYA 2R1TA 3I61A 3E7FA 3PDJA 2EP8A 2NTVA 4ROTA 4MNTA 2R7MA 1XEXB 5DXFA 3E82A 4M8SA 1QKJA 5IUNC 2AL7A 3EXHB 1D4ZA 4XGQA 1DT3A 2D7CA 3MWJA 2VTEA 3FPGA 3QA3E 2CCGA 4NDNE 4GX0A 2RGUA 3NTOA 4Q3NA 2B5WA 2CFRA 4NZNA 4QNRA 1Y89A 2IYUA 1EFPB 3UUEA 4H4DA 4CL0A 1I5OA 3A9VA 5JNTA 1GQSA 1XHEA 4RYDA 5C7OO 4OXQA 3PSAA 3KLPX 1DSSG 4F1WA 1QV7A 1D5CA 4QO8A 1GDHA 3TQTA 3ZKAA 5C7YA 1L5GB 2D7JA 1IN5A 5JI2E 2IELA 3OZXA 1K8QA 1E2JA 1QYDA 5DU2A 3TL6A 2HRCA 3TLJA 5IZCA 3A9UA 1XZFA 2WWWA 3HSSA 2GJ9A 4M60A 3K32A 1RC1A 4YIKA 3DJFA 4MV3A 3UQYS 3WWDA 4R5MA 2ZJ3A 1U3DA 4NK4A 4CV1A 3VU1A 3OWHA 3BKWA 2QZJA 4JBXA 4AN4A 4Z7QB 4M0DA 2IYTA 1X1EA 1JV2B 3CRQA 3R75A 5LD2C 3TW4A 1EK6A 1V1MA 2C95A 2CFTA 1YVPA 1HE8B 2FPIB 3QUAA 1O87A 4QM6A 1MORA 3MTBA 1QANA 1I33A 2FV8A 4C4YA 3AXTA 1PFKA 3ECSA 4ARZB 4RTPA 3K5IA 5LA6A 2HLHA 2BEUA 4PCLA 2E4WA 1EUQA 2FI1A 1IN1A 1M1YA 2NO0A 4P83A 5L45A 5AVSA 1Y7TA 2IKSA 2RGAA 3C1UA 3WYEA 4F8EA 1EP3B 5F3DA 3BHJA 1GPNA 2XD4A 3PGVA 3TIGA 3GLGE 4XGNA 1N32B 2VPXA 5F9FA 4NHEA 1GXSB 4JUFA 3VSEA 4XJTA 1ZK2A 2BRUA 2W6CX 4IWNA 4A2WA 4NQRA 4RLQA 1MO5A 3C15C 4ZAZA 2VRCA 2E85A 1Z38A 3D1LA 3A1NA 1CUZA 4BASA 2RI6A 4B7UA 1WXWA 3I6IA 3QF4B 2JGMA 2PV0A 2P8JA 4HGNA 4YCMA 3T5PA 1YDGA 1XTZA 3LPMA 4ZGGA 3AL3A 3PYXA 4F2PA 3NDIA 2WU4A 1RKBA 1ZONA 1TQHA 3HP7A 4IF6A 4OQPA 2FNAA 1KK2A 2PM8A 2W4MA 2N1BA 5BN1A 4W63A 4EB0A 1JLSA 1FU7A 1XMSA 2EJBA 4RWZA 5D3MA 4GD3Q 4ZU3A 3RC3A 2LCFA 121PA 2NU7B 3COVA 3B3FA 2AD1A 4MVJA 4CLOA 1KJ9A 4TSRA 2H8KA 3B1KA 5KNCA 3H2JA 3C5VA 2CHGA 3BZBA 4KE9A 1QP4A 3CKMA 5AOCA 3MQFA 2OXFA 3ORRA 4OQEA 1XEWY 2ZBFA 4MHOA 3O74A 3C3EA 3BORA 3C1TA 2G9ZA 1E1QD 3MCTA 1FJHA 1KKUA 3GD7A 1NLUA 1JQAA 2IXBA 1B6TA 3EZ6A 5DK4A 4BNWA 4E6PA 1GKKA 1SVSA 2HBYA 1UDXA 3AEZA 5AHKA 3AY3A 2DJIA 2WTUA 1LPNA 1QR2A 1DPGA 3EQ9A 1Z33A 2IY9A 1G20E 4IDEA 5LIRA 3BGDA 5BNTA 2ZUCA 3KTDA 2B94A 2ZJYA 2ZM5A 1A98A 2AOUA 2RHMA 3I92A 2UUPA 1G38A 1IULA 3KQKA 2X5XA 4F9FA 3H5IA 1EX9A 3M4ZA 1SXJD 1DMSA 2GWHA 1OB2A 1W5BA 1PD0A 2EKBA 4U6QA 4UZEA 1LCIA 1H69A 2QGFA 2WF9A 5JSZA 1RI5A 4RJJA 1EXDA 2WJPA 3FYCA 3PFHA 5LFAA 3WIBA 5HW0A 2GR9A 2IEDA 3CF4A 3EFBA 1E3QA 1G3IA 3EE6A 3ETNA 2WKPA 5ESXA 5ERXA 3F4BA 1KJQA 4JOCA 4TSFD 3UK2A 4DCVA 3NC1C 1XVAA 2O07A 4F2GA 1PWHA 3JQBC 4NU0A 4NX2A 2YJ4A 2A5FA 3D59A 1H4QA 3QX8A 1GVNB 3DAHA 5TF0A 2GARA 4FFVA 4BCDA 3I62A 1SG9A 4MWSA 1SWWA 2OTCA 4KGDA 2HMVA 2Z2XA 5DHFA 3WRXA 3CRVA 2W43A 2XT9A 2WJWA 3JQ9A 3RTAA 1ZSYA 1ZU4A 2C1XA 2V45A 3A1CA 3U7JA 4CIBA 1C9YA 4OHKA 2R6HA 4YMIA 1V45E 3SIWA 2BP7B 2VCHA 4TTPA 2IOQA 3FF4A 2VH2A 1ONSA 4JJFA 2ZT5A 3EFOA 2EFEB 3KT6A 5CBKA 2VFAA 4IL5A 2XDQA 4QU8A 3F6RA 4R2LA 2VZ8A 5DE3A 2FF7A 5IXYA 4U2BA 2QAGA 4KTVE 1OIXA 5LQSA 1Y6JA 6GPBA 1HT2E 1K7SN 2G5TA 3KQYA 4U3JB 3T9FA 3IB6A 3A05A 1RVDA 1VDZA 3H4TA 4MWZA 1JDVA 4QGAA 4D97A 4EF4A 5CA0F 5GZ1A 1RSZA 1KVTA 2FRXA 3RRBA 2LE0A 3HJNA 5FIUA 5JWOA 1MQ9A 2V6FA 3Q9LA 5ENZA 3IMGA 5DYYA 1RRMA 2DFPA 4MULA 2OZLA 3TH5A 1E5QA 4QBGB 1NBIA 1XK7A 4DT1B 3HH8A 5CMLA 5DASA 1THZA 4MGEA 5FP0A 3BGIA 1SBQA 1DINA 1GKYA 1HZZA 1CXZA 1QNLA 2Y0BA 1F2TB 3F97A 3EXEA 4F8YA 2XIJA 3IJEB 4HPWA 4J0DA 2X8WA 5SZHB 3GFPA 2W6OA 4DTCA 3DKRA 1KC1A 4U7WA 1VGRA 3JRXA 3TNLA 1TTHA 1SULA 3TF5A 4K9LA 2M6KA 5DLEA 5AKKA 2IZ0A 1G3UA 2FDRA 3A06A 5HJ2A 1ISMA 1EWTA 5K99A 4MINA 1WQ1R 1ZMOA 4P3KA 1NBAA 3LPLA 3DBLA 1N6OA 1VE9A 2P9HA 3B2QA 3B7GA 3O3CA 1YRLA 4HQOA 2QPAA 3PWKA 4UE6A 5K51A 3S70A 4CKCB 1VE3A 2FCAA 3R3YA 2VH5R 3QG1A 4DVJA 2G6TA 4HDMB 1C9DB 5K8UA 3GFTA 3G9QA 4M37A 3AY0A 3A25A 4BNDA 3HGMA 4GWGA 3EGXB 1OH7A 4OAPA 4GKVA 4E14A 4H08A 1YKFA 3HRKA 3T7DA 4EMUA 1JRLA 1RMYA 4LNUB 2HBZA 4IR7A 4LF9B 1P1KA 1XKXA 3IDFA 3TINA 2VHCA 6Q21A 3VYTB 3N5CA 4C88A 3I5YA 1U98A 2RGNA 3AV3A 1QB7A 5B2ZA 2WT8A 3UGTA 2J3IA 4D6XA 5JNUA 5KHLB 1HFWA 1KTVA 4XB6B 4NFHA 1T2AA 3N2EA 2V58A 2V7BA 2XUQA 5JD4A 1SA0B 3U5ZB 5HIAA 4M88A 3I45A 3ONNA 4HGRA 2I99A 4MIYA 2R7KA 3VO2A 3BMQA 3L79A 3JQFC 1I8TA 5CVTA 2PH3A 4HPJB 5FL7D 4F0JA 1EUCA 1R3UA 2ZUDA 5B7PA 1M1UA 1MBZA 3FWNA 3K1AA 4X3CA 1HA3A 1OV4A 2D0OB 3ENQA 3AERA 5KTOA 1NBME 1DX6A 4BCBA 2JFHA 4XYGA 5BN4A 2IKQA 1T8WA 2DPYA 3CZ5A 3GLHE 3TCNA 4EY5A 3K30A 3E81A 4FTWA 4WPGA 4D9HA 4EKGA 1LBEA 3PEWA 3B53X 2BGJA 4ZT6A 5F7XA 4JVOA 1XPRA 4ABYA 3DV0B 3IIKA 1JR3E 4R9UC 3CRNA 3BWDD 1TKCA 3CRRA 1OZAA 2I4OA 1Z4PX 4W6ZA 4XCQA 5K0GA 4GW3A 1KDPA 5AYVA 2QLNA 4FMCB 3ACDA 2XUGA 1DIAA 3A7EA 2MMGA 2YHIB 1JGTA 2O2SA 3GCGA 5JJLA 3ROFA 5IYZF 3AF2A 4QDKA 1ECBA 3PA8A 1TCUA 1MVOA 3VO1A 5FUQA 4GSYA 4XB1A 1M9NA 2XQGA 3RG2A 4KGZA 5U4QA 1CNFA 2ZPAA 1OMOA 3AONB 3H2BA 1E4YA 4GIBA 4URZR 5E8JA 1ZVVA 1SPXA 1BE6A 3KKEA 3DOJA 2Y93A 1TMGE 2Q3JA 4HL6A 4YFVA 4H27A 1MJNA 3TBHA 1VG0B 3GFBA 3HI4A 3DXXA 3UFBA 3ILXA 4MVJP 3MAGA 2PZBA 1NDQA 4BFZA 1SOAA 1HOTA 2VG8A 2XZTA 2HH9A 1I5RA 1NQOA 1ZNZA 2VSQA 5B1SA 4BRZA 1UBRS 1UMCB 2AC4A 4DADA 2CNKA 3HZOA 4ER5A 4ZV4A 3WA7A 1TIBA 4G0OA 2VK4A 4BNYA 4BQSA 3STWA 3CRZA 4DA8A 4DA6A 5IU6A 1L7QA 3OETA 1YFLA 1P5FA 1WZNA 1Z08A 3PUIA 4HAWA 2JLYA 4NFYA 4NCAA 4EG3A 1SVUA 1AK1A 1XE3A 3TGPA 3ICQB 1VG8A 1CUIA 4EZEA 4TKVB 5G4KA 1QO7A 4Z7JA 5KTTA 4YP7A 2QP9X 2AFRA 1SXIA 2Q41A 3LX5A 5JJBA 2RKOA 2XB6A 2Z5LA 1KJWA 1ZW1A 2FPPB 4KWHA 5FB3A 4BNIA 2C7PA 3E2IA 2FX3A 2UZ4A 1L9KA 2VI5A 3PKZA 1YD7A 3L4JA 4NSNA 4HATA 1CB7A 1BWQA 1JPNA 1L7EA 3H7AA 4LC9A 2FU5C 1L5HB 2R97A 3I1FA 4IFBA 3RK0A 5I9LA 2BGTA 1R8SA 3I3OA 1H6CA 4DG8A 3UANA 1WMFA 4N54A 4PRKA 4LZZA 3TBFA 2XZPA 4C7KA 1RXWA 2MCFA 1A69A 4Z4GA 2I55A 5ESWA 4QREA 1XTUA 1KMMA 3E8XA 3ONFA 4OGWA 4P33A 1BEZA 3C3PA 3RSZA 1OXSC 2BY4A 4IDHA 4BKOA 4JGGA 3V5NA 3ZKWA 2E9SA 2HEIA 5LQRA 1TO1E 3QX9A 4PHGA 1VMKA 3ZX4A 2R00C 2V6GA 3L05A 3TLAA 4BEJA 3CCCA 2BMFA 2C2MA 3FVWA 4F4UA 5HQ3B 3RUIA 1PNVA 2J4CA 2YWXA 5ALHA 4DR2B 1WSDA 1T8YA 1M2VB 2Q2QA 1RWWA 4G1MB 2AFHB 2C98A 1KDOA 3AHEA 1PGOA 1NOJA 2C2XA 3ON5A 4N9QA 3GT0A 4OKNA 5B37A 1BD3A 1KE2A 4ZQFA 4ZQHA 2R8PA 2VP4A 3UT6A 4LYGA 3AO0B 3VJMA 2SKDA 1U5BB 4OB6A 4J03A 5FOWA 3WKEA 1TM5E 1JP7A 4WIAA 2DEUA 1JYEA 3V7FA 5KSWB 3VR5H 3TZ6A 2VA9A 3VTFA 4MVJI 5I7WA 1A5SB 1NVMB 2ZFUA 2RAPA 2Q1TA 3SKVA 1NT2A 4TVBA 1N9KA 5JT1A 5K3FA 3T0FA 3FWYA 1CVIA 4FSXA 1JPUA 1N0UA 2GERA 2Z2JA 3IQXA 4IG9A 4JEIA 4Q4LA 1Z2NX 2P4QA 3HGQA 5FLEX 1HDIA 3T1HB 4M0PA 5DBEX 4OMCA 4F5DA 4KN8A 4P86A 1M33A 3STUA 3QVSA 2Q8QA 4DLTA 1Y8ZA 1X86B 2ZAGA 4U5XA 2HNBA 1U9ZA 4YJ3B 3BWCA 5KCMA 1T0UA 4W5RA 3HLTA 1M72A 2ZG6A 4DWVA 3RVRA 3T5DA 1C41A 1JUDA 4JKOA 2O8FB 3RBZA 2QENA 2AJLI 5GV8A 2GETA 1CS0A 2BIFA 5CJ2A 1G5FA 3G1UA 4CE6A 2QU7A 4C06A 3LDAA 2C5FA 1U9JA 4WD3A 1ZA2A 3R76A 4ZOLB 5CFOA 5JXIA 2O1WA 4GP9A 4NL4H 4EGJA 3U1BA 1WV1A 1UXOA 2DQ4A 1RLTA 2H57A 5DSZA 3TZQA 1XYVA 1UAAA 4LY0A 4XGKA 3AF0A 1F2UB 1L4HA 1YB4A 2D1FA 1QIGA 5BSUA 5LPNA 3ZTTA 2X0KA 5EIFA 2GAIA 1YJAA 1IM5A 5EWLB 2XTMA 4Y0VA 4NAHA 1O94A 2V9PA 2C78A 1V8OA 2OCYC 4BGIA 4F5YA 4KGXA 4QJBA 5F52A 2QF7A 1P2DA 1A7UA 3OT1B 4L0CA 2JAOA 1JILA 3N2ZB 4A2QA 5B55A 3TQHA 2NP7A 1ADJA 1JDJA 2VK1A 3F5MA 4FI3F 4ARAA 1C4OA 1B15A 4NMHA 1MD9A 4GYJA 5CT6A 1N7HA 3IO5A 3PPWA 2H31A 2K2WA 1GNQA 1WXXA 2X1LA 2Y1OA 2QT1A 3HCEA 3PPVA 5EHGA 5A05A 3T9EA 5ABPA 5JRDS 3G2IA 2O20A 3FTQA 4CKYA 3EOBI 3ILSA 5BVHB 2IPLA 5LA6F 4L22A 2EBWA 2ODAA 2F8TA 1A8SA 3EBLA 3P26A 5JMWA 1KY4A 3PUYA 3OCXA 4QG7A 4BNFA 4ZYUA 2P79A 1U9IA 2ZSJA 4RIIA 4QQKA 2DCMA 4MYDA 4O1MA 3PJDA 5GZ3A 5JCZA 4PC6A 3NIBA 4Q15A 4LJ7A 4RUKA 4OQMA 1C7QA 2C5GA 2CXOA 4P31A 2VWPA 4QU9A 3SIXA 2EU8A 3HB9A 3TE7A 2Q5LA 1E9SA 2ZS9A 3GRVA 3TIVA 1DB3A 5K3OA 4PV7A 2WWIA 3JD3A 2KQUA 3F9RA 3FCAA 2AKAB 2I7DA 4OQ4A 5G1NA 3QJYA 2OFPA 2CNLA 3LM8A 2PU5A 1YO6A 1Y6GA 4UNQA 2BJWA 3O9VA 1FUYB 3P2OA 1B8NA 4CQLB 3HBNA 1I36A 3D7KA 1WBDA 1OBFO 3BWXA 4F3RA 4EPXA 1YI8A 2H6EA 1NUSA 3CZQA 2ILTA 4U2GA 4TTVA 3T5TA 4CEHA 3ETJA 3I9NA 2Z98A 2YHSA 2I65A 3TJMA 1K27A 3DVAA 3AB3A 1IBSA 4QTZA 3ZVLA 4MVJF 3ZDRA 4XPIB 2HSDA 2OR3A 4TQ9A 3SHTA 5ITWA 3RG8A 3PEUA 1YFKA 3KZKA 4Z7OB 3U62A 1EIWA 1CTQA 2CXNA 2HO4A 2ORWA 3HN6A 3HU2A 4I8IA 2GB4A 1KMCA 1WPXA 3VR2D 2R87A 1M0WA 1UPXA 1DBWA 4KQ9A 1R0KA 3HEMA 5L40A 2ODQA 4AJJA 2O2IA 4QULA 3L4EA 4L0MA 1OLUB 1B26A 2MSLA 3TSOA 3SDBA 2I6SA 4QVKA 3VRHA 5IBCA 3P4UA 3DMTC 2UZ1A 4HO1X 1R4MA 3Q7TA 1GQQA 4M1YA 1Z8NA 1SG0A 1FZQA 2F64A 1P5HA 2WMOB 1EMDA 2V96A 5FR1A 1ILEA 3GFRA 5CT5A 1PZMA 1I80A 1A4XA 4P2GA 1CJUC 1EXNA 5GP1A 1E0AA 3LQYA 3WGGA 4ZKEA 1C8LA 1YS9A 2ZK7A 2ZJ2A 2ZJ5A 3D8SA 1Z2AA 5AI4A 3DLHA 2J0SA 1FDWA 2GLXA 5CPBA 1E5DA 4GL2A 4P5DA 3KQOA 4XX0A 5LQMA 1I2CA 4JJ4A 5AJHA 2QD1A 5KO2A 2HSGA 1WKBA 2TECE 1TYBE 2XE6A 1NF3A 2MSEB 2QTVB 3EISA 4OBXA 2VXOA 721PA 1DFIA 3CKKA 2HSWA 1N2CE 1WG8A 2VDPB 4X1YB 2C7OA 5JWHA 2FG7C 3RASA 1FPQA 3OURA 1DC6A 2FPKA 3THWB 2LVBA 3B70A 2IU0A 3ZDYB 2XE4A 1T4DA 4QASA 2PAFA 4L6CA 4MWOA 4REOA 3IHWA 3UEOA 2ZJ7A 3AU9A 2GHQA 1N1DA 4I9FA 1R5JA 1GPLA 2XUFA 3BXXA 4MR7B 4S1WA 5ARDA 3UK0A 4BE4A 2BDUA 4JJGA 4TZ0A 1LEHA 2BWJA 4PO9A 1RBYA 3E5RA 1CSEE 3DVRX 3FKJA 1U31A 4G0UA 2BFPA 4H35A 5FWXA 5EQTA 4AN0A 4DZRA 4YUXA 1GDDA 1NE7A 2PTGA 1TZ2A 2DY0A 2G40A 3FMOB 3JQRA 3MK31 3QKTA 4P93A 4F5ZA 3ZK7A 3ICEA 1JZTA 1SMKA 2Q5CA 1GYPA 3FJOA 2HWYA 4E5NA 1EP1B 2VJPA 4QOSA 4IGEA 4M9XA 1G9SA 1GGJA 1XZIA 3O2QB 3UOAB 3VPFA 3KQHA 3RC7A 2HU5A 1CJKC 4LBZA 5EMJA 4F06A 4EYEA 4UE3S 2E7ZA 2QRMA 1GEGA 1Q5PA 1Z22A 5DXAA 2WD7A 3A1SA 4BXOA 3A1TA 3DBHA 2I4NA 4N6NA 1KZ1A 2BFEB 2HLNA 2JFWA 1BAPA 1EX7A 1SGWA 4FGUA 4TKUB 4YCAA 3SY8A 4BBPA 2PQ2A 4UBIA 1N6NA 3C8MA 3U7IA 5A62A 1YMUA 1DT5A 3HBFA 3PEVA 4JVSB 4DLUA 2ROQA 4JI8B 3RS7A 5CJPA 4POOA 2WI8A 3R24A 4MITA 1SNYA 4FMDF 4G5XA 2JATA 2P35A 3WMWA 4B3XA 1DKQA 1F06A 3W9BA 1Q17A 1UUFA 3IR7A 3FYDA 3KT8A 5JSFA 4JI2B 2ZRFA 3PGMA 2YWBA 4TWBA 3FR7A 3KQTA 3EQ8A 3L8DA 5D2CA 5C2JB 4CTKA 1EZ1A 1KEKA 3HN7A 1SBNE 4KH1A 2G3YA 4KYIB 4BE9A 4M7WA 2GO1A 5H80A 4ILEA 4REQA 3EC7A 1UMBA 1FSFA 2O4CA 4YJHA 4D96A 3M9XA 4UTPA 1DRKA 1FSGA 1XRNA 2YCBA 3NWJA 4IXTA 1WMEA 3IV6A 4WXRA 4EY4A 3BWEA 4O1HA 4U0KA 3E2PA 4YMVA 4A73A 2W0SA 3OKPA 5BSEA 3SBEA 4BMDA 4DCJA 4HDAA 4Z7NB 2PIAA 4JC0A 1JA1A 3I37X 1EVKA 4ZTUB 2NZVG 2DKFA 4ESEA 2RHJA 5FI3A 1FVOA 5JW6A 2PX0A 2DOKA 1O96B 1TF5A 1QTQA 2VP9A 4HMQA 1GPMA 3QFTA 1K68A 4X1OA 5FTLA 1REQA 2W70A 2NU8B 2P0AA 1Y1SA 4KQCA 1BMQA 3PLRA 5EMMA 2XF2A 3OMXA 3V4PB 3UJNA 3S0JA 1IONA 5LDGA 3W8EA 4BJ6A 4UTOA 4EHNA 2FSHA 2VWGA 4RZSA 1KJNA 1EVZA 4UUMA 1Q0TA 5F51A 4JA0A 3LZCA 3SXPA 1AGXA 4M7OA 3GXOA 4UASA 3A2NA 3JYNA 5I48A 4F4DA 2ZTLA 1JR6A 1TQ6A 3S2IA 3IEUA 1KK3A 1M8GA 3ZU4A 4J1QA 2TRSB 3U48A 3A6HA 3KLMX 3QUBA 5JS6A 4JS0A 5AK6A 3UMFA 2XV1A 1XP8A 2B9VA 3Q3VA 3KXDA 1UM8A 4NC9A 1GTG1 4M6WA 1OT3A 1NRJB 3BIOA 1MJHA 3FB1A 1G20B 4OK6A 4GLBA 5ANRB 2B7CA 1HT1E 3RHSA 3I9V1 5BV0A 2GXAA 1YL7A 4E46A 3RT9A 5F98A 1JT9A 2EFJA 4E5MA 2H1OA 4XVQA 1QFXA 2RI1A 5ITZA 1VIYA 3U44B 1QH8B 1GTL1 4HH3C 4TLDA 2RH5A 1EWYA 2OO7A 3DOUA 3K4PA 3IXLA 4GXTA 3GGOA 2C9BA 8LDHA 3RAFC 4FGZA 2J0QA 5CXUA 4D9KA 2MWMA 4Y67A 1KY2A 2XR1A 2JPDA 2J4FA 3GJXC 3LBIA 3KXPA 4ND8B 4RS4A 3V1MA 3JASA 2PAAA 1Y63A 4Y9TA 1U2EA 1GCUA 5K7SA 2C5SA 1QVWA 4KQWA 3OZBA 4TXMA 3WO0A 4E03A 2J0VA 3BBPA 5JZVA 5MFZA 3T7SA 1PRYA 2BTQA 1IHDA 4I7EA 5B7QA 3QH4A 3IP9A 3N9IA 5F4BA 1XAGA 1T36A 3A70A 4JYBA 4ZC1A 1LPAB 5BRNA 1H3FA 1DOAA 1I4OA 3FDXA 4MVJG 3CBQA 4QUDA 1IJEA 2WSSA 1Q7GA 3OEYA 3VQTA 2QRUA 4FKZA 2QUHA 2PLWA 4KNWA 4TLMB 3Q8XB 4RJ2A 3OZWA 2JH8A 4X6UA 2JRLA 1JU3A 1QAMA 3RFXA 3E15A 3F6BX 3KSMA 3X1YA 5BUQA 3NFYA 4DM4A 4JEUA 4J0KA 1HZJA 3NKVA 5BWCA 3VNQA 2J3DA 2REBA 2B4QA 1XDZA 1SIOA 4MTCA 4CQMA 1IMJA 5L3SA 4FYPA 4DBZA 5B6PA 5EJEA 2FVYA 3S1AB 1G3QA 3L8HA 4Y2UA 2C88A 4DMUB 4LHYA 3PNVA 1NULA 5C4GB 3RVOA 1C80A 2RGBA 3A0RB 3OPXA 3VPBA 4DBVO 5EESA 5AJYA 1KZ4A 4X20A 5BW5A 5K9ZA 4CLXA 1J1UA 4RHCA 1EQUA 4KG7A 1PFWA 3JD1A 2PSFA 4UD6A 1Q16A 4GMXA 2XUDA 1KI9A 5DWDA 1XKTA 1MX9A 2XCUA 4OXYA 4KXMA 2B0JA 4JYPA 2HHLA 4PGMA 1ZMRA 3BUSA 4XLTA 1ACJA 4JJEA 5ESRA 5KX5A 1O08A 1J5PA 1MB9A 2Y1LA 3CF4G 4IO0A 1V39A 5K8CA 5T41A 3HDVA 5E0OA 4UZSA 2Y0PA 4IIFA 4OGGA 3WL8A 2Y67A 2XXJA 3GRKA 3V8BA 4DM3A 2NXWA 4HJXA 1Q1ZA 2NO9A 4Q1CA 4BJHB 4BQFA 5E2BA 2GEBA 5B6IA 4JV5B 2ZS8A 2N47A 5B3AA 2GN1A 3GF4A 3SMQA 1KY3A 4UD2A 5KVSA 4QFBA 5DNDA 4LWQA 1ATZA 3H0CA 4MQ4A 4CEIA 2C8LA 1IZ8A 2J9ZB 2IH5A 2C4NA 3QY9A 3PEEA 1QRRA 1RXEA 3PXCX 3G3EA 4WVFA 1ORTA 1RJ9A 2R86A 1R5BA 2J5XA 4Q4HA 4BNKA 4FYXA 4WVLA 4F97A 4CEJA 2ZJZA 2HU7A 3FNEA 3GI1A 2PJZA 5ULLA 3L1IA 2QIOA 3EZFA 1QP7A 2JLVA 4B3DA 2LD4A 2OD9A 3OOSA 4M9SA 4MVJM 1X7DA 2BHLA 5TQ2A 2JZCA 5B36A 4RPCA 2IIPA 3OEHA 4LYHA 5IH3A 1VJTA 3FR8A 4LJRA 1BD4A 3T4XA 3GQBB 1WW2A 3QVOA 5ALWA 4DEVA 4E4YA 1E98A 4EPYA 1I94B 1UXHA 1JTFA 1GN9A 5J2TA 2DLNA 4ENQA 3GA0A 3E27A 1QFZA 5D85A 2OOKA 2QZ4A 5JXHA 1Q1QA 1SVMA 4Q24A 4MVWA 4HVTA 3AYXB 1S8FA 2AOWA 2Y71A 3EQ6A 3WMFA 1H6AA 2Z6VA 3D3WB 1R0WA 4G4SP 2QROA 4WZBB 4ALMA 5EJ9A 1CNMA 2B8TA 3F47A 4MWBA 1WXFA 3FUCA 4PYMA 1BGWA 1ZSNA 4ZMRA 5JBNA 2W2XA 1WF6A 4IVNA 5ITSA 1ESCA 1O6BA 4OLHA 4PGFA 1HNNA 3L8YA 2EBFX 2ZTVA 1QMPA 3PDUA 4Y18A 1GPYA 5K0JA 1HNWB 4QOJA 3A9CA 1WL8A 1HQCA 3DE6X 4OLBA 2XSZA 1U0JA 2EZ9A 4FW9A 5FULA 3L7KA 1PZFA 2ZCVA 3AVWA 1J90A 3OOJA 4K7JA 3REGA 3GLHB 1Z3CA 3NTVA 2F4VB 4OHOA 4BKQA 2G9RA 2X77A 1WHSB 4BYGA 5J2UA 5HDBB 5SY4A 1MIOA 4KPUA 3GAZA 1QRDA 1FFSA 3BHIA 3FDFA 4G0XA 4WKPA 3E1GA 5EEHA 4H6VA 4CW7A 4Q7JB 3U56A 3R7DA 1M74A 2H2GA 3JTMA 4X6LA 1NI4B 1XCOA 1WAMA 5DEOA 4QDJA 1NJ6A 2ZWMA 3HSYA 3QPBA 4YFYA 3QI2A 4RKWA 1GR1A 4H3SA 4LGVA 4ZZIA 3H4MA 4GBJA 5AW9A 3SR4A 4LUCA 4MRRA 1F0NA 3GD5A 2AI1A 4RW0A 1AN0A 5K0BA 5F9HA 3I76A 3KZCA 3NAMA 1QOZA 1XLUA 1YB1A 3ADCA 3HDYA 1ZEJA 2XNDD 5LLDA 1GZ5A 3AVYA 3I5XA 2HO5A 4K9DA 2Z95A 4ZWNA 3SVLA 1G5TA 3GGCA 1FLVA 3G2JA 2D0DA 1K5GA 2BFWA 2PFSA 3EZXA 4YWHA 5FBLB 3QELA 1JDZA 1II8B 4O4LB 3UM9A 3LTEA 2BV3A 2WF5A 3DYBA 1GGHA 1ND5A 3KR1A 5D1HA 2JEOA 2BKUA 3OLYA 3I2GA 4DWJA 5BQXA 1HWYA 2YYSA 4G8CA 1D9XA 4CKBA 2IBMA 3AB8A 2ZB3A 4QTXA 1ZOPA 2QOEA 2PDAA 3PENA 1X0XA 4PCAA 1FU8A 4HDSB 1CRLA 2I8CA 3NVAA 5DTJA 5DGCA 2YQ5A 4G0YA 1H66A 3ZLTA 3M1IA 1JZQA 1EFDN 1HYBA 3QVWA 2H7CA 4KO2S 3JQDA 4MRSA 3TM4A 5A2GA 2JL1A 3MCZA 3ZJ4A 4ERXA 3LDGA 5HIIA 3USES 1BDIA 3MWEA 4IEIA 3CPHA 5JEDA 2H1LA 3WFIA 4HLUC 2R8XA 1UKZA 2X8JB 4WHMA 2PJDA 4BNLA 5J4YA 1IBRA 4TRJA 1PVDA 3OX1A 1I6WA 2R1VB 5GOZA 4QYSA 3B1FA 3GGDA 4RZIA 5H8WA 1HMPA 1F6DA 1QG2A 1E64A 4DEXA 3SAJA 5ADUS 1SWVA 1D1SA 1C4XA 3OX4A 1KQNA 1BE1A 1JAYA 5I01A 3INGA 4X54A 3STYA 1KH2A 5HFNA 3AINA 4KRYA 3MBIA 4Q3AA 3ST7A 4DUGD 2W4IA 4JI1B 3V4SA 2QTRA 4JL6A 2YBDA 3U3XA 1GEEA 4MYRA 3JSAA 4TLEA 3F73A 2EKZA 4NJEB 5CB6A 1GKUB 2Q9CA 3N8KA 3EZYA 3TAUA 7REQA 3NG1A 4X71A 4NBKA 1C30A 2CWDA 1TM1E 2FR8A 1LS6A 1S2OA 4B71A 3OIYA 2H1HA 1COWA 5GQSA 4FHZA 2BFMA 4XVRA 2CEKA 3K9NA 4YGYA 2EZ8A 5A02A 1TUBA 1E32A 2OGUA 1ULUA 3DP7A 3GY0A 3K1TA 3RUCA 2OSVA 4NZYA 4B8WA 5K6TA 3H1EA 2QTAA 4P8RA 1W36B 1EBBA 2ID7A 4S04A 3HWWA 4DJEC 2HIAA 3CLTC 4LZPA 1WHTB 3JWJA 1MGPA 1QUEA 4IHJA 3P4XA 5JNSA 4QELA 5IULC 1O9BA 2AW5A 5GM2A 4UEKA 1UKVY 3GPCA 3GCWA 4V0KA 5REQA 4DYHA 3DE3X 4YQFA 1OSNA 1ZD1A 4IRUB 2X41A 2IYSA 4OOEA 3CBGA 3PQ4A 2RGDA 2OPHA 2H2FA 4HMPA 1LBTA 1JKMA 1E6CA 1CULC 1J8DA 1DARA 4UQPA 5AVKA 2ZXFA 1UP6A 2F3UA 4AD8A 3FMVA 1OX4B 1NN0A 3TR5A 3U0BA 1KI6B 1SC1A 3ITDA 4Z2AA 5C35A 1PU2A 2UZAA 3PDIB 3KAKA 3AQIA 3W1WA 3T1NA 1T5HX 5JYDA 3KHSA 4NZPA 1QH1A 1GYQA 1WQ3A 4PYKA 3JX9A 3TZLA 2SECE 4CIVA 3L9WA 1SEVA 3FOBA 4G5OA 4E30A 5JXGA 1IBLB 1QRAA 1RJWA 4B45A 4CF4A 4GE0A 3JY6A 3OU2A 4J4TA 2ZDGA 5ERYA 4EQZA 4IH1A 5ICSA 4CV0A 2JCVA 1V7ZA 2YHUA 2WWYA 4QKQA 1M6VA 4TVKA 2XLCA 2PXHA 3D1VA 3D6JA 5DM0A 4AYWA 1ZUIA 3AFGA 4GOKA 1YA4A 3TTWA 1Y8RB 4ER7A 3F1KA 3SHOA 1GZ6A 1NNSA 4WI1A 3VKWA 3CSDA 1O6CA 1H05A 4YJGB 4HVCA 3UHFA 1E79D 3IOYA 4WMLA 1UDAA 1A3CA 1WCIA 4XYEA 5KSOA 1ZGBA 5FTWA 1I7NA 4HQ0A 1Y5LA 4AWXA 4EFNA 4FFNA 2VHEA 3OFVA 3KZMA 5EIBD 2OXTA 4DV5B 1K4KA 4Q1BA 3GYGA 3K0FB 3OCYA 3CNBA 3CVOA 3AFOA 4MRNA 3ZBQA 4D5GA 4E0BA 4NVRA 2AW3A 1NSTA 5JISA 1YC5A 5KINB 4Z9AA 3W8NA 3LTNC 3R09A 3I0ZA 4GPTA 4PFKA 1KMHB 2OFWA 2XCRB 3BH7A 1N4DA 2XGSA 1WOMA 4L1KA 4NFSA 4QXAA 1LPOA 1HLGA 4MP8A 5FRDA 3V46A 3MHTA 3BD9A 2P3QA 4D80A 4ETMA 4YRSA 3I9KA 4AK9A 4GC9A 5ICGA 3ZLUA 1D1QA 2C84A 2BFCB 2FY8A 2QB5A 5KB3A 2QN1A 3O8RA 4NBRA 2FDCA 3QBVA 1AUVA 1D2EA 2C00A 2L82A 4M1SA 4NHOA 4LDPA 2GK6A 1ZGGA 4GDMA 4ODIA 5A7HA 3L92A 3QHAA 1VG9B 2EVWX 1CERA 1SCJA 5B1YA 2HFJA 2JVKA 1CUGA 4JLVA 2I0FA 2F3RA 1S9DA 2VP6A 1P60A 3GNQA 5DCYA 1PS0A 2RHOA 3AR9A 3EGDB 4M89A 2ZI4A 4NENB 2QIPA 3W6NA 3WKDA 1AA9A 3D8BA 5EJ2A 1P4HA 3LK6A 4K9PA 1UANA 5TE9A 2NO5A 5AI8A 1IRXA 4N5NA 1WUKS 4GU5A 3LG2A 3SS8A 3I4CA 1R0CA 4XWAA 3UB2A 4QDZA 4DLNA 1F4VA 1J33A 1L7NA 1P7PA 1V16B 4EELA 4DSUA 1HLFA 2AZTA 4PY2A 4ZT2A 1QG4A 3MTEA 1WB6A 2P40A 4PU0A 4V02A 3GX1A 1HT3A 4MEAA 1F12A 2PH7A 5D3KA 3IV7A 4Z1MA 1Y7IA 1XO1A 2QT0A 3V4LA 3KV1A 4BQRA 2NUAB 3BCRA 3MXOA 4LN1A 4DC1A 1H23A 3RKRA 1PT8A 4EGSA 5ADWA 2H3HA 1JWBB 4GXRA 4KAJA 3KM0A 3U3OA 1ORIA 1AO0A 1L7DA 4XASA 5ARBA 1I3CA 2XHEA 5IBRA 4B76A 2XLBA 4BGUA 2QBYB 1XC7A 2SBTA 2YJNA 3NHYA 3ZGNA 4WK0B 4FDUA 3WBKA 3LW8A 5FADA 3IJPA 3RYHB 3ZWNA 1H1TA 1K9SA 2H0RA 3WIVA 5LOVA 3ZWVA 1B74A 4NBTA 2MMCA 4KR0A 2P77A 4P3PA 3ANTA 2P65A 2AG5A 4L9SA 1LGYA 4Q18A 3CO0S 3STTA 4V1CB 4NOJA 3DO6A 1SD2A 3O75A 4NBVA 5JJKA 3UJHA 3SI7A 5JCOC 4TV9A 4QUEA 2R62A 1QFJA 1KAEA 1V26A 3AJ9A 4IJ5A 3BHMA 2QGZA 1N33B 1Z6PA 4BOYA 1JAXA 4ZCMA 3GLIE 1N2CB 3O9ZA 4JLMA 1WETA 5I7FA 5IAAA 1K4MA 1U11A 2HPVA 1LJUA 4EMTA 2HI0A 2NSHA 2VSNA 1K8YB 5KYXA 1NDUA 3PX2A 1M8KA 1BZYA 2FUG1 4PZZA 4AS1A 1OXUA 4JH0A 1L5KA 4OUKX 1XJ5A 1YVUA 1L8AA 3TW6A 3SQWA 3UXEA 1NSFA 5DOZA 4H1UA 4KQMA 1Q19A 4HKTA 2QRLA 4XWGA 3RU2A 1SVKA 5A2QA 4LOAA 4I08A 3FH0A 1I3NA 4A9AA 1DFHA 3EX7C 1Z0ZA 2EIHA 3ZW7A 2JK1A 3D8NA 1T3HA 1QCCA 1SUCA 3Q5GA 5DFAA 2J31A 2MTBA 3H1FA 4R1MA 3O8CA 2UVPB 1JG6A 1NQVA 5FFFA 4J3NA 1OXTA 2I3BA 1X2BA 4TMWA 4LXYA 4Z5XA 1GTZA 3C3JA 4I1IA 3FCOA 1YQWA 5HF6A 4YJ3F 1AMOA 1BX0A 1EYZA 1X7HA 5EE0A 3AR6A 1OLSA 1BS1A 5CITA 2AG8A 2FN4A 1KYYA 4ZT7A 3O94A 2R6JA 3LUAA 3TR0A 3D2AA 2CEAA 3ETGA 2G9VA 3ZE7A 5KYUA 4A23A 3NYQA 4MP6A 2CBGA 1SUFA 4P7BA 4WN9B 5HFAA 1W25A 4Q4DA 1TZMA 1GJRA 3UAGA 4TYWA 2IWRA 1C7FA 4WQMA 2PKQP 2O3TA 4U2FA 4GNRA 4LW8A 5EIOA 5KX5F 2EX4A 5JXJA 3N86A 4OYYA 1TYEB 2DVMA 5EXPA 3JQEA 2G1JA 5JPCA 4YRLA 5C51B 1HLDA 4JSTA 1AKVA 3KQLA 1UCFA 2HA4A 3LP8A 2PUDA 5TPZA 2IZ6A 2PRJA 4AF6A 2PUTA 5H83A 4R8KA 3H6HA 1GCIA 1W4LA 5CLGA 4E7OA 3LSTA 2DU8A 3S5JA 1K5DA 2P6UA 1IQRA 2JAHA 1QV9A 3VR5A 1UBLS 5IG2A 3H84A 1XMQB 4X6XA 4BFLA 1F1BA 1U90A 4TL6A 2V5UA 3W2GA 3F71A 4P5PA 3W8FA 2HF2A 4X1IA 3ZHZA 1PT5A 2VJLA 3VSDA 4BAUA 2V7QD 1Y1LA 1A9XA 3NZEA 4JX9A 4CRWB 4XKJA 2P75A 1IUKA 3KKLA 4KZKA 2B99A 1SPBS 2CF5A 1HDZA 2IYAA 2JBAA 5JSUA 3I3SR 1AQYA 1OCEA 1KZ7B 3CLRD 3I05A 3BWYA 2G6BA 1GU7A 3ORSA 1DAHA 4XQCA 4YJDA 4CM9D 1CRPA 3K31A 4LDAA 4HDKA 2P1DA 3EXFA 3MAAC 5ALRA 3RUEA 3U7FB 3K70C 3KUDA 1CP2A 1F3LA 5J2TF 1GA1A 4HNAB 3CUWA 1L5QA 1UJMA 3GRUA 4XR9A 4ZVOA 3FCUB 1FRQA 1UC4B 3ITEA 2CL6X 2IP2A 1OI7A 1THGA 2XA2A 1J23A 1RC8A 4M99A 3TLGA 2ZB8A 2QA5A 4L4RA 4ZQGA 4BIMA 5HSGA 2WF6A 5AHRA 3D6AA 4ARCA 3ER8A 3HQ4O 1IUPA 1Z0SA 3O8LA 1OZGA 2CNBA 4DB4A 4LI0A 5I4KA 5EG5A 2OCIA 5A5GA 2AZDA 1KDTA 4C7BA 4X3OA 1Q1EA 1HKUA 1U8CB 4IDBA 3WICA 3OOHA 1WSBA 3T9AA 4EW2A 5F7OA 3LF2A 2WVGA 1ZD9A 3DZGA 4GOMD 4LJ6A 4NWIA 4RD2A 3WGTA 3E9QA 4ZCPA 3COJA 1IB0A 1CUDA 1JF8A 2JJMA 1TIKA 3NTLA 4RLHA 3CIFA 1RRVA 3UT5B 1W5AA 4OXIA 3JYOA 3MELA 3PNLA 5KAPA 4QYMA 4Y6RA 5CHYA 3VPCA 1HSOA 2JI7A 2OKCA 3PQ2A 4TGLA 1G3RA 4PRYA 2D0PB 5IK2D 2AWNA 1UJ5A 3OZAA 2P6NA 3EODA 4BU1A 1H4VB 1WPRA 1HE2A 2PGNA 2FMHA 1T2FA 2GEJA 5EE5B 5IXJA 4KC0A 4L5BA 1H4SA 2I54A 2NYUA 3O5AA 5CCBA 3AKZA 2GK4A 2OOSA 5EINA 1U63A 1QF9A 3VC1A 3AVPA 3PF8A 1IQPA 2OV3A 4N12A 3WK7A 4DY4A 1LDMA 2EBHX 1FCJA 2M6RA 4NKRA 1VBNA 3OM1A 2V9ZA 3QFRA 3H1AA 2TMYA 4GKAA 4R8LA 1WMSA 2V3CC 1ZK4A 3HNRA 3KPVA 1GR0A 1BXRB 1QGUB 4J16C 5LBTA 3UA4A 1JXMA 3MN1A 3VKVA 3W5IA 3LX4A 4FNGA 2Q2WA 3OSUA 5DHQA 4J2TA 1IN7A 3DAPA 4B7XA 1PZGA 2O3SA 4M9QA 1H2BA 3TUZC 4IKEA 3CMMA 1T5LA 1ZGCA 3GDWA 3A0UA 4OMFG 4R8SA 1TKBA 4YJ2B 2ZZMA 3QTTA 1H5NA 4Y0NA 5FYDA 2ONCA 2FRVA 2OHHA 4X5OA 4E7PA 5ALVA 2BT4A 4RE5A 4FP9A 1VHDA 3LC1O 3LUHA 1V9SA 2ZETA 4PINA 2QW0X 3HACA 2OUIA 2WABA 2Q6IA 1USIA 2FKAA 2Q1SA 2IHJA 4E1VA 1W73A 3BMNB 4ZAVA 3JU3A 5H81A 1ADGA 3PEFA 5LR6A 1I0IA 2REQA 1FQOA 4OI2A 2Q07A 5E95A 1WW3A 5EFOA 4ILKA 2VTBB 4DWWA 2J7PD 2PNJA 1I2BA 3K05A 1HKHA 2FKNA 3RVLA 3TLZA 4HD8A 5I9BA 2A0UA 4XRRA 4E5DA 5IZ4A 5AJWA 4PRZA 2ZI6A 3B1WA 1QC5A 1TPZA 2BSXA 1TEVA 1V47A 1L8OA 1KXJA 1N1GA 3O26A 4D81A 5CR9A 5LP6C 4C21A 1XA4A 4MMYB 2IYZA 3RTDA 1A8UA 2XT0A 1N6HA 3AEKA 2W2KB 4BFWA 3UHJA 2J3EA 4YAFA 1ZM9A 2HWXA 1F6BA 1K63A 1POXA 2I3GA 4KI7A 5AJZA 4Z0PA 1FW6A 3VBCA 1GSHA 2BE7A 4IJUA 3WQRA 1PFQA 3GMIA 1VLJA 4RPHA 2WFMA 2K87A 4LV5B 2DTDA 3ZGZA 5K8TA 5C37A 3I01A 4WOBA 3SEFA 1P2TA 3HSKA 1ECFA 3I04A 3E22B 1VJGA 3JQ7A 2DG2A 4KO4S 4WZAA 4GC5A 1BXKA 1F4PA 1RYNA 2B5VA 5A4DA 1GGMA 3FYTA 3K6KA 2VPTA 4PNPA 1NLFA 4AW9A 5A1JA 2QR3A 1LUAA 1PG5A 2WJGA 4PCUA 2JNWA 2L18A 2B3DA 1Y42X 2EGGA 3GJ6A 3M6AA 1D5WA 1XVTA 2PX2A 4DOMA 3ISTA 4UDXX 3WK8A 4RMHA 2IL1A 2E5WA 2ALJA 1FFBA 4FD2A 1JEDA 4HQ6A 5GGXA 2JG3A 4FOPA 4EA9A 1NAIA 2B1RA 4J4HA 1M10A