5ARDA

Cooperative bio-metallic selectivity in a tailored protease enables creation of a c-c cross-coupling heckase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASCNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords SUBTILISIN SAVINASE
publication title Cooperative Bio-Metallic Selectivity in a Tailored Protease Enables Creation of a C-C Cross-Coupling Heckase
rcsb
source organism Bacillus lentus
total genus 100
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2015-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 5ardA00
2G4VA 3GCXA 2DQKA 1TM1E 5AVKA 4CFYA 4KG7A 3VHQA 4LVOA 1NLUA 4YN3A 3I2YX 3F49S 4AKTA 3DE3X 2ZWPA 1Y9ZA 4OMCA 2PQ2A 1WMFA 1T1IA 3WQBA 1GTJ1 1R64A 1BFUA 5JXIA 1T1EA 1SUAA 4NMXB 1GT91 2WWTA 2ID4A 3DE5X 1SUDA 1Y34E 2DUJA 4B5LA 2X8JB 3BPSA 2XRMA 1C9NA 5I9SA 1GTG1 1SUEA 1TO1E 1MEEA 3L1KA 4RYDA 2Z2YA 1AH2A 4K8RB 3F7MA 1KDYA 1YJAA 4CFZA 5JXJA 3AJ9A 3D43A 3DE2X 3H42B 5AQEA 3DVRX 3WHIA 1SCBA 2PMWB 1WMDA 4WOBA 3LXUX 1V5IA 4GI3A 4Z2AA 3I30X 1WSDA 2XTJA 1KE2A 1SPBS 1OYOA 1AU9A 1ZVKA 3VTAA 1YJBA 1SCDA 2SECE 5K7SA 3DVQX 1SCAA 1S2NA 3ZXXA 3BX1A 3VV3A 1SVNA 4OV6B 2IY9A 1XF1A 5CW1A 4KB5A 4DZTA 5B1EA 4ZOQI 2WUVA 3LPAA 3GT4A 3PRKE 3VSBA 1GA6A 3DE0X 1ST3A 3Q40A 1Y3BE 3DVSX 1LW6E 1R6VA 3DE7X 2Z58A 4H6VA 1Y3DE 2W2QA 5FBZA 2GKOA 1S02A 2W2OA 3VYVA 2HPZA 4AKSA 2ZWOA 1TM7E 1UBNA 4ZARA 1SUBA 2Z30A 1WVMA 1SN7A 2W2PA 2SICE 1VSBA 4NE9A 1IC6A 3QMPA 1CNMA 2WUWE 2P4EA 3A3OA 3DW3X 1CSEE 1SBNE 2PRKA 1SIBE 1Y3FE 1GNSA 3A3NA 2ST1A 5ARDA 1TMGE 2TECE 4OMDA 1TK2A 3EE6A 3ZXYA 1NDUA 4H6WA 1BH6A 2Z2ZA 1EA7A 5SICE 4DJ5X 3SICE 1P7VA 3AFGA 1C9MA 1SH7A 1Q5PA 3Q5GA 3TI7A 1T1GA 1AVTA 2ID8A 2V8BA 1BJRE 3LPCA 3DYBA 2IXTA 5FAXA 2B6NA 3I34X 4J94A 1TM4E 2X8JA 2W2NA 1KDZA 1WMEA 1C9JA 1GA1A 2PWAA 5JXGA 1SUPA 3GCWA 1GA4A 1AQNA 2HD4A 1OT5A 5ARCA 1BE8A 3UNXA 1BE6A 3BGOS 3P5BA 1SUCA 1PFGA 3I37X 1SELA 3TECE 1C3LA 3F7OA 5JXHA 1P8JA 1V6CA 1PEKE 4BWGA 1TM3E 1Y33E 1Y4AE 4C3VA 4WOCA 5ARBA 1OYVA 1TM5E 1DUIA 1IAVA 1Y48E 3VV2A 1NDQA 4I0WB 5FFNA 2Z57A 1AF4A 3CNQS 1S01A 4NE7A 3EDYA 3DWEX 1SCNE 4DWWA 2DP4E 4H6XA 5AMXA 2PWBA 2PKCA 3EIFA 1AK9A 2E1PA 3DE1X 4FONA 1SIUA 3PTLA 1P7WA 1ZVJA 5JMOA 1AV7A 1GNVA 1GTL1 1SBTA 2W2MA 2QTWB 2WV7A 3DW1X 3DE6X 1A2QA 1TO2E 4MZDA 1MPTA 3D9QX 1Y4DE 1TECE 2Z56A 1HT3A 3LPDA 1YU6A 2SBTA 3AJ8A 4C3UA 3TI9A 3CO0S 4CG0A 4LVNA 3OSZA 1THMA 1DBIA 1SBCA 1JEAA 3GT3A 3QFHA 4HX2A 1KE1A 1R0RE 2ZRQA 1SBHA 3QTLA 4JP8A 5AVJA 3SQOA 3T41A 4M1ZA 1SIOA 1SBIA 1PTKA 2PYZA 1GCIA 1SCJA 1BFKA 3WIVA 1Y1KE 1Y3CE 3WIUA 4HVLA 4KPGA 2Z2XA 3HJRA 1EGQA 3DDZX 1YJCA 3A3PA 1ST2A 5B1DA 2SNIE 3DE4X 1KDVA 1PJ8A
chains in the Genus database with same CATH superfamily
4D5EA 1ZS9A 5L4LA 1T1SA 3L7KA 2QN6A 3R77A 1L4BA 1P4HA 3E3AA 4HATA 3WB9A 2PX6A 3ZWDA 4KQMA 3AG5A 1CQWA 3C6KA 4CF4A 4ZDJA 5FR2A 4ZCTA 3TCNA 4G0UA 5JT1A 4KKVA 4L9SA 1X1AA 4KBFA 1RWBA 2GR9A 3QFTA 1IBCA 3UAVA 2GNOA 2IXEA 1ESNA 3JVEA 4HFMA 3CEJA 3HU3A 4GP9A 5CP8A 4O33A 4QPZA 1OXUA 1ZQ1A 4P92A 4R8SA 3SYTA 1GQSA 1S2MA 2CNDA 4FQ5A 3TJRA 1SFRA 3CMMA 2W6NA 3WFIA 4Z9AA 1XU7A 1VLLA 4AKTA 3HYTA 5IZCA 1B74A 4YBZA 1EM8B 3NV7A 4PGMA 1XMSA 3R1IA 1ZDMA 2IPNA 2Q6KA 2QDKA 3KEOA 3ZQ4A 5KVCA 2WMOB 4WFJA 3IURA 4CF5A 3GUHA 1K5PA 3VKUA 1QCZA 4FUTA 1SVOA 2Z3VA 2OUKA 4C4YA 4NCJA 4MKRA 4BFSA 5F7XA 5H9VA 1JEOA 2BI4A 2DZDA 5DNDA 2C4HA 4LV8B 1R0WA 2DRIA 3ROZA 2HQSA 1Y1RA 1BVRA 3DE5X 4FFVA 3OF5A 4UE6A 4B3FX 1EE9A 5EXPA 3DEAA 3NDJA 4GMHA 5G4LA 5ISMA 1NR1A 3ZKAA 1XP8A 3FNHA 1P4JA 3EMKA 3PFWO 2ACEA 2KQUA 2J3MA 1VLQA 3UB4A 1JLLA 1PNTA 2Q5JA 3OX1A 4LKRA 3T06B 1DQZA 3T8YA 2JASA 4FU0A 3ZLBA 3QPCA 4IRUB 3G8DA 3HR7A 4PGGA 3EDQA 3ELWA 4YB8A 4YRNA 4C3ZA 1IJBA 4Q9LA 1UOPA 2DXIA 3A4NA 2W58A 3OT5A 2C4VA 4D2IA 1NBWB 1B8VA 3P4UA 2FSSA 2PBLA 3L1KA 1Z6AA 3WL3A 2J7KA 1ZJZA 4ZK2A 5DN6A 1G6HA 4QXOA 3T5CA 4HLUC 2XAUA 4C22A 4U7WA 2BHLA 3A14A 2QLNA 2OXIA 4LCBA 4MMYB 4NL4H 3UXYA 1XSEA 1BG6A 4WZBE 4FKBA 4M0FA 3V2HA 2VZ8A 1U8XX 4OKNA 2QPTA 2AT1A 4DYVA 5J4LA 1DAPA 1LFDB 4PAGA 1E7MA 4OEHA 3K1JA 5REQB 5DBFA 4ISBA 5IWAB 4G6ZA 5DGHA 5H82A 1USWA 4XLTA 1PL0A 1KYIA 1Q7GA 2GBFA 3PP8A 4US1R 4IIXA 4I19A 1UMCA 4N5MA 2ZUSA 2AX4A 1WMDA 4TL6A 5JNRA 1DKUA 3MQFA 3LRXA 2PMCA 3AEUB 4DA6A 2V1UA 1KP9A 2H52A 3AOGA 2ZIEA 3IX7A 4GR9A 5CYPA 3I9JA 4HUQA 4PPNA 4GO1A 3FYTA 1E4EB 5CTJA 5C5EA 2Q5QA 4TV9F 2I1WA 5H81A 3AX6A 1MORA 3OT1B 1CDDA 3FOFC 3HA5A 2I3ZA 1AU9A 1UDCA 1PV2A 1YS6A 3UUGA 3O93A 2ZSJA 3KD2A 3BBLA 1W6RA 3MILA 3HA3A 4TN5A 4QU5A 3IVMA 3O1LA 3S5JA 4B3BA 4HNVA 1E79D 1RE1A 2NYVA 4C7XA 3FUTA 4CM4A 1RSZA 3HSKA 1I4LD 4JOBA 3V9AA 1C3OA 1S2GA 2UDPA 1L5VA 1ZIYA 1YZTA 3A1DA 4G5GA 2IY9A 3OLQA 2V7TA 4P53A 2XSZD 4WOJA 4ZVQA 4DE5A 3B9RA 4B3HA 1W0JA 4WV3A 2J67A 4XWKA 1UP6A 1Y8RA 3TVTA 3OICA 1N5RA 4DDHA 3VHLB 3FLBA 3BDAA 1L9KA 2JAUA 5DOVA 2FGJA 4EY7A 5EMLA 1K27A 2GCNA 2ONYA 4AI6A 1LNZA 1IQPA 1Z0IA 2HLDD 3UT5A 3GH1A 4EFNA 3TLZA 3LWBA 3HB5X 4ZCLA 2F1KA 1QIDA 1DELA 4Z99A 1XXHA 1INLA 4QD3A 2WZQA 3M5CA 2LE0A 2PLNA 1TA4A 1JFFB 3MZ0A 4DV4B 1E6MA 2HFJA 4TKUA 4BE4A 3C3MA 3ETHA 1SULA 1ENYA 1SVUA 2GLXA 2RJ3A 3GPDG 4YMGA 1DKLA 1TQ6A 3A05A 3NZEA 3W4JA 4ZYZA 4HQOA 4R98A 1Q7CA 3WQHA 4B2IA 1YDFA 1L3IA 2OHGA 1MZPA 5SY9A 3WQQA 4DCTA 4L22A 4Z5XA 3IT1A 1S02A 1EHIA 5J63A 5BSFA 4BO3A 2ONCA 5CLFA 5JCZA 1X3LA 2L18A 5K0TA 1S8NA 1G5RA 1MFPA 1O6BA 1P2SA 4K2HA 4WX2B 5I3ZA 3M6FA 3HRKA 1KZGB 2IITA 1WW2A 2QYHA 5EP1A 5C7YA 1QB8A 4DMFA 1BHJA 2Q8PA 2ATXA 2CE2X 1OBFO 3CUUA 3O4IA 1ZM2A 4KXXA 2ZXEA 5BXQC 1FX0A 1X94A 1HA3A 1YB7A 4NX2A 2EV9A 2R5FA 4D96A 3OTIA 4UJ3A 4WFQA 5AW9A 3DTYA 4FLEA 1DFHA 3X1XA 3ZZNA 5EA2A 4QA9A 5GM1A 3ECCA 4DPKA 3HVRA 1P1CA 2WMDA 2HNKA 3H0EA 4I3GA 4XGQA 1QS0B 1KZYC 1NBAA 3IAXA 5B53A 5IUKC 4DAEA 4M99A 3PJDA 1FLNA 3QENA 4LXIA 4WK6A 1Z5WA 2Y1DA 3GRRA 1JT9A 3SSMA 1GCGA 1KYTA 4NYJR 4ZJUA 1C4WA 5D1HA 1KVRA 2JEYA 4EKEA 2GM5A 4DSAA 4PLPA 5FIUA 2QLLA 3EUEA 3I32A 1P72A 2ZSUA 2WLTA 3SS8A 3R5JA 1N6KA 1NAIA 2VG8A 4TQAA 1Z4LA 5C51B 3D3WB 1HFWA 2PLAA 3RBVA 1VG1A 3FF4A 5D7BA 2ST1A 2ZR7A 2ZUUA 1XZCA 4G5XA 1S8FA 1TMGE 2Y68A 5JS6A 4KE8A 4ZMBA 2YBEA 1NVXQ 1PBTA 5KKAA 1R0LA 2Y92A 4FBGA 5FOSA 5ILOA 4J8PA 3IUMA 4EA9A 4GXRA 4I9UA 2FLWA 3EUAA 3JRXA 3DV9A 4NENB 3B6KA 4CF3A 4DCPA 5G4KA 2B36A 4XQ9A 5K8CA 5SICE 3I9V1 3I39X 1P7VA 1FU4A 4QOIA 1XZBA 3U7HB 4OI4A 1SH7A 2A78A 1EX6A 2A7QA 2AEMA 4TTTS 2HBQA 4GIBA 4XUGB 3R7SA 2QKYA 2JGDA 3AW8A 3IILA 1VI2A 3L07A 5GJCA 5GQSA 5LA6F 1SXGA 3TRIA 3EVFA 1PSDA 3OHMA 3FPAA 3GEDA 3QWIA 3K8QA 1Z8NA 3OMLA 3PDUA 4AMYA 3ZDZB 4HDMA 5FUBA 2NSDA 2YASA 1W85B 3A0UA 4FJ1A 4H9GA 4WBNA 3L7AA 4EFKA 1EBBA 3ELDA 1L7PA 5AH0A 1EPUA 3IA7A 1Q3KA 2CNBA 3HJGA 1R6XA 5DWVA 3RK0A 4R0MA 5DU2A 2QVGA 1CEEA 3PEWA 4X64B 1U94A 1HQCA 2GRAA 2OB2A 1H65A 2P9CA 3BXFA 3VC7A 4UZFA 4EL5A 1E3IA 1KDZA 10MHA 2RBGA 3GNQA 3AI2A 3BZWA 5B4UA 3GGSA 4KLRA 4CKXA 5K9ZA 1UKEA 2P4UA 2FEWB 4NWIA 3W3AA 2K2WA 2N75A 3FFAA 3MB5A 4QXQA 3RROA 3CNLA 4CV3A 5C9ZA 3QBVA 2JFZA 3B1VA 2ZRNA 4LY9A 4PCVA 1EVKA 1Z63A 2BWJA 1U7DA 1I32A 1UXHA 4DQVA 2WIDA 3DB1A 3FAKA 2Y67A 2Q5LA 2CJPA 1GFWA 2WIKA 3E22A 1AO3A 2HA3A 4DR2B 3GX1A 4I55F 1PVVA 3FSJX 3IP7A 1H1LA 2CDAA 4QU0A 3E61A 1X1SA 1PZNA 2WDZA 1RWPA 3AESA 3MWEB 4KGZA 1ML3A 2Q41A 5KI6A 2J3HA 3CLTC 3ZDBA 4K6MA 2WAOA 1CVRA 4L8LA 4EKYA 4RTMA 3DZBA 3UMJA 3VI3B 3RU3A 5K3SA 1Q1QA 3C5VA 4F3RA 2DKFA 4ZU3A 4JA0A 3FFXA 5EIOA 1X92A 4JT8A 8LDHA 2G36A 3ID6C 3MN1A 2CFSA 2H5EA 4ZT5A 3VZPA 1NMSA 1LNQA 5K03A 4WMLA 1H66A 4CKBA 3Q1LA 3AMVA 4WOCA 3RC7A 1XQVA 4XUDA 1EYZA 2FE1A 2QTVA 2VS1A 3EGIA 4RD3A 1PGOA 4RQUA 4MYUA 1Q0UA 4TZ6A 2Y66A 3E84A 1TI7A 3E1GA 4LZAA 5ER9A 1XAIA 3U9TA 3WX0A 2BFWA 4Z1MD 1D8AA 3RUFA 2O8FB 3RUIA 2DFNA 3RUEA 2BFCB 2QE7D 2I78A 2Q6LA 3KDSE 4JODA 2IIQA 5G0WA 3S1SA 3FTQA 3SZRA 3ZJUA 2FI1A 5H59A 1HZJA 2YIMA 4MUJA 1AZSC 1OT3A 1RRVA 1WQ3A 3UT5B 1ZRMA 2PA3A 4S1NA 2AD1A 5AHXA 1L5NA 1IWBB 5C3MA 4KP7A 1N2ZA 3I12A 3R0JA 2FKNA 1G7CA 4EG1A 1UFKA 4NPAA 2RKBA 3OPXA 2DLNA 4NYIR 4JI2B 1V6SA 1WAMA 4EHLA 3I2HA 4RO0A 4IY1A 2A33A 2CJXA 1WEKA 1ZH0A 3JV7A 3SNHA 4PAMA 4IINA 5IANA 3OEHA 1CUBA 3OIYA 4EYKA 5M2QA 1OBCA 4IQ4A 5FKJA 2OPHA 3I9OA 2WU1A 2PSFA 1ZHFA 5BSWA 2Z6AA 1ODFA 2GK7A 4LCEA 5T8KA 1R00A 3BK1A 1QGUA 1RI3A 4M8IA 3LGSA 3CEAA 3USES 1OB5A 3D0RA 1GUYA 1P1IA 2KE5A 4OUDB 5BRNA 3V42A 3R6WA 3DZKA 3EA5A 2YY7A 2FRXA 3TR0A 5JARA 5JPDA 2XZTA 2DCUA 3PUJA 4NDAA 4CDGA 1KQNA 1N3YA 3U61B 1LBIA 3OKPA 2WSBA 4LDPA 5E3IA 1Y1TA 2VAVA 5FBVB 3DW1X 2B8JA 3DE6X 3G5LA 3PXBA 3WKCA 5BN3B 3RS4A 5K8IA 5GAJA 5AHRA 2IYNA 3D7MA 2ZXFA 1YU9A 4Y1GA 3QGMA 4KFUA 4C01A 1CY6A 2KB0A 1Y4DE 3D54D 4ND8A 2NVUB 4RJKA 4NXMB 4MYTA 1UKBA 1LWOA 1JHOA 2GBCA 3ESBA 4ZGGA 4C7OA 1CXZA 2CLMB 4POAA 5KTKA 1SQ0A 4C14A 1A4UA 2IVFA 2B20A 1FDRA 5BO5A 2HX1A 4NJMB 4WNAB 2ZYDA 3BOSA 4M6WB 2PRJA 2JJ2A 4B7ZA 2C57A 2FMHA 1FFAA 2IODA 2W6JD 4QC2A 4JB2A 3G2MA 4NKRA 2BM0A 2P6OA 4NAVA 3QNWA 5AJHA 1GKUB 4FKZA 4M4SA 4E51A 4EW2A 1NRWA 1NFQA 1U99A 2DHEA 5EIBD 4YVFA 3AEZA 4YWJA 3R9IA 2FFJA 2NU6A 4AY6A 1L4LA 1VLHA 1ONPA 1YF3A 3F96A 2AMJA 2R79A 4HX2A 2WQ6A 4Z3OA 4W8OA 4MEAA 1M72A 4CODB 3S1AA 5JPIA 4BNDB 1AKUA 3RJTA 1N0WA 4QATA 1KOLA 4FZ5A 4R2WA 2CWWA 4D4HA 1F8YA 5JWOA 2WJIA 3HTXA 1E6LA 3FTFA 2JGKA 1VZ2A 2W8BA 1SOAA 3PGVA 3AXSA 5CD1A 1RVDA 4K9RA 4D8XA 1TJPB 4DDUA 2V3WA 3OUZA 1EK2A 1RQGA 2WBLC 4NONA 2QX6A 4XA8A 4JI7B 3R7AA 3F98A 2BKLA 2CXQA 4M86A 1KI8A 3N0XA 3DZGA 5AKLA 1AK2A 4I8XA 3HSSA 3U7FB 1OB2A 2WWHA 4Y1FA 3ILVA 1T3SA 1EUZA 1J1IA 2HDNB 3VPBA 3GBSA 1J5EB 3DTVD 3N8IA 4BB9A 3FLEA 2R2AA 3TSOA 2RG7A 4O1IA 4KH0A 3L77A 1PUJA 3TNFA 2JLSA 4H0CA 3PEYA 1V1RB 2C9OA 4XVUA 1DFIA 3ICQB 4MHOA 1M67A 1XNJA 1RYNA 2RGUA 1HNNA 2WICA 4UPDA 3K92A 4RA6B 4PX5A 3HB4X 1DIOB 2NZWA 2GPYA 1JVNA 2O1XA 2ZT5A 3D4NA 2IDMA 1MLDA 2JFWA 4BQOA 3HNRA 3DONA 1NM5C 3P32A 5HBGA 3E8XA 1YSCA 4YI5A 2HFKA 4A8HA 2JGLA 1SOWA 1W5SA 5IN5A 2EHJA 4OHPA 3LGAA 1OY1A 4U0KA 1N7HA 1NUPA 4ML3A 1QYXA 2IHUA 1GADO 5JNTA 4TPKA 3EIUA 4HFJA 2QUIA 2OQVA 2WM3A 4NSNA 3PJRA 1LK7A 3I53A 1I14A 1TYAE 2JAPA 2H1FA 3G17A 3HKBA 3TQQA 1TAGA 1TVKA 2OORC 3TSAA 4JLVA 4C6TB 2ZRKA 5ES4B 3GUZA 5LQCA 5AVOA 4MB6A 1EFPB 3TINA 5GVRA 3F4KA 3AHIA 3QPDA 4G1FA 3SOZA 4MS4B 3WLEA 1F4PA 2VLIA 2VWGA 3GGJA 3LT0A 5FUQA 1LPPA 4OU4A 4OGKA 4O0MA 5CDYA 4MUMA 2FSPA 1JMYA 1UINA 5BR8B 1DVRA 1WCIB 4PHFA 5FCDA 4YJFA 3KE8A 4US2R 4MKFA 1GY8A 1XVLA 1Y81A 4KXWA 3RWBA 1PQUA 4YTEA 4XD7D 4K9NA 2OZEA 1V0JA 4ECAA 1P4GA 4I6EA 4NNOA 3SLGA 1W49A 3N3BC 3TLGA 3OM0A 4B6GA 1V7CA 2V6MA 2ZAIA 3KTDA 5FWAA 1ZHHA 4IEFB 4JLUA 3WDSA 2J5XA 5B2EA 1A5ZA 3QWHA 4EI7A 4ZI7F 3FPEA 2XUAA 3K2EA 4ETMA 1AC5A 2DKNA 3PC7A 2ID4A 5AJTA 2O0KA 1D7AA 3PPVA 3O4VA 1FRFS 1SUDA 1SEVA 4XPIA 4AKGA 3QHAA 5FOUA 2RD2A 3Q11A 2PPVA 2HWWA 4RV4A 3PA8A 1JVBA 3DL7A 4UASA 3KOZA 1F0YA 1N2SA 3CWQA 3LVBA 1TLLA 3U0BA 4CUZA 4DNPA 2FYTA 2P41A 2J7PA 1EFRD 3JD3A 2W8ZA 5I9SA 1D6JA 2X41A 2CUNA 1GTG1 2KX7A 3DBRB 4X60A 5IDXA 1AO0A 1Y8AA 1WMSA 2Y1KA 3DQZA 3HU1A 4R1TA 5AOVA 3PYLA 2V8OA 1A7KA 3K32A 4UTZA 2CBXA 4Y9SA 4B4KA 5DTIA 4C6RA 3KWJA 4LG1A 3WNQA 4KYIB 2FFHA 3WA6A 4FYXA 1UEIA 2ZI4A 1XCOA 2EBUA 1FP2A 1WDLA 3JD4A 3L0ZA 5H68A 3BXZA 2QT9A 2MWMA 1TZJA 2PUCA 5EMMA 3SC6A 3Q8WA 5EQJB 2OM2A 1T5LA 2V9CA 4G0QA 1S3IA 4JSTA 3VXKA 2GNPA 2I34A 3JCZA 4YLEA 4EO9A 5I01A 3NYIA 2RDMA 3NWBA 5E1MA 2OXEA 1TYEB 4L4RA 5HKKD 1JYEA 3ITEA 1E9CA 1AMNA 1ZRNA 1GTSA 4E08A 2WJGA 3F6BX 3GRVA 4J7AA 4PPYA 4D9FA 1XXLA 3WWEA 5CA1A 1FUKA 4WLEA 4YRTA 3WHIA 5LD2C 1SCBA 1E3WB 1H23A 5D86A 5ALRA 3REFA 1MOZA 3T3EA 4BZPA 1N6PA 4AC9A 5GTDA 4QPPA 1EWVA 3WSVA 2VT6A 4JSYA 4HRXA 1DIBA 5KTNA 5TT0A 2PGLA 2ORIA 1YCDA 3ZEIA 1GZ5A 1LX6A 1TIKA 2A0UA 3I30X 4UM5A 5IAJA 4CG3A 1WWKA 2P5TB 3HLYA 4IBOA 4I46A 5FO1A 4XR4A 5FJJA 5HZKA 3K7EA 3P4YA 4RHYA 1OYOA 2ZUBA 4H0FA 3FKSA 5E6RB 3C7DB 4EEKA 1XZQA 3V3TA 3DPSA 3COVA 2NW6A 1BQEA 1BA2A 1MOPA 2C03A 2R8XA 3CLUC 3BXXA 5K7SA 3UIEA 5P21A 2O50A 1XZPA 4YQEA 5C2JB 3L0IB 5AVXA 5FWNA 1G3RA 1S2NA 2VSFA 4DABA 1AQYA 3LUDA 4UREA 1GIAA 2C94A 2VF2A 1MX9A 2PS1A 3F4BA 4GHWA 5CLHA 4YAFA 5DRTA 1GUDA 3KRTA 5K3OA 1WV0A 1CB0A 2V54A 3BCRA 3PNOA 1N5LA 2J0UA 3E53A 4DJJA 1DQNA 5CVJA 1IXYA 2B3DA 3TRJA 1NI4B 2D8MA 3URKA 1VE1A 1CF4A 3WV4A 3RYHA 1WZEA 1L5HB 3H5AA 5EPEA 1A5AB 4M0PA 4NG4A 4W9NA 1EXDA 3DLAA 3AP2A 1Q7BA 1FQJA 3NHPA 3FG9A 5KYWA 1XDSA 3VR4D 2OAP1 3H2BA 5K3EA 3GZTB 1EVYA 1P6QA 2ES4A 2HWKA 3DBLB 3UENA 3GT4A 4F85A 1YZGA 5M34A 1US8A 1V1MB 4ZTBA 4E1VA 3QXJA 1ZU5A 1Z74A 2KJQA 3GFRA 4RQAA 1W4CA 1Z3CA 2A58A 4B87A 3CR8A 3N59A 4P4LA 3WHLA 4KREA 4I1IA 3HCBA 4RVDA 1JHRA 4KCGA 5D5HA 3QKUA 5DMHA 2O7NA 2QL7A 4I3FA 1K1EA 4PM4A 3D6VA 5AI8A 5E7IA 1JEEA 4CCYB 3C70A 4QRDA 4L3VA 1Y4UA 1QZZA 1E7RA 2QSUA 3DHYA 4AMVA 4U6QA 5JS8A 2AK2A 2JHPA 2AV6A 2ZT6A 4JR0A 2WWXA 3BK7A 1VHQA 4EY8A 2W2QA 4Q37A 2CZGA 2DH5A 2AI1A 1NX9A 5DK6A 1VA4A 4IQFA 4KX3A 3G0OA 1V37A 3YASA 4F6RB 4UNRA 5J5AA 3RYFA 5AOAA 2IU6A 1PF7E 2FPGB 1Q1AA 1DJQA 3DUFB 3LA8A 3QK7A 1XL1A 3ED5A 4OQEA 5EPOA 3ZK7A 3L06A 1DGQA 1V45E 4NECA 3V97A 2C84A 1NUHA 2Z30A 4CQMA 1ZUD1 1L9XA 1XCJA 3MTJA 4TN1A 4GL2A 2CF6A 1U1IA 2DE0X 4FW9A 4ZALA 1VYHA 1ZY2A 1FNMA 2GHIA 4LDJA 2O5CA 1G4AE 3GVHA 3ZR4B 3CRMA 1D2CA 4LI0A 2J0QA 3UCEA 1PWZA 3ZKWA 4B3GA 3VA7A 1JEQB 2N46A 3BERA 3PHGA 2V7WA 1KMHB 2Q6OA 4GSKA 1Q3TA 4P4UA 3IALA 4R05A 4TM8A 4YJ2A 3UWPA 2DFDA 3HN6A 2QAIA 3WK7A 4MJ3A 4DMLA 4FIDA 3N7AA 4JP2A 2GJAA 3Q7QA 2FUG1 4LAFA 1DLJA 1EKXA 1C0LA 3AJEA 1PN3A 5DDIP 1NF9A 1GNSA 3F71A 2DR0A 3K94A 2FFRA 4MV5A 1CZUA 1TU0A 5EG5A 5IF9A 3K0SA 3OOHA 2EP8A 1SCQA 1A1SA 1YB6A 3PF8A 4DTIA 3Q5EA 4NU6A 4RPIA 4DDKA 3OCWA 2PUTA 4YGXB 5LQNA 4JZKA 1IIRA 5HFJA 3UTDA 2QTZA 4JI1B 4CW7A 3KELA 3MLEA 2Y0CA 3HZHA 1MFZA 3PYXA 4X8HA 3T5DA 3VKGA 2RKWA 4EW6A 1ZINA 2AVNA 3P2KA 1K2VN 5CH5A 2CFRA 3I0ZA 1NOIA 3ADKA 3NP9A 1ZO8A 2ONKA 2QUAA 2A5LA 3Q5GA 4TUYB 3ZTWA 1I80A 1QG6A 1PV1A 2ZJ0A 2W6QA 3RK4A 3QNUA 4RUKA 4QQ8A 3UK7A 1KOGA 4PR3A 1W88B 3LK7A 1NIJA 4UAGA 1IXRC 1VSQA 2AHOA 3KB2A 1KXZA 2YV4A 3L6BA 3I01M 1BA3A 1DWQA 5F1PA 2ZR8A 2PR7A 2A0KA 1NQ5A 4G8DA 2V8BA 2ASEA 4GWLA 3DKPA 2BBTA 3H4TA 2RGNC 2AX3A 2PO7A 3OZVA 3INTA 4AZ0B 4ZVSA 3DOCA 4EQ6A 4J94A 3RAFC 2XTNA 1JFVA 3HB1A 2MSKA 2W2NA 4MV4A 3EZLA 3SFZA 3TLCA 2PLFA 1ZPDA 1I2MA 4QKQA 1YL6A 2PVCA 3D6TB 1R2QA 4E5KA 1EJ6A 3CLTD 1L8AA 1KETA 1Y82A 1ZWKA 4UOZA 2H8GA 2PGIA 1SY7A 2XYGA 3BWDD 3OWOA 4BGEA 2CMKA 3R3XA 4MGEA 3BF8A 3IUEA 3NV9A 3OUTA 1CUEA 4ON9A 2X0JA 5JUWA 4BY9E 5F4ZA 1JQAA 3ND8A 4X1IB 2VH2A 4RCYA 4FXOA 2FW6A 1II8A 3ILHA 3LQFA 1IN7A 2D5BA 3BF7A 3RJZA 3WI7A 1OT5A 5GINE 1KAHA 2O8DA 1XZDA 1TADA 4GOOD 5ARCA 4GVPA 1DAOA 4JLPA 2OESA 4HDAA 4U63A 3UUFA 2ZAMA 4TTRA 2DQZA 5DHUA 1DO0A 4E15A 1KS9A 2FPWA 3RSGA 1YOVB 2FEKA 3QPBA 4RAOA 1L4FA 1WB5A 2HWUA 4XRRA 2DPYA 1YZQA 5EE9A 3CUYA 1ZAYA 4S0ZA 2OCDA 3UFBA 4BLQA 5H9WA 4PYJA 1R9MA 4RH0A 3U31A 3JR3A 4KYUA 1AJEA 2C7GA 2PKXA 1HOTA 2Q1XA 3NAZA 3BFJA 1LTKA 3HDGA 3I3OA 4HDQB 4DA9A 1F7UA 2F2TA 1XRNA 2PSJA 4P58A 5DTJA 4IIHA 5CX1A 3TD6A 2DSTA 2BHRA 4QULA 5JJCA 2B9EA 5TPWA 1HURA 2APJA 2QYTA 4IUDS 5E38A 1SQGA 2BZSA 4R2HA 3L5OA 5EERA 5FORA 4PONA 2QK4A 5CBPB 4DANA 2WE8A 4EMUA 5TQ2B 4KQ9A 3PQCA 2FMUA 5I48A 3GRFA 3VR5A 3V4RA 3FDIA 1PU2A 5PGMA 5F33A 4EKIA 4IJ6A 5JZ9A 2J6HA 4P0QB 3OZSA 1ZD2P 2QN7A 3HEBA 5K1ZA 3RC2A 1JALA 2X0KA 4PC3A 2P3QA 2ZIXA 3HADA 2IDKA 3H65A 3WK9A 3DBHA 3AUUA 2CL5A 1R5JA 1Q95A 3KXKA 2QUBA 1GITA 3WLFA 4D92A 1B8NA 4Z4IA 4QBGB 4F84A 2VP2A 5TQJA 3G5AA 4N0MA 1MB0A 3DAPA 1CUXA 2C99A 3AF4A 4EGSA 4D8VA 5L51A 2VYFA 2HV8A 3GPBA 3KQUA 3A4IA 4H6XA 1H22A 4IIEA 2AOXA 4AXBA 3DUWA 4DARA 4QJ3A 2J4FA 1S1CA 3DV2A 3ZNNA 5IXJA 3FCEA 2RFLA 5T4HA 1JUDA 4DVGA 1AK9A 1ZLXA 5AKGA 2GK4A 2H4FA 3TVYA 2EL7A 5FULA 3W5VA 3ZIDA 3IE1A 1IQ0A 1P1HA 3R5KA 2WD8A 3NC1C 2FWBA 3QSYA 2WSMA 1SB9A 3PTLA 1H6AA 2VK8A 2PUFA 4JI0B 3CVWA 1JB1A 5BR4A 5DBEX 4HDNA 5FWYB 1SXJC 3OTHA 1O7JA 2CD7A 3B1ZA 4Q0MA 4QEKA 5LQAA 3J81k 4JLJA 2N0SA 4F1JA 3GWGA 2QT1A 4FGSA 1PL6A 1KZHA 1DXHA 5LZ5A 1J00A 4Y9DA 4GF5A 3AP1A 1XFAA 2HK9A 4TMZA 4ALNA 3AHHA 3R7WB 4UDXX 2H2IA 2Q62A 2JD1A 3ACCA 4N5LA 2O9JA 2VNAA 4NJEA 5E8RA 2JLZA 3AUTA 1WPRA 4ZAGA 4FGJA 3QEBZ 3L43A 5TEVA 1EVIA 2BOVA 4QO8A 3FZNA 2WWIA 1UC9A 1XD9A 4LHZA 3CNNA 1G38A 4HO1X 5F73A 3KZVA 1TT7A 4G2TA 4MRMA 4XVHA 1W73A 3FYUA 2M9MA 5C5DA 2J9RA 4EIWA 1OX4A 2DTEA 3L01A 1XKXA 5DM70 4G4SO 5T3YA 1YIOA 3GL9A 3OZ7A 4FOSA 2FRVA 5T4EA 5CYOA 3VH2A 3DVAB 3KU1A 1K9VF 4BDSA 3LOPA 4JBIA 4QDZA 2OLKA 1MJGM 3S2EA 1PT6A 3O7MA 3UVEA 4QTTB 1N77A 1Y8QB 2FKAA 2PYIA 4EUHA 4URFA 1M2FA 1PUXA 3OQOA 1E6UA 4Q9DA 4F38A 5F7JA 3J7AC 4XIJA 4JASB 3HE3A 3LYUA 2ZRBA 2HIMA 4FEYA 3CNEA 3WKEA 4YR9A 1BGXT 1JQJC 1SMKA 1Z2PX 4RD4A 5EJGA 4DSZA 1B41A 1C7IA 2BKEA 2RBKA 3HUFA 1B42A 3KLOA 4FNGA 3RFXA 4ENSA 4ZEMA 4A5OA 2FWRA 4QGSA 1OFUA 1Q0LA 2V65A 1VCHA 2IKQA 3ASUA 4RZXA 1VQ1A 3STYA 5FLXA 2IS4A 1IRXA 1Z0AA 2ZW9A 2FP4B 3DV0B 1Z9BA 4LJSA 4NCHA 1JMKC 4A8PA 2QAGA 4EG4A 5A5FA 5CXQA 4X97A 5IAOA 4R8LA 4PG4A 1CRPA 4HAUA 3C3KA 5CVEA 2HK6A 3GFPA 3TOCA 5JNVA 4QELA 4LHSA 2AVDA 3HG7A 2LVBA 1I2DA 2R8RA 2YZ7A 1YZKA 1FPQA 2ZIUB 3AONB 3WADA 1G6KA 1XD2A 2OPBA 2QP4A 5CDUA 1N36B 3VPAA 4LQCA 4X3PA 3LC2O 5K20A 2POQX 2C58A 4XLZA 3C1AA 4X7RA 3FOBA 4UM9D 3GA0A 2RHOA 3KJEA 4X1YA 4IIJB 2JGMA 3QRWA 3RG8A 1R9JA 3I23A 3Q8XB 3EARA 2I4LA 3JALB 5EWMA 2OEPA 4P81A 2P4QA 1E64A 3GLHE 4ROTA 3VR2A 5C4MA 4PS1A 3EBOA 3EASA 4F4HA 4TWAA 3ZWYA 4CKCB 4OAQA 1GTMA 1RNLA 2PWYA 1GFIA 1XGKA 2X4IA 4GW3A 3WRYA 3JQQA 2WR8A 3OTWA 3FSEA 3QLVA 1XAJA 2REQB 4PNHA 5U1PA 1RI5A 2C5HA 2YN0A 3A58B 3IDAA 3VNAA 4DUZB 3GT0A 4BO8A 1NWCA 2PEYA 1I01A 2R11A 4FDLA 4XLLA 4YRQA 1XR3A 1V8DA 2PUGA 1ZCBA 4HDSA 5IXYA 2P8JA 1DG9A 6YASA 1A8SA 1XZAA 4EHAA 2JCXA 4QGHA 2XPCA 4RLHA 2H4HA 3ROGA 5G1PA 1W1UA 4EFDA 2LNDA 2ORYA 4L02A 4K0RA 5C7LO 2SNIE 4G26A 3V00A 3LWNA 5JNLA 4WN9A 2GFIA 3IO5A 3IV6A 3WJ7A 2AW3A 1ND5A 1NA5A 3B1KA 1UJNA 2OGUA 5CFPA 5HUHA 4NMMA 2PFSA 3K3PA 3L6EA 4YRDA 4D82A 1E3DA 2F8TA 3PPYA 3BMXA 4B6RA 2OXFA 1KKLA 4MR8B 4TSKA 2JRLA 2X77A 3FBTA 1P18A 2RC6A 4CDNA 3EVCA 1O6GA 1P0MA 4BX3A 4DQDA 3HDVA 1DKQA 2QP3A 4LKOA 2QVCA 3ZW7A 1BS2A 2VZ9A 4D8TA 1O5IA 2IZZA 3PGKA 4JU9A 4NMWA 1ECFA 1B3RA 1IZ0A 1Z28A 1CLEA 4O2LA 3TE7A 5J5VA 4L76A 1VA5A 2I4MA 4MA0A 2NUTA 3OQIA 3ONEA 4J0KA 2XZDA 1V96A 2EEPA 2I2FA 4KXUA 3SYKA 3RFTA 1PGQA 3KHUA 3IEMA 5KCMA 2F55A 3CW8X 1WCYA 2IPOA 1RZRD 3EUFA 3SX0A 4AKHA 3DE3X 3OEEA 4P7GA 1UDWA 5J5CA 4YAUA 2YHAA 3RE1A 4MVXA 3FHTA 5I9BA 3HFRA 1HDXA 4ARVA 1MC4A 2H2DA 3HDHA 3BRCA 1N6RA 4K26A 1O95A 5DISB 2AFIA 3VSDA 2W5UA 4WFKA 3KPYA 3OY2A 5LYYA 2XRYA 1DT3A 3Q2IA 4IDCA 3IULA 5IZCC 2P9ZA 1GSAA 4D9MA 4C5CA 1JJAA 3BIXA 1XLVA 5IULC 1B0UA 4OHFA 4OMFG 1ANKA 3QWAA 3M6AA 3NXSA 3NIBA 2MHCA 2QQ5A 5CLGA 3WTCA 2QLFA 1KYYA 3QBEA 1RWOA 2XITA 2BMJA 3AU9A 1F12A 2VTDA 2D5LA 2PX3A 4MAFA 1T8PA 3NMUF 1QZUA 2B7LA 2HI0A 1OAAA 3NOQA 2D8AA 3FZGA 1QXSA 2DY1A 3P9SA 5G40A 1XRQA 4AS3A 4HGOA 1APBA 3UJ9A 5CJJA 4YUXA 2V5UA 4UD6A 5EWJA 3NRCA 1QG4A 5J23A 2O0HA 2FWIA 4M7RA 4TL7A 2PKEA 1MTZA 1HYGA 2XADA 3DA8A 4J0FA 5FQOA 5HR5A 1XOIA 4EG5A 2PUBA 1N32B 3L7LA 3RT1A 3OZGA 5FUXA 3KVNA 3EPKA 2J9YB 3EH1A 2YINC 5J4HA 3CUVA 4LZLA 1AH2A 3RSFA 4KQKA 3S8YA 2WWGA 1XDUA 2WILA 4FFDA 4L6AA 3RVJA 4BPBA 3VGJA 2NT3A 4AJIA 4OHMA 3BQ9A 3TR6A 5I6DA 1W1IA 1MQSA 3GVCA 1L7BA 2CHGA 5IC6A 2WKRA 1OHHD 3ZCSA 2B4TO 4RFVA 2AKAB 1HG0A 3N53A 3QE0A 4LHYA 1JW9B 1DC6A 4JBYA 2Y0BA 1L7NA 3NM6B 3KETA 2FZCA 2IZ6A 2WDPA 1JVSA 2CNNA 3CLUD 3DAYA 3T7DA 1Y1PA 3NI2A 4EB6A 2O4UX 5BUZA 4MDFA 2J0VA 2OVFA 3UUEA 4AYTA 1RI4A 2E4WA 2F3TA 4PV7A 4YDRA 4JBHA 2VYQA 3R0QA 2WMYA 1L5RA 1W0KA 4FGZA 4RK6A 4TKZA 5FRDA 2RG1A 4TLLB 1ZBQA 2O14A 3DZFA 2DQ4A 1XDWA 3QVSA 5F3DA 3WICA 4EY5A 2XTJA 2IZ0A 2ZITA 2XCIA 3OECA 4GE3A 1YA4A 1CERA 4I4TB 4AJJA 5HQ3B 1NPTO 4JOCA 4QUBA 1U3GA 3MOSA 1BCSA 3Q3CA 5A6SB 2WINI 3TZ6A 2AL7A 2WWVD 4Z51A 1WB4A 1CIPA 2QY9A 1ZIDA 1IB0A 2ZEJA 3CN9A 3CRNA 3W5AA 3E9YA 3UJBA 5IH7A 1AXGA 5E9WA 3M4NA 1XZ8A 2E55A 5CM9C 3R7BA 1WXGA 3S5UA 1D0IA 1MIHA 1YBHA 4U5XA 4X1OA 1TKBA 2YOHA 4LGMA 4D8UA 4PC6A 4HAWA 3C39A 3O4HA 4ETWA 3Q15C 4JKOA 1PNOA 2Q2WA 4RY2A 2E87A 4EECA 3BREA 4DCJA 1K8ZB 4C7KA 4KSCA 2WB4A 1FX0B 3CEMA 2XKAA 4HAYA 3VPSA 2QRNA 3BYZA 5C7IO 3E9NA 2C9CA 4M0MA 3KXPA 1LV7A 3RS0A 4S2EA 3QH4A 1TF2A 2OCLA 4TT3A 1QVZA 2WUDA 3EQZA 3M9LA 2J32A 3UMSA 4HH3C 2H7XA 3DYVA 3R0VA 5IAGA 5J58A 1W36C 3Q1KA 3PRKE 5ESWA 4KN6A 4EJ2A 1GD1O 1WOMA 5KC9A 5BNIA 4N3CA 3M1YA 2FEMA 5JBIA 2P2SA 5J4VA 3IKLA 2WM9B 4OHYA 2FXIA 1V26A 2PD3A 4C2UA 2H4ZA 4U1RA 4Y7DA 3DVSX 1T8RA 3I28A 5DGXA 3ZE1B 3ZNQA 2W7TA 1KSFX 4HC4A 1BXGB 4PVDA 4MGHA 3I5AA 2I65A 1E2DA 1CZLA 1QB7A 4IIVA 1MJFA 2HPAA 3ZTTA 2Z58A 5I5EA 1JFRA 2GQ0A 2DETA 1C3JA 2B6HA 2QD3A 1G20B 1FUEA 1EHYA 3F4LA 1PYOA 1NVGA 3F9IA 4Z4EA 1PT9A 1ADGA 2ADOA 2PD4A 2NTEA 5B1YA 2Q1SA 3KE9A 1OLUB 3MMNA 1HLFA 3L4BC 5DHTA 3WHPA 3IJRA 1NQXA 4DMHA 1OKKA 2EZ9A 1IRIA 1RXCA 3LA6A 4YMTA 2NP7A 3DDNA 3CTPA 2DM6A 3E2IA 4MIKA 4IQ0A 1ZCAA 2O1SA 1L7DA 3PB3A 3INYA 2OL4A 3P9RA 4TUYF 1GGMA 4ZT4A 2V5AA 3KQKA 2DC1A 1I6KA 2WRZA 3F6PA 5JMTA 1DIGA 2A8YA 3NGMA 5JROA 2IX9A 2I22A 3HWX1 4RADA 5LQMA 2W2PA 1ISMA 4NE9A 5GVSA 5JQGA 2B8TA 2LCFA 3LP5A 4NHOA 5LDHA 3I9V6 3IJ5A 1WKBA 3LBIA 4NY1A 4YXWD 3W8DA 2CKMA 1P3JA 1UMBA 4PYKA 4AY2A 1BMQA 3AF3A 1QDUA 4XJTA 4RTNA 5D85A 4XD2A 2NXJA 2HSWA 2RIPA 2YVQA 3N2EA 4DUGA 1K2WA 4YCDA 3CMCO 4PZ9A 2N1BA 3KZ1E 2ATVA 1WPXA 2ZUWA 1IHOA 1HQDA 4OH1A 1H8HD 3K4PA 1UAYA 3MXTA 4RDXA 4O02B 4RD2A 1QYWA 1TF5A 3ONWA 4KDRA 4OOFA 4WERA 5HDBB 3IQZA 4C87A 3N6RA 3CF6R 3HEAA 4MVWA 2ZG6A 3A3NA 1DAKA 3Q3IA 1A9PA 3J7TA 1PSZA 1QAQA 3CU5A 3CTMA 1E0SA 1OXXK 2D0OB 3KOWA 2GA8A 4YCSA 4D45A 2O3JA 1ZMBA 3HYRA 2XAAA 4O25A 5A71A 3T7TA 1YMQA 3AI3A 3B85A 4LNUA 5F76A 3SHOA 1VYVA 4EFMA 5KU7A 3NQ41 4NNJA 5E2BA 3HXTA 1XC7A 4KN5A 4BP9A 3P7MA 3KALA 4PZPA 3A1NA 4S3MA 1FQWA 2OB1A 4WINA 4WEQA 1P2VA 5LLSA 4IR7A 1LI5A 1CRWG 3B9QA 1ENPA 1NW5A 3IHKA 2RH4A 2WTEA 3VC3A 4A15A 2EX1A 3WNDA 4GWKA 4GI7A 2QQGA 3W05A 3X1WA 1VPEA 3SHFA 1LS1A 1QK4A 1UOOA 2VAXA 4WA8A 2CLDX 1J6UA 1WA5A 2QROA 3TI7A 2VNHA 1JJ7A 4AN4A 2IJGX 3OKFA 2JIQA 5JH7F 1EX7A 3JAWB 4B44A 1XNQB 4M83A 1CY7A 4OK6A 4ARSA 3WLKX 1YFZA 4LZOA 4D4MA 3Q9NA 3GZNB 3RUAA 1GGNA 1B6SA 1LJUA 3VU1A 3V4LA 4PN3A 5F2EA 2NG1A 4DWVA 1NL3A 4IH1A 3RT9A 2AZTA 3THYB 1J2RA 3QA9A 3ZLUA 2XRFA 2CVPA 1MO2A 2YZNA 2LTAA 4ME6A 4L07A 4ZT6A 1X0XA 1R4MA 4GZ3A 4Y2HA 5F51A 2WYIA 3CG4A 2INGX 2AI3A 2PS0A 4ZRNA 4HNTA 1DBVO 1I30A 3P9IA 3OOWA 5GONB 3HNOA 1AUPA 3ER8A 4G0ZA 3K0FA 1AGRA 2VDVE 4MV0A 3TUIC 1TZCA 5KOYA 3R5FA 3LF1A 3HV0A 1ZU4A 4GWGA 3U2QA 5AVSA 2HD4A 2VYVD 2AJLI 1BWSA 2I80A 3V6LA 4MULA 3QKRA 4DQUA 4KO8A 1E89A 5D00A 3GJ7A 1BQ3A 1FS5A 4MCAA 3D5TA 3AL0C 2BCJQ 4A0GA 1KTIA 4OHXA 1Y6ZA 3Q3GE 4H1TA 1SELA 1C3LA 2Y8EA 3NJ8A 1ZH2A 3V1KA 4PS0A 4IDQA 5DKFA 4ZXPA 5JYBA 5THKA 4OM8A 3W78A 4DCNA 3ROEA 4ZJYA 2L19A 3H4MA 1NIPA 1L4MA 5HE8A 1NVUQ 3IH5A 3RV3A 2F9MA 3ZWCA 4B3JA 1NVAA 3T1YB 2XRZA 2RHMA 2QNIA 4AMGA 7REQA 2P9YA 4INAA 1F9EA 3BK2A 1SXJE 4JUBA 4RMGA 1Y4AE 3V1TC 5B7PA 3CZ9A 5HMMA 1K0FA 2BGNA 1CDZA 1HUQA 1OYVA 2A86A 2BRUC 1PEYA 3KOUA 4LEIA 5BN4B 5AK6A 4DQLA 1CUJA 3HP7A 1QGED 4YMSA 2JD0A 2O2XA 4OGGA 2GD2A 1Y9EA 1ZICA 1GAQA 4MITA 5FWXB 2EL9A 2MR6A 1E1YA 2GBLC 2A0XA 5IVIA 2NWQA 3UGKA 3LQQA 2GD6A 3P0JA 4H7DA 4G5OA 4JQCA 2G1UA 1ETHA 2PBRA 3K1AA 2G8LA 4R8VA 3ORYA 5DB4A 5HJ5A 4BFTA 3BB3A 1LZKA 1RC1A 1NJGA 3HWSA 1WVGA 4DDMA 3FVQA 2Z57A 2P67A 5I7SA 1FJGB 2XNDD 3AOEA 2YC2C 3R8XA 4BQQA 4BKOA 4ENUA 2C2BA 2B1GA 4NE7A 5TQ0A 4MLPA 1SXJD 4DR7B 2IIPA 3IKTA 2NQTA 3F3YA 1TUGA 4B85A 1EK1A 3I2FA 4PRYA 4BVJA 2ZREA 3OO0A 2WNHA 1MEJA 2F6RA 3AFOA 4UUQA 5ULLA 3D8SA 3ECSA 1R8QA 3NBXX 4JJIA 3QFCA 4BLRA 3N8KA 1R50A 2XUJA 1UWKA 5IT9A 3BUSA 2YOFA 4DM7A 3UAYA 4YUZA 1UFRA 2VDOB 3UF0A 3IDZA 1MP0A 1MQ8B 2WSIA 2OO7A 1EI9A 1U0GA 2JRCA 9LDBA 1FU8A 3R0ZA 4KWEA 4WY5A 5FPYA 3T95A 3DEHA 2FWJA 1U9YA 3MS2A 2X6QA 3M9WA 4AKEA 4X45A 4P0PB 3P26A 1C4KA 2C4MA 4YP9A 5L3VA 1RRFA 4UHFA 3RWOA 3W4KA 1T9DA 2W71A 2RGGA 3FVWA 3GLIA 3ZHBA 4IIJF 2IW1A 4G9EA 2VQEB 1ODIA 2IGTA 3FNBA 3VPFA 3WQRA 3OBBA 1C7ZA 1RQRA 4Y9TA 2JVIA 4MS3B 4Y9RA 4KGDA 3R0XA 2XYRA 4R7ZA 5FPTA 4F86A 3N0WA 5TJHA 4EATA 3UHOA 1QK5A 1G8JA 3WGNA 3EY9A 4XH9B 5BQ3A 2YXNA 4RHXA 2M6RA 2C7OA 3GRAA 1RXWA 1ZXXA 4KRFA 1E66A 2XYVA 1WBJB 1DLIA 4YQYA 5AKYA 5E7QA 4N3NA 4YEDA 4CKBB 2G83A 2V0NA 4GBGA 3JQCA 2P0YA 3IFSA 1XJ5A 3FMGA 3LL4A 3RFVA 3KT6A 3FYHA 1HE2A 4M1EA 1CF2O 1IEVA 1WQ1R 1XEFA 1DCMA 2FCRA 2CVOA 4A82A 1EUQA 2WF6A 4N54A 3G2QA 2PGJA 4R16A 3BFPA 3LIIA 1LU9A 1T91A 1GUAA 1FSSA 3QLJA 5BSUA 4NXNB 4JR2A 3E9QA 1N7GA 1K8XB 2B1IA 1KMIY 1TVMA 2QVZX 2P9HA 2WNSA 3OTGA 4UHBA 2V7EA 1FTSA 1H2YA 5F3WB 1VG8A 2ODBA 2OFOA 3BE4A 3WLIA 1TYCA 2WFLB 2Y1CA 1LK5A 1Y3AA 2C1EA 2WFMA 4RPLA 4H6PA 2X22A 4G1BA 5DI3B 4G5SA 2G5PA 1Y1LA 4QU9A 1KJIA 2MJLA 1ZKDA 3HCWA 2JCYA 3R23A 3N2GA 3QX8A 4KE9A 4OFXA 1PIWA 4QASA 3ZS8A 5I4KA 1K97A 1EXWA 1TVKB 3D4LA 4KLNA 5B3JA 1LF0A 2BHNA 1NP6A 2BZ0A 1PNRA 1IZZA 2VJMB 2PKYX 4OGWA 3OFVA 2REBA 1LPAB 3M9XA 5L9AA 2B34A 2NYAA 1R5NA 2QLJA 3P9KA 4MYHA 5TR9A 3ILSA 4ZJPA 2WKQA 5DSZA 3CH6A 1VGVA 2PFKA 4AB1A 3GLGB 1O0CA 1KPHA 1G59A 3OLVA 2FW0A 4JB8A 2F43A 5ICEA 3O3OB 3PHBE 3ZE7A 4E30A 2GBGA 3JD1A 3UPUA 3N05A 2B8NA 3QKSA 2PL5A 4GRIA 1ZJWA 5AKZA 4RDCA 1C8BA 3QPAA 1JHMA 3WAJA 1XZKA 3Q7RA 4KPGA 2I6UA 2WNIA 2GRJA 3OP4A 5LC1A 4W7IA 5JAOA 3UT0A 1DJOA 2Y4OA 4EUEA 5M04A 1QV9A 4QGFA 1X1EA 4E22A 2QTNA 1CQJB 1MIOB 2GFHA 1TVEA 5I8PA 2C2YA 3MIZA 2GZSA 4DXAA 1ZM3A 3ZK9A 5CU7A 5JJBA 2XUZA 4PQRA 3TK1A 4B43A 1FTNA 3RAJA 4A27A 2WLSA 5G0UA 3ZHUA 4ZAFA 4D46A 1OGJA 1ZD4A 2PMDA 5JC8A 1UAAA 4X85A 4AECA 5IM4F 2AR9A 3P20A 3KK0A 2EF0A 4E3ZA 1MX3A 1NW7A 1BDJA 1SEPA 1T6NA 4PNEA 3IAEA 2OZVA 4B2PA 7YASA 1P0PA 1AG9A 1TCAA 3EFEA 4KODA 1YQGA 2GD0A 1CR2A 1NJ8A 4C3OB 1BU5A 1BW9A 2Y6VA 3R5XA 4G2NA 4RTPA 1A3CA 1TUBB 3UMCA 3KZXA 4HLNA 4CKYA 1LS6A 1MVNA 4CM7A 5GIPE 1C7EA 1H8EA 2NP6A 2AN9A 2OWDA 2JVKA 1YB5A 3JQ6A 3RPEA 1FVFA 1T5IA 4N39A 3B1YA 5KJ1A 5JC1A 4TYYA 2C92A 5B1IA 4X1KA 4BFLA 3U4MA 4GVXA 1J0CA 4OA8A 3ZS9A 4DY6A 2W90A 4IMIB 1M8KA 2J4DA 2CJWB 4WASA 5LB4A 1X70A 4JVOA 3VOBA 2CXOA 3UWKA 1YTUA 3UW3A 2JLBA 1RPAA 3V4SA 4D26A 4N5DA 3SIWA 2Q3FA 3IQDB 2VUHB 4TQ9A 3ORHA 2W6MA 3BMQA 2JFUA 4IDPA 1T26A 4YUYA 4I4NA 4BO7A 2QVYX 3DQQA 2OFPA 4PTYA 3BL5A 5EXTA 1RMTA 1PJ3A 2Z8ZA 2QV7A 3L92A 4GKKB 1JA0A 2PQ6A 3HN7A 1SIWA 1Z4NA 1EH5A 2A9PA 3L04A 2PL3A 4GX0A 4XXHA 5DIZA 3ZJVA 4BO6A 2FQXA 3GEMA 2GAAA 1BOFA 4MLCA 4I4TF 1NRJB 5COAA 1E1DA 1JNXX 1KJJA 4KNYA 1E60A 2X1VA 1NVWQ 3FSRA 3DC2A 2AYYA 1JPNA 5FJIA 4AUEA 4DA7A 4RJTA 4RJLA 4ZV4A 1A4IA 4HEQA 2XWBF 5BYBA 3TFWA 2P35A 4PBTA 4RY0A 2QN2A 3EDRA 3LYHA 2NV2B 1YC5A 2VBCA 1SXPA 3MYRA 4P84A 3E03A 4DR6B 4MQFA 1SNYA 4ZCQA 3BCHA 3L7YA 3KQOA 4ASUA 2UZ1B 3A3KA 5L7YA 3DKKA 1L1FA 3U4IA 2YVKA 4BP8A 3JD0A 1BHO1 3K05A 3W2FA 5DN6D 1EFAA 3FCCA 1TO1E 4QM6A 3VR0A 3GMIA 5BOSA 5JWRA 3G13A 3F1LA 2E82A 1XELA 2QI9C 3NO4A 4ZVRA 4QUGA 4ZK6A 3HVIA 5B7NA 4M0CA 1Q20A 1LBEA 2DWCA 2I55A 4UVHA 4ZVUA 1BWPA 4FHFA 4R8KA 2GS9A 1MGPA 2FQQA 5B6JA 2WG1A 2D6FA 1DFGA 2IK8A 1VSUA 2GEBA 3CPSA 3N76A 4IDNA 1JG6A 3L1VA 1X87A 3CLVA 5CM8B 3W5BA 2HIHA 9MHTA 1K63A 2RK6A 3QWBA 1FF9A 1E6KA 4ICIA 4R2XA 4R31A 3GP8A 1FLDA 2BTQB 3CJQA 4MEBA 2ZRCA 1UK9A 2FFBA 3U7JA 1A1VA 4LE1A 4RK0A 1AKNA 3NTOA 2WYVA 3F7NA 2D54A 2CYBA 4M87A 2G76A 1DRVA 2W2KA 4IGAA 3V8BA 3FWHA 5AQEA 1WHSA 2F9LA 3DVRX 2OBNA 3ZDCA 2PHZA 5FYDA 1KQ3A 4IW3B 3NORA 2JIZA 4B40A 3E2PA 3LLSA 4ZRMA 5CX4A 1UH5A 3LD9A 1FMLA 4JBWA 1O8CA 3SE0A 2Y27A 3PNQA 1K3TA 2XA9A 3WLSA 2IP1A 2X2FA 1WS6A 2DBVO 2L0XA 4QFDA 5EIFA 4YP6A 1CFJA 1BXRA 2W6PA 3TL2A 1VLVA 4WNCA 3V7FA 1SVIA 5L45A 2UU9B 5CCEA 4ZVPA 2NOAA 4Z54A 4KK4A 5GV7A 3JQBA 3RSQA 4O4IB 1ZVKA 3HZRA 4HH0A 4D3ZA 5ELLA 1F2UA 1IU9A 4BDTA 1E9VA 3R3HA 1C2YA 3PC8A 1U8UA 2Q9UA 1XXHE 3VAAA 3P2IA 3VNRA 4BRWA 3NDRA 4EWLA 1K6EA 1QQ7A 4MVJA 4E6EA 1W8DA 1W36D 1JF8A 1PS9A 1HDGO 4KDFA 3G79A 3G8AA 4BV3A 3ANMA 2DUWA 1SVWA 2O2YA 3M6IA 3NG1A 4KI0A 3WFZA 1NC3A 1G5HA 3V6MA 1C0IA 3FKJA 4DF3A 1W0JD 2F90A 4LZWA 3D6MA 1M6EX 4ZAXA 4DCGA 4WBNF 4AW9A 1XF1A 1V9LA 2P1DA 2RH5A 3VHRA 4BO9A 1N2JA 1V41E 2ZJ1A 5H70A 2Y9MB 3E9CA 4FBLA 3T1NA 3KCQA 1XZGA 3JU3A 1BS9A 1XRPA 1R5OA 3Q12A 3T9CA 1PLLA 1ZM7A 1KQGA 1RYFA 3T4PA 4W9NC 2FR0A 3L8FA 4AQDA 2ZETA 4M46A 1NZFA 2AQKA 2XMPA 1Y3BE 2YFHA 4X20B 4EQZA 4JVNA 1PJSA 5DCLA 1AGYA 1LF5A 4TYMA 4BMSA 1NHGA 1LLDA 2H48A 3FVTA 2HCFA 4AN0A 3R9KA 2WP0A 1EDDA 4ZAWA 4I1OA 3AEKB 1NYTA 1R6VA 3EXG2 1ZH8A 4IOLA 4ZRDA 3PIDA 2E7ZA 3D0KA 3KPUA 1CR4A 4B9AA 5ALVA 2ZJ3A 4K6OA 2WAXA 2AZMA 2WMNB 1U2DC 1DXOA 2YYSA 3F2IA 5HJ7A 4CQJA 2F1JA 4HVTA 1H94A 4XYMA 3W6PA 1Z39A 3UK6A 2GXAA 3LHFA 2QE6A 1FDTA 4TS9A 3TO5A 3HN2A 2ILVA 3AUXA 2FUKA 1W7AA 1UBGA 1T29A 2H5LA 1SZPA 1GL6A 3IUSA 3K0HA 4UUAA 2RK4A 3IPRA 2RHBA 3QE3A 1T9CA 3RRBA 3V8RA 1A9XB 1V43A 2BEUA 1ILEA 2UZ4A 4TV8A 5DCWA 3TUJC 2CSXA 3INGA 4CHGA 4B82A 3DHWC 4PC7A 4GI5A 4ZIRB 2V6IA 1JKXA 1L7QA 3RKUA 4EK9A 1E62A 3IXLA 3EPPA 5P8WA 5KMGA 1PW5A 2OILA 3C1TA 4NCIA 3EODA 3TQRA 1Z2EA 2GPBA 2QLBA 3EC2A 1R0ZA 4E2FA 1WUIS 5JE8A 5LYJA 4W9MC 4ESVA 1H6DA 4NV3A 5D01A 1OLSA 2HU5A 2UYHA 3SGLA 4KEAA 4G23A 4JJGA 5TS3A 4MMZB 3UOWA 4N7RA 3TM4A 5GONF 3RS7A 5H02A 3SBOA 2H7YA 1NBHA 2IU4A 4O4JA 5ALGA 3T12A 3LQ4A 1VLJA 1U80A 2BZGA 2WKPA 2VJNA 4HP8A 3OZFA 3ODPA 3LRTA 4OMDA 4W63A 1OI3A 1YS1X 2IYEA 3CVJA 1Y3HA 3G49A 5DWQA 5F64A 4ZZ2A 4BC0A 4Y98A 1MH9A 4CYMA 1XCBA 4W5RA 3RREA 1TDJA 1TLTA 2PQ0A 2A9KA 3FX2A 2PQMA 1QH8A 3HPRA 2NXNA 4UEOA 1QR6A 3S68A 4E5PA 3E2MA 1C9MA 3IKVA 3JQ7B 2IEZA 4P5PA 4R83A 2ZSBA 1BC5A 5JAHA 4EITA 4RZ3A 1FFXA 1NURA 1EEXB 1DBQA 4Q3CA 4UOEA 4PZUA 3C4JA 1WPGA 4WACA 1YRLA 2GA9A 1TRHA 2IBMA 3T9BA 1CIVA 2NPFA 1XD8A 3UJCA 4JB0A 3FMIA 3VTKA 4YCCA 4JN6B 3WGQA 1M34A 1NLZA 1Q0TA 3FCYA 1KZ7B 3LCJA 3PDCA 5KYGA 4IXTA 4WAUA 2IEYA 5ELMA 2AUNA 3OH8A 4HSGA 1PTJA 1Z6YA 1D2MA 2CFTA 2IXTA 3TE6A 2HCTA 4DT1B 2YWFA 1MQAA 1OZHA 3RR2A 3W3AD 3L41A 2ZAGA 3DF9A 1YB4A 1CEXA 3PF9A 2QWXA 1IBMB 4I6JA 4CVNA 1QV7A 4XOIA 2O8EA 1CULC 1JDVA 3A4TA 3LBHA 5EXSA 1N7JA 2JFVA 4UAVA 4PLZA 2YDYA 3DDCA 1BDIA 5KQMA 4BO5A 3EQ9A 5KX5B 1IY0A 4YY3B 2ZYVX 3ASVA 4B7UA 5JR3A 1IHYA 1DWPA 4GPEA 4N5HX 4UPVA 3T4EA 4G5QA 4YJKA 1UXKA 1J8YF 3E5HA 3RS9A 3WGMA 2EW8A 2GI4A 2J41A 2CB0A 1B3BA 2YV1A 4TRJA 3TLXA 4DRXB 5EJ9A 5L3SB 4ZP1A 1U7HA 2CFOA 4NZMA 3TZQA 4NESA 1P9WA 3D1VA 1UJ2A 4WCFB 3LT1A 3VZQA 4V0RA 4UVEA 2BR3A 3EJWA 4KAAA 2Q8NA 3DWIA 4GPIB 1QJCA 1LVHA 1K7EB 2FMFA 5K0BA 2R6DA 3TECE 3BA6A 5ICMA 1X2BA 4UVIA 2DFVA 4O4HB 4CMJA 1KL7A 3EG9A 3BT7A 1IATA 1BWQA 4TMTA 4IHJB 1CUDA 1ISGA 1X7YA 5DM4A 5AM4A 5FPPA 5L6MB 4OJQA 4DTCA 2ZKLA 1I0ZA 1ZN2A 3A32A 4C0LA 4KMMA 1QH0A 1XZLA 3UK0A 1KAEA 4NK5A 4KWTA 4L5BA 2WSYB 3D8NA 4HF7A 1C7FA 3SI7A 4M1QA 3H8JA 2C77A 4O2AA 2H00A 1IONA 2DULA 3OCUA 1YBFA 2Z83A 3EVAA 3O8BA 1V6AA 1D03A 1MAAA 3FCUB 1Z4IA 3R24A 4BNHA 5K3CA 4E4TA 5BSEA 1BYUA 1UDXA 2QRVA 2WIAA 2MSLA 2GAOA 3RADC 2ZSFA 5EJ6A 1JFSA 1DKRA 4ZMRA 4H4CA 1CQIA 5B5SA 5BPHA 4CM1A 3H6KA 5FOXA 4PNPA 4PYQA 1X80A 5DTMA 2WHRA 3VR3A 2XR1A 2Y77A 4NBRA 3ZV7A 3AH8A 4FINA 2JL1A 5AKKA 5BVGB 3OIFA 2IHYA 4XGNA 1WDMA 4ITUA 3IIEA 1RZVA 5LXTA 4GQBA 1RFLA 3N0RA 4FDTA 1W6UA 2E21A 4A6EA 4DMCA 4CQLB 3B2EA 2I8LA 2A6PA 3SJ7A 3TDNA 4EDHA 1GGFA 1L7RA 1W9MA 3KSUA 3ZXUB 1WSAA 2KS6A 4BQFA 4ZQHA 2H1OA 2PT5A 1AMOA 3IMEA 1TK9A 2NZUG 3AIKA 1NYRA 3KXIA 1IHXA 3WRXA 4UTOA 3JYNA 3S2ZA 4HKTA 2EQAA 5C1BA 2JZOA 2WOOA 2UVPB 4MGYR 1QVWA 1VPVA 5CDGA 2DH6A 1L8QA 4JC4A 5T4FA 3W9SA 2EDAA 4WCFC 3W9UA 3VJRA 1TMYA 3FPJA 3REOA 4NCAA 3AI1A 3IB6A 5FF9A 1UPXA 1QNLA 3QA3E 4Y1RA 2YL2A 5FR1A 4MCHA 2KSQA 4YRGA 3CPEA 4GGMX 3V4ZA 5A5GA 4RZHA 4N3AA 4HSEA 4E94A 3LDUA 1IVSA 2VJBA 4YLYA 3K0CC 2A5JA 4LW8A 1XTZA 1F8GA 3IT2A 5IP5A 2H54A 3T61A 5CVVA 3I5XA 2W6IA 3WGTA 2PXXA 4WIAA 1QLJA 4IM7A 1P9NA 1RWNA 3IIJA 4JVLA 1IOVA 4MV3A 3V8QA 4CLOB 4RK1A 2ZDQA 3GIWA 2Z2IA 4IVPA 5ALUA 2OQ2A 1U1FA 1LPNA 4QYWA 3WIBA 4F4FA 3H4VA 1IK4A 1SJ9A 1E5LA 1G8YA 2JJ2D 3DFUA 3KVYA 3PRJA 4LGCA 5EWMB 2JAHA 2PJUA 3AR3A 5BV7A 4MGKR 5JEEA 3HY3A 2FZWA 3LC1O 3JATB 1MD9A 4FFSA 2GLUA 2P78A 3AJ8A 4UCFA 3CO0S 1OF1A 2NT4A 2QTHA 1O94A 2AXPA 3EW7A 3QU2A 1CX9B 4W1RA 4LYYA 3TOZA 3Q88A 4A23A 3K9WA 4WZAA 3TNYA 2IIVA 3UFXA 2C5FA 3N2IA 4ZOLB 1H85A 1P7YA 1T3LA 1WIWA 2H0QA 4ZREA 1JDSA 1T9GS 1V9CA 2P2DA 1EEHA 1N33B 2W2VA 2ZWIA 4HDSB 4EJFA 5JYDA 3U0VA 3HBNA 1BDHA 5JSQA 4XZ3A 1RC0A 1VMIA 2PUDA 2V6BA 2WT9A 3AKEA 3H05A 3PGA1 4LNAA 5EINA 3L6CA 3OTOB 4DMRA 2AZXA 3BJMA 3GNLA 3FPHA 4K9PA 4LRWA 1ZXLA 2QMOA 2WJVA 3B36A 2V7QA 1FMCA 1RWXA 1T5SA 3H8SA 4P9NA 1JAIA 2C8VA 3LF2A 4RAQA 4REMA 3C3JA 5BSTA 2QI9F 5BXYA 2Z0MA 5LDGA 5IJ9B 2QX8A 2QPOA 3NWEA 5HS6A 3TEMA 5BPFA 1Q1NA 2OGSA 1KYZA 1SKYB 1Y63A 3F2VA 3RS3A 4KAFA 5ALOA 4CI9A 4CXMA 1WQ4A 3EYAA 4U39A 3FBWA 1W8IA 2QAGC 2JARA 1S96A 1WJGA 3NKFA 1F0PA 4RVUA 3VM6A 3H2ZA 1A76A 2HMUA 4BO2A 1KI2A 1GPH1 2G40A 4H7IA 4UDOA 3A0RB 3H2KA 2C3UA 4HDOB 3TJZA 3DEZA 4J6FA 4C03A 1T36A 3C0KA 1HOXA 1GL9B 5BQ5A 4BNUA 4RTKA 3DXXA 3KQYA 3L8ZA 1O77A 2JLQA 2WJ4A 2ZI9A 1NF3A 1YVRA 3VZBA 1T3ZA 3IOEA 3ZWAA 4HB0A 4K6HA 5JBNA 2YZGA 3PT9A 1AY0A 1KJQA 2A5YB 3B60A 4NNPA 4AKSA 1E9RA 5KHAA 1KYXA 1EGQA 1JZQA 4FGKA 4J91A 4OPMA 5CA1F 4TZ0A 1SB8A 2ADFA 4MQBA 4X93A 3KVVA 4M9ZA 3U7QB 4XIFA 4PG7A 4XM1A 5H4HA 2ZYWX 1JB9A 4FT4A 1P80A 1PR2A 4HWPA 3QLVC 3NONA 2VQFB 5JZSA 5EE0A 3KEGA 4W7SA 4ZVOA 1ECLA 2NVWA 4QWWA 3JARB 3ZV4A 4DZZA 2R7KA 1RYYA 4ENQA 1M1XB 5D6OA 3R0IA 2RGEA 3ZE8A 1UP7A 2W00A 1KYWA 4U2EA 2QL9A 3QU5A 4BNMA 1DPFA 2GPWA 3DS8A 3DLCA 2Q27A 1UT8A 1HMPA 2Q4OA 1K7FB 2Q4EA 1ZWLA 4UXIA 1AB6A 4YQZA 4YASA 3VYSB 4AF7A 4NH0A 2LIPA 3IR7A 5CCBA 1W0CA 2D13A 1NXVA 2Y1LA 1L4HA 2FEXA 3H1GA 4MW5A 4S1OA 3MNFA 1I2CA 4WY2A 3H3JA 4DSUA 1W87A 4EB0A 1C9DB 1F1BA 2CVZA 2NUAB 1ZNXA 3BH0A 5ALQA 3VDNB 1YR9A 5BN1A 2P79A 4KTVE 3QXSA 1IK6A 1CDOA 1RTTA 1SUIA 3AY3A 1T5DX 3OPNA 1DJNA 4RPKA 2JGAA 1TMOA 1WY7A 2JCGA 3B6EA 1P1RA 1XZHA 3MJDA 3WYFA 2CWDA 3JTEA 3I2YX 4Q1AA 2PWPA 5ILGA 4BFWA 1SAYA 5TRTA 5F2OA 3JQRA 3H11A 2GN8A 3PNYA 3UANA 3AVPA 4UFNA 3KKOA 3C8ZA 1TIPA 2VSNA 2Z5LA 4GRDA 1COWA 3WNCA 4E6PA 5IG2A 2FMIA 1WMFA 1X13A 2P9EA 2WPDA 4NE2A 4V02A 4PQEA 3JASB 1ES9A 3T9FA 1P0IA 2AKYA 1XTTA 1A8PA 1QAMA 3OIUA 2YFQA 1VSVA 4KNVA 3K1TA 4WECA 4XE5A 2P6NA 5L3ZA 1POWA 1PUIA 4IQGA 3S7ZA 4BEVA 4F3TA 4KHPB 2H07A 3LVRE 3N6VA 4IH4A 4OHKA 1G0OA 1YCHA 3CY6A 4G0NA 3M5DA 4BNIA 2JJ1A 1DXQA 3BXOA 4AWAA 2F8LA 1NP7A 2J7PD 1HE5A 2J3EA 3O90A 1JV2B 3Q85A 1OXKB 1O95C 5ADUS 1J1UA 4B5LA 1IM5A 2QMZA 1SXQA 3AM1A 4X00A 3I6BA 2BEVB 3PE6A 4GOJA 1ADJA 2IDZA 3I76A 4JDUA 2EHDA 4XUEA 4LV5B 4D3XA 2JFBA 2XRMA 1Z15A 3DQPA 4W5OA 5CIWA 4RC9A 2YJNA 4EY6A 1WL8A 4H3KB 3EZ9A 5ALLA 1ORDA 5EMJA 1EP2B 1ZGHA 3JQGA 3Q9SA 1MB4A 1WZCA 3GXOA 3FUXA 4WXYB 1CUZA 3VGPA 4R2IA 3ZX5A 2UYYA 3HA2A 3N8NA 1ULZA 3MA0A 4KDEA 3TW6A 4AM8A 5IK2D 1J9ZA 1OZ0A 4ZMSA 2XVMA 1J33A 5FL7A 1RBZA 3O95A 5IPFA 1HLDA 2PXHA 5B3LA 4PQGA 4KW7A 4ZD6A 3QEJA 3D8RA 4CEHA 1QONA 1Z47A 2JFYA 3IUPA 4J4BA 1OH8A 4GM1A 3SK0A 1E9DA 2BEKA 2PCLA 2VF5X 4GL4A 1KI7A 3BB1A 4M9CA 3B5IA 3WL6A 2WZDA 3I2IA 2ESRA 1NVFA 3PCTA 5JRZA 2R3SA 4YI3A 5IT0A 1T6XA 3T1VA 3PQ6A 5AK3A 5KBYA 4W5HA 5JO9A 1CW2B 3QVKA 3ZHZA 1PR4A 4E1AA 5DHFA 4JJAA 3OCJA 5HOEA 1R4AA 3GEIA 3QG1A 5AVVA 5K4HA 1EVEA 1TZ2A 2VATA 2QD4A 3PUKA 2BKXA 3FKSD 4GI3A 2I4IA 4M1KA 1RS0A 4TWIA 3U4QA 4IMJB 5JYCA 4TKLA 3EZXA 5I7WA 1RIFA 4D9IA 3DPUA 3LXMA 2QG4A 4G24A 1PKEA 4AQ7A 4FC6A 1FXWF 2HIAA 3KXLA 4MV1A 4M1MA 2E4YA 2DF8A 1IMOA 4IS2A 2WY2D 4NABA 2SECE 2JLYA 1J90A 2CEKA 2FWPA 3D7RA 2FSGA 3WL4A 2NUPA 1GRVA 4UNNA 3UG7A 1DAEA 4R1QA 4P3PA 4DGSA 1E32A 1VB3A 4II3A 2H63A 4JUAA 5CHYA 4R0VA 3C5EA 3O75A 4M7PA 5D3MA 3WLNA 4BAGA 4DCVA 3EXHA 2I9PA 2DHQA 2XB2A 1IY9A 1XRRA 4K0KB 3HK2A 1NG9A 2PUEA 1T2VA 4YYEA 4DV0B 3P4XA 1RQNA 4O2RA 5CW1A 3A1EA 4HPXB 1IM2A 4LYAA 4QDTA 1UMBB 1EFVA 2G77B 3ENQA 1M74A 2ZJZA 3QKWA 3SVLA 4RSHA 5JSZB 1FA9A 3ZHOA 3UMFA 2ANCA 5A6VA 3UJ7A 3IPCA 4NICA 1K7SN 2CVFA 3MQ4A 2OHOA 3O9VA 4G4GA 4YONB 3VR4H 1FFCA 3O8LA 4HUJA 2BCGY 2X0RA 2CLCX 3IMKA 3PI6A 4KVFA 4JENA 3TSZA 4YIHA 3NHLA 4ABYA 4B6FA 3Q0IA 2BEWA 4JOSA 4L2IB 3ZGVA 2HEIA 1N2CE 4K9LA 3W6NA 4ZYLA 2GHTA 1X1QA 5DCUA 3SF8A 3W4IA 3ZQKA 4KQ6A 1L4UA 5KSZA 1YAHA 2WTNA 1IWPB 2A92A 2R6ZA 3PDIA 1GPLA 3RSOA 1JL3A 1CUUA 2AQ8A 2BFPA 3BMNB 2RARA 3OO1A 2R0QC 3BSWA 5H83A 3TZCA 3ZD6A 3WKAA 1Z0FA 1L5WA 1A97A 2PN1A 5D8DA 4F2HA 1XU4A 1U3CA 4GECA 2G1JA 4V39A 5IDYA 4Z0PA 2COEA 4A6PA 3CVUA 2ZWOA 5HRCA 4B3RB 3K70B 3VZCA 1M2KA 1UFVA 2VCHA 3LHKA 3OQHA 4EG8A 4QTYA 5DHAA 2A1UB 3EULA 3O21A 3O2QB 1P74A 1AKQA 4I4LA 2PUHA 3RYCA 4MVYA 2GK6A 1VKRA 3HKEA 2GCGA 3I72A 2Z9BA 3NHSA 3NIFB 4MKXA 1CS0B 3IXMA 4A36A 4UKDA 3FIUA 1JR6A 1HKUA 4UHDA 3OKAA 1N6HA 3DKVA 5T67A 2MSWA 3DMFA 1CSEE 1TZBA 2QIOA 3ICOA 1E1CB 1YRBA 3T1OA 2ODWA 5AW4A 1ZIOA 3SC3A 5J3JA 5CH8A 4NZYA 4RCVA 1N2OA 5LZ2A 1K66A 5KX5F 4MKZA 2BM1A 4BUZA 3KJGA 5HA5A 1Q50A 3GFQA 4JIGA 3QMVA 1C8LA 4PAWA 2O0MA 1PHRA 2P3OA 4FFOA 4YXFA 1XK7A 4Q9NA 3BWYA 5D84A 4HBZA 4NTZA 1RJDA 4AJKA 2NUBA 4PFJA 4CUKA 4EH1A 1TOAA 3O83A 4LJ4A 4JI8B 3ZU5A 3DO8A 4L8GA 3TW4A 1MHPA 1VDMA 2JD2A 2YVAA 3L1IA 1IL0A 1GQQA 1C4OA 1PJRA 2VLBA 1JXAA 1IMJA 1PWHA 1ACMA 4YRLA 3AL2A 3IIIA 5ANRB 4BBJA 4CN8A 5AW8A 1M2VA 1DBWA 2EW1A 4DLZA 3KQHA 4H77A 5GP1A 1YS7A 2BFAA 1GKIA 3FMVA 4X8LA 2X1HA 4CKEA 1HYEA 3PUXA 1Q5PA 2GCOB 1VZ3A 4RH3A 1NZJA 3SQLA 1YHZA 4AAYA 1KIMA 5F35A 3CO5A 3SU8A 1BN7A 2VP9A 2XGMA 1V16B 5L95A 4DVJA 3OZEA 4WDQA 2QN3A 4PLTA 1QORA 2KW5A 3PQ4A 4GD3Q 2GZHA 1N1EA 1FUYB 3ZLTA 4KC0A 4M0LA 1Y8CA 1NUAA 3MWKA 4BS9A 1QHFA 2MTBA 1TA0A 5EHGA 2CN1A 2RH8A 2WWFA 2DU8A 7REQB 4IOMA 3DFKA 5E3HA 4CM8A 4RVGA 5AVZA 2J30A 5D3KA 8AT1A 3ZHYA 3DOOA 3BN3A 4JROA 1QHHA 2FPLA 5F1KA 2B4AA 1KDTA 2V1XA 1EK6A 4XGKA 3ZG6A 5FAXA 2HBRA 3OCVA 5KVSA 1QGOA 1ZJ4A 2NADA 4DBLC 1E7QA 3CUWA 1FP6A 3C6QA 5K8UA 3EEIA 2GJSA 1V4BA 3JYLA 1QFXA 2ZB3A 1WMEA 1XHLA 1QHYA 3BORA 1LBQA 1GWNA 4NBNA 2VA9A 4OYRA 2J31A 1I24A 4BU1A 2EFGA 4JLAA 4OIMA 4C9BA 1KH1A 1REQB 1C4XA 1P75A 3DMGA 4RIEA 4UC0A 5AI4A 4A2CA 3EWSA 4GYJA 4MDHA 4UOQA 3HY4A 4EPTA 4F4JA 1W4LA 1D5WA 2I6FA 4II2A 5GOZA 3EZ7A 4OSEA 4XGIA 2HK7A 2DSNA 3ORFA 4BP1A 4K3VA 2Y1OA 2IH2A 4W99A 1KBQA 1WM1A 2D4HA 1ZBDA 3OZUA 1MAWA 4KN9S 1OJLA 2Y0DA 1R6TA 3DMTA 4FYVA 1GILA 2FR1A 2JEOA 2ZPUA 4KBGA 5J4KA 1VL2A 4A0RA 1G1AA 1NR7A 3LOUA 5B3AA 3PK0A 4YV7A 3ANYB 1I7SB 4WLUA 5IVHA 2AXEA 4R40A 1UBTS 1X3SA 3ZHQA 1EFTA 1HV8A 2F1IA 2LXNA 3GFTA 4MR7B 4EUSA 3K35A 1RADA 1U2TA 3LMKA 3PWZA 2BMWA 4A73A 3L49A 4I4CA 1ZFNA 1JJFA 3TRFA 3DGFC 4P98A 2DR2A 3B3GA 4ZCIA 3EGVA 1YL7A 2WHEA 1YRHA 3IBCA 1RPTA 2PBZA 3BFKA 5DK4A 3G2LA 4RHUA 2RH9B 2V7XA 3DOUA 4V0SA 2H3EA 2R7LA 5KYXB 1E6CA 2KWIA 1YVEI 1A7JA 2IY8A 4MB2A 3VNUA 1YQQA 2XNCA 2C59A 1HPLA 3DR3A 3RM3A 5JAIA 4K1XA 4L7QA 4HLDA 1DZ3A 1QIKA 1G4UR 1WW8A 2HBYA 2V45A 2XD9A 4JMPA 4Z0NA 1N9KA 3PC2A 2ZYAA 4XIYA 3NNNA 4N4AA 2IDJA 4CNBA 3QELA 4KFRA 5D5PA 1IAQA 2JBHA 4W6QA 2QY6A 3T1HB 1Y48E 1YT5A 2C3MA 3HR4A 4FOOA 4G1UC 1Y98A 2FZ5A 2IYYA 4O4LB 1JFLA 4R3NA 5EE1A 4BB6A 2PH3A 1BKDR 5KNCH 2JLWA 2B8EA 4L8YA 1XEAA 5U4XA 3L8CA 2CEAA 2O1EA 3BH7A 3CWCA 4YGYA 3STHA 2I33A 3LBYA 3EXEB 1SA0A 3WMWA 5C35A 2FR8A 1T13A 1HBJA 4ZOLF 3X1MA 5FBKA 2BTOA 1YIAA 4CL3A 5LP6A 2PGOA 1A5BB 1OXMA 5AM5A 1WB9A 1TQ4A 4B76A 2IWRA 1FIUA 1XTQA 2X2OA 4LJAA 3B8HA 5CXUA 1MR3F 3OQ6A 3THOA 1UZMA 3K96A 1EP9A 3GUCA 2YJ6A 2ZATA 2BFBA 3N2KA 3OPYA 1DUVG 3MQ2A 4IP0A 3UBMA 2FPMA 4EYQA 4ZN6A 4PZAA 2NGRA 5E1BA 5CK5A 4EENA 4XQ0A 3MJRA 2B21A 1XRSB 3CNBA 1ZUWA 4NIMA 4Z8YA 1VPLA 3GJQA 2VZLA 3JXEA 2ZRPA 4PYNA 2YWBA 1RYEA 3AY7A 4Q4JA 2HHJA 4F8YA 3ZIAA 4HXFB 3R3SA 4ZOEA 1QHIA 4HS9A 3W9YA 3N3AC 5B4VA 3AF1A 1MX5A 3TGWA 2WT8A 1JHAA 2V98A 2W4IA 1SXIA 4GPAA 5EIEA 3E15A 5FUVA 3UHPA 1NXPA 3C3AA 1QIMA 3RHSA 3DNMA 2YMMA 1JBQA 1MPTA 3HBLA 4JV5B 3G2JA 4L75A 4MYSA 1JGTA 1OIXA 2WHPB 2Z43A 2UV8A 4H60A 1G2QA 3WK8A 5FT9A 4M7WA 3HC7A 1ECJA 4LTMA 4CEJA 1EZ1A 4HPWA 2WU0A 4Y2JA 2IUFA 2UZAA 4DLUA 4LJRA 2P65A 3ANNA 3P9NA 1N6OA 3ZUGA 4Y0VA 4HBGA 2WJHA 1VHJA 5JV5A 2REOA 1P2DA 3GXBA 1CQXA 3WLRA 2NU7B 5FNVA 1GTVA 2Q50A 2IW3A 2HTFA 4XCQA 1M1YB 3NHKA 2QW0X 4JC5A 4BFUA 2Q8QA 4B71A 1ND6A 4TYPA 2ZZNA 4UD2A 1D1SA 4PC1A 3RYIB 1U8FO 2H6EA 5EVCA 3RNLA 3L8DA 4GU5A 3PD1A 1PJCA 5DRYA 3WYNA 1CQPA 4K9MA 3QVUA 2DUMA 3O84A 2BGMA 2OCKA 4QUJA 4U2BA 3R8FA 2XXJA 3D64A 2NACA 4QUIA 2WTXA 4L4ZA 4TSFA 4U2KA 3UUWA 4BNGA 1F6BA 4ZDKA 3S29A 2A9FA 4KPUB 2OE2A 1JTVA 5DTEA 1JR2A 3QIVA 1I9CA 2P4HX 2J6CA 5D87A 1OI2A 2VPXA 3NFYA 3CT4A 3IPLA 1AX9A 2P5UA 1E1RA 1M0TA 3MCAA 5BV1A 1D6MA 4M1ZA 4IL5A 2W0MA 4Z0HO 4QVKA 2A9VA 1H0HA 3BA1A 2KPOA 5DSXA 3KHTA 3RVSA 2IU3A 3UQYS 1WB6A 1C0EA 3PQ2A 5H80A 5IF3A 4LXUA 1M2EA 1BFKA 5J2UA 2VPIA 3E27A 2Z3WA 1GUFA 1F48A 2DJ5A 1T9HA 2R5NA 1FDIA 4FNOA 5K3AA 1I8TA 4ZQFA 2D2FA 3EHEA 4HB4A 3TL6A 5B3KA 1B7GO 4AZ3A 2EJCA 2X15A 1LY1A 1VE9A 2DBZA 2QM0A 2C7RA 1QJ4A 4FZVA 4P8RA 4HVCA 1PG5A 3IBYA 3QLUC 2V59A 2QZPA 6REQB 3ZDYB 3N8HA 2E18A 5KOHA 1XZNA 4Q3LA 4AF8A 4PXYA 4JWKA 4G85A 2QL5A 2E49A 5AVRA 3JZAA 5ALFA 4OQLA 3MWYW 4B1FA 4BXOB 3WWOA 1I6WA 2GPSA