5C3MA

Crystal structure of gan4c, a gh4 6-phospho-glucosidase from geobacillus stearothermophilus
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
434
structure length
410
Chain Sequence
LKMATIGGGSSYTPELVEGLIKRYHELPVGELWLVDIPEGKEKLEIVGALAKRMVEKAGVPIEIHLTLDRRRALEGADFVTTQFRVGGLEARAKDERIPLKYGVIGQETNGPGGLFKGLRTIPVILDIIRDMEELCPDAWLINFTNPAGMVTEAVLRYTKQEKVVGLCNVPIGMRMGVAKLLGVDADRVHIDFAGLNHMVFGLHVYLDGVEVTEKVIDLVAHPLGWEPDFLKGLKVLPCPYHRYYYQTDKMLAEELEAAKTKGTRAEVVQQLEKELFELYKDPGGAYYSDAACSLISSIYNDKRDIQPVNTRNNGAIASIPPESAVEVNCVITKDGPKPIAVGDLPVAVRGLVQQIKSFERVAAEAAVTGDYQTALVAMTINPLVPSDTIAKQMLDEMLEAHKEHLPQFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative 6-phospho-beta-glucosidase
publication title Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus
rcsb
source organism Geobacillus stearothermophilus
total genus 138
structure length 410
sequence length 434
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.86: 6-phospho-beta-glucosidase.
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02056 Glyco_hydro_4 Family 4 glycosyl hydrolase
A PF11975 Glyco_hydro_4C Family 4 glycosyl hydrolase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5c3mA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5c3mA02
4WECA 4E31A 2H63A 3WG9A 1T1RA 4TKLA 1Y5RA 4ZQEA 3OJEA 5CP8A 4CPDA 4IDAA 1QR6A 3GZNA 3FNGA 4DMMA 1ONOA 4OQZA 3I9KA 4WLFA 3CEAA 2FRDA 4IQ8A 2CVQA 1LEHA 3CTMA 4TSKA 1QYXA 1PL6A 1O6ZA 1Q7CA 5JAQA 3TDKA 5IZ4A 2PKQP 5KOIA 1VL0A 3NAQA 3OECA 3FN4A 3UAGA 1T2CA 3P19A 5KJFA 1VPDA 3L9XA 1DAPA 1DHRA 3C8MA 4IUYA 3UGKA 5A03A 4RVUA 1R4NB 4FFOA 1DFGA 3INRA 1PTJA 1MLDA 1ZSVA 3W8FA 5CPFA 4P8RA 2NQ8A 3DHEA 2CVZA 1JW9B 4L76A 1VL6A 3Q9UA 4BQRA 2QZ9A 2ZCUA 3ADPA 4NJMB 2W2KB 4YA6A 3I23A 4E13A 3ULKA 2NVUA 3ANNA 4EBFA 1HKUA 3RUAA 1GYPA 3BHIA 4ALNA 1VM6A 1ZK1A 1IPFA 1FDVA 2OL4A 3PWSA 4J0EA 4NFHA 3UVEA 2DBZA 3L6EA 3R1IA 3PYXA 2SCUA 3OSUA 5I7SA 3WGGA 5AYVA 1ENYA 4AJEA 2J3JA 2X0IA 3QRWA 1O8CA 3JTMA 3C1OA 3QQPA 4B8WA 4BO5A 2ZQZA 3PI7A 2JFFA 4CMJA 3ONFA 5BSHA 4J1NA 5JNLA 2D1YA 2E6UX 4ID9A 3VVCA 4E21A 3DMYA 3Q2IA 5A5FA 4AJ2A 1FDSA 2CF6A 1S7CA 3AM5A 7MDHA 4BMNA 2QRLA 4WK6A 1XQ1A 1Z82A 4XGIA 4BO0A 1LDNA 2GASA 4U0JA 5HWSA 3BMNB 2O3RA 1V9LA 4HV4A 1YBVA 5JY6A 1Q7BA 3O9ZA 5TJ9A 5JSFA 3MOGA 1VRWA 3RUEA 3PGJA 3DTTA 3EDMA 2ZJ0A 4PG6A 4J49A 4ALIA 4CV3A 4D3SA 4WLOA 4CL3A 1ZUD1 2E4AA 3DL2A 1H5QA 1JLLA 1MFPA 1QKIA 4BVAA 4I5FA 2H5LA 2VHXA 2P9GA 4M89A 4CM8A 3EC7A 2D0IA 2DBQA 1VJTA 3PHJA 5IJZA 1NWCA 2XOXA 1NVGA 3FNEA 1XELA 3NX4A 4D44A 1DBVO 2CNBA 5CDUA 2A9FA 3WQQA 2EG9A 3ROKA 1PJLA 3BMOA 2A92A 4MVJP 4OSPA 3L07A 4EEXA 3UKOA 1N7GA 4WGGA 3GF4A 4TRRA 2YHIB 2GNAA 1P1JA 3I3OA 4QQRA 4YJGA 5L53A 3CXRA 4FOSA 2Y1GA 4HUJA 3C7DB 5CPBA 1R4MB 2AQIA 3V1TC 4JNKA 4R68A 4S3MA 1LDMA 2BGKA 2E48A 1D1TA 1YH3A 4B3HA 1DIHA 2DTDA 4D3DA 2DQ4A 2HU2A 3BMQB 1DB3A 2Q3EA 3RJ9A 3QV1A 3OA0A 1BMDA 1PWZA 4AJPA 4B4OA 1B3RA 1KVQA 4BO1A 4E5MA 1E3LA 3L6OO 4E2WA 4AJ4A 2X6TA 5JYEA 3SJUA 2LDXA 1V35A 4IQGA 1I30A 1YJ8A 3VTZA 1KVRA 2NNLD 3ZWPA 1NHWA 1HYEA 3OJLA 4Y6SA 2I3GA 4NJMA 3UFXA 5KVVA 4J0FA 4XEHA 3AM4A 4DIOA 2W2KA 1ORRA 4FC7A 4IIVA 4Y98A 4MP6A 4R51A 3IMFA 3GZ4A 4PZCA 1Y6JA 4LK3A 5DF1A 2JKVA 1PGOA 4D45A 3I9NA 4ZQFA 5EMHA 4IGEA 2P68A 3ZZNA 1WVGA 1PGJA 4R01A 3JQ7B 4IJVA 3KETA 4R1NA 1FF9A 3H65A 3QWFA 4LSWA 1QYVA 4GLOA 4M8SA 1UXGA 5GMOA 4TQGA 4GMFA 3WMWA 4EI2A 2ZYGA 1UUFA 3VH3A 1GQ2A 5JW6A 2IODA 1UP4A 1N9GB 4CLRB 1F06A 5C37A 1QXSA 3QVOA 4KUGA 2DT5A 3WYCA 3DDNA 4WE3A 5JBIA 3GDGA 4NK4A 4CLDA 3A28A 4DUPA 3E9NA 2C82A 1I36A 4Q3DA 5U4QA 2PFGA 4J1QA 3JQAA 3GT0A 4BV8A 1QLJA 5EN4A 5AXAA 3PEFA 5JCXA 2B4QA 4I9NA 2FWMX 5FF9A 1C1DB 3BMNA 3COSA 4NH4A 3SC6A 3BTVA 2GN4A 5J23A 3UHAA 3C1TA 4GL4A 1YB4A 2ZB7A 1PZEA 4R3NA 2H9IA 2O4UX 3NV9A 3PHGA 4PGFA 3RSHA 2JCVA 4W4TA 4ALJA 1U7TA 1IE3A 2R2GA 1NTOA 3V2GA 1H93A 3W8EA 3HNPA 4J9VA 5DT9A 3WGQA 3W1VA 1IZ9A 2DFDA 4DMLA 1A71A 3UICA 4KTVE 1BGVA 4PLZA 5IXSA 1EUCA 2P2SA 3H9JA 3L4SO 2NVWA 2OBYA 4LRSB 4M54A 1BVUA 2PA3A 2I99A 3JQDA 3OF2A 1JTVA 4PLPA 3MJVA 5EINA 3ST7A 2LDBA 5G0TA 4R3WA 4CQMD 3LSYA 1BXKA 2D5AA 5B37A 1CJCA 4UVEA 4JLWA 4K9DA 1U1IA 4XIYA 3ABIA 3PYLA 1AUPA 2X7HA 1BXGA 1R4MA 3DONA 3M1AA 5KJ6A 3E18A 1X0VA 1VJ1A 4RDHA 1DC6A 4J6FA 2X0NA 4DIFA 1HDGO 1ZSYA 1GUZA 1PJSA 3AFNA 3VZSA 4UVIA 4WJZA 1AHHA 1IULA 2HUNA 3GDOA 1MC4A 2YFHA 4YT8A 4A26A 4XB2A 2ZYAA 4DC0A 3AU8A 4FGSA 3EAGA 2W90A 4QX6A 1HZJA 3ZWCA 4R1SA 4MPDA 4GBJA 3EUWA 4UEJA 4EEZA 1DC3A 1T24A 5ER9A 1JA9A 1D8AA 4Y6RA 1PU2A 4OIMA 2IYPA 2DKNA 4WCFA 4Y67A 5BNFA 1X14A 3DBHB 3K5PA 2BHLA 4MVJF 3ROMA 4RPHA 4MVJI 1LSJA 3I4FA 3B6ZA 1HT0A 4XYMA 1GCUA 2GF2A 4A10A 4I08A 1TA4A 3ZI0A 4XYBA 2I5PO 1IUKA 4BL5A 2QW8A 2GLXA 2AEJA 2I67A 2X4GA 4W7HA 3W4KA 1ZK3A 1OMOA 4ONEA 4WKGA 1LLCA 4OH1A 4BKRA 1N9GA 2ZB3A 1PS9A 4CLRA 2P4HX 1MXHA 2P4QA 1ISJA 3GN1A 4XKJA 3U0BA 4D3FA 1C3VA 4E12A 3QWAA 1YGYA 3BYZA 5KVQA 1Y81A 3OHSX 4U0KA 4ZRNA 1SB8A 1ZW1A 5MGBA 3ZU3A 4ALMA 4QECA 4GH5A 1VI2A 1ZNQO 2EWMA 2JCXA 3BTOA 1HDRA 2VHWA 4FS3A 5EESA 1L7EA 5JY1A 1WMAA 3T7CA 4RVDA 4YJFB 3BAZA 4RVSA 3KHUA 1C1DA 4XYGA 3H8VA 1U3UA 3Q3CA 4J4HA 4E0BA 2WE8A 4EUHA 2JHFA 3V8BA 3FF4A 1BHSA 2GN6A 1XSEA 1XWFA 1NASA 1A5ZA 4Q3NA 1P3DA 1CIVA 1A7KA 4W99A 4Z9FA 1WXDA 4Q3CA 3F4LA 3OIGA 1GY8A 1VKOA 3G1UA 3F6YA 3QHAA 3OH8A 1NP3A 3ZDFA 1SPXA 4FIZA 3AI1A 3WYEA 3CPSA 3PK0A 2NTNA 2CDBA 2V6FA 3L0DA 2YDXA 3FCOA 3FRJA 2X5KO 3PHHA 4GPD1 2ZTMA 4JK3A 4L4XA 4IZHA 4PRLA 4TKMA 3RVDA 2HDHA 3MJSA 1Z73A 5L95A 3JYLA 5K6AA 4BO8A 3GQVA 1NFRA 3ZGYA 3ASVA 3CINA 2YZ7A 4FSHA 3GVXA 1DHTA 3OETA 2BF7A 1XEAA 3AJRA 1QSGA 3FHLA 3TZHA 4YRBA 4XYLA 2Q2VA 4CUZA 1TB4A 1Y1PA 1K6IA 4RVFA 4IGFA 4MDHA 3WBBA 1SEPA 3VC7A 5KWEA 4RVHA 1KETA 1BWSA 2DFVA 3H4VA 3PRJA 4XJTA 5BT9A 1RYEA 3S2FA 4R41A 3PWKA 3HWRA 2ZB4A 5A9TA 2X0JA 3DZIA 3WGIA 1EVIA 2XXBA 1F17A 1HDYA 1A4UA 2OORA 3C7AA 4KDEA 3DBLB 2Y68A 1TXGA 1QYCA 2FPGA 1H9BA 4FJ1A 1QG6A 3VPGA 1LRKA 1LQTA 4WEOA 1BTOA 3DO5A 5CG2A 3V1UA 4ITUA 3WOHA 1GEGA 5IFLA 1HL3A 4URFA 4QO7A 1XIVA 1U8FO 4F45A 4LMPA 1GZ3A 1DRWA 2JHGA 1X13A 2J3HA 3JYOA 1Q7GA 3GPDG 2RH4A 5A5EA 2IZZA 1EFLA 1YB5A 2Y1DA 3RCBA 1GU7A 3Q2KA 5LDHA 1H2BA 1LBEA 3KUXA 1HDCA 3H5RA 1Z74A 4DWVA 3E9QA 4CMCA 1OC2A 4A03A 1D7OA 1HSZA 3Q11A 3SJ7A 2E49A 3DR3A 3ICPA 2GERA 2IYOA 1IB6A 2P5UA 4N18A 3DB2A 3IQDB 3KSZO 3ZH2A 3HQ4O 3FI9A 1KS9A 4OMUA 2VT3A 3H2ZA 3WIDA 3C1AA 1D1SA 1YL6A 4XYEA 3WFIA 3TOZA 4LCEA 2VYNA 1Q0LA 2JAPA 4ND5A 5DN9A 3VKVA 1Z45A 1BW9A 2RH8A 4IJWA 3GNQA 1DOHA 4WNIA 1GEEA 3QY9A 1T2FA 3FWNA 3R6DA 4MKRA 4OXKA 1FMCA 4XZ3A 2HKIA 1ENOA 1EVJA 1GL3A 1PL8A 3P7MA 3R3JA 4AJIA 2J5QA 1LX6A 1RM5A 3AUTA 3LZ6A 1K3TA 4UUMA 3JYQA 3I9LA 3IIEA 1XYGA 3M1LA 4MINA 1C0PA 3QWIA 1VLLA 4AVYA 4E2YA 2FMUA 5IDWA 4L73A 2HMTA 3ANLA 4J7UA 3C24A 1UZMA 2GSDA 2QRJA 3JV7A 4J4TA 1O9BA 1L1FA 4YAKA 1BDBA 1DLJA 4P4NA 3C7CB 4WCFC 3VPSA 3WSVA 4DQXA 4Q39A 1YO6A 1B8VA 1TVEA 3WNQA 4N5LA 5TSDA 1K0UA 3OM9A 4XIJA 4DPMA 1E3SA 1EE9A 1ADBA 1LRLA 5EQDA 3GLQA 4WOJA 4IS3A 2VRBA 3WNVA 4AJNA 3QW2A 3WLFA 2VNSA 1PQWA 2O3UA 2HAEA 3H3FA 1WDKA 1KEWA 2PK3A 3GMSA 4RO0A 1SOVA 1ZJYA 2IZ1A 2J8ZA 3AI3A 3G17A 4FQ8A 3TOXA 1RJWA 2HCTA 4XDYA 2O3JA 3L77A 4DRYA 3T4EA 5CDGA 3IUSA 4MIEA 4O6VA 5KJEA 1LTHR 1P1IA 3QLJA 4W6ZA 4E32A 2DLDA 5I8WA 5MDHA 4JJGA 2JFGA 1NM5A 1WDMA 3BIOA 3AM3A 1LLDA 3PJGA 2HK8A 1HWYA 3EZYA 3JQ8B 2A4KA 2I76A 1JKJA 1E3WB 1TT5A 3KLMX 1YL7A 1CQIA 5B4UA 4CMEA 1GR0A 3NT2A 3H3JA 3KYBA 4B4UA 2WD7B 3JYNA 3RFVA 1B26A 3DZJA 2OP0A 5BNIA 3KYCB 2PGJA 3UF0A 2EGGA 4N5NA 1PQPA 3JQ9C 4NPCA 2B5VA 3W6ZA 4IJKA 4U5QA 3SC4A 3T4XA 3AOGA 3O4RA 3V2HA 1T26A 2GN8A 3R3SA 3GH3A 1EBUA 5K0ZA 2EW2A 3K92A 1HDXA 5AOVA 3DZKA 4CM9A 2DUUA 2WMDA 3MJ4A 4EITA 1ADGA 4R69A 1K6JA 1SC6A 1EBFA 4NBTA 3BZUA 1U4OA 4W9NA 4TRJA 4BNNA 3MJCA 1PJQA 2FPPA 5L3ZA 3WQRA 3W8DA 3MWDB 3U3XA 3CIFA 5JDCC 5ILGA 2NSDA 2PD6A 4M86A 4QTZA 1SO8A 1U8XX 4IPTA 4YQZA 3WXBA 2GD1O 4I5EA 2PH5A 3NT4A 4WLNA 1C1XA 3ONEA 1DJQA 5A1TA 4E2XA 3OA2A 4GGOA 3KB6A 4FCCA 3B1KA 4E5KA 1P0FA 4LVCA 3VPFA 5L7WA 3ZWAA 3RC2A 4GLLA 3T7EA 2PGDA 2QRKA 3HSKA 4FD3A 4RZIA 3ETEA 4K26A 3EMKA 3GEDA 5ICSA 2ZIZA 5L9AA 2FSVA 1M66A 1P9LA 1G0OA 2VRCA 1HXHA 1GUFA 1M67A 1Z6ZA 3NDIA 3GVHA 4M1QA 3RUHA 3EW7A 3VDRA 4PG5A 3L6DA 1DO8A 3LT0A 3I6IA 5BSFA 5CEEA 2EEZA 3E48A 2OZPA 4OOFA 3GC6A 4XB1A 5FYDA 3ZV5A 3HUDA 3U9LA 1QMGA 3M2TA 4YWJA 1I24A 1ZK2A 5G4KA 3TNLA 4GI2A 1T25A 2AE1A 2Q1WA 3EK2A 1H94A 3D64A 4OOEA 4CR8A 2B37A 4YT5A 2QG4A 4ZN6A 5L40A 2NU7A 3LLVA 3D5QA 3KBOA 4FR5A 5L7TA 2Z1NA 3EVTA 3WTBA 3ZNOA 1AXGA 2PH3A 4FFRA 3NDJA 4NR0A 4BO4A 4R1UA 3K96A 2EERA 4ILKA 5HRUA 2DPGA 4EUFA 2ET6A 3QWHA 3RAJA 1I2ZA 2D8AA 4ALLA 2EHDA 3SLKA 4BGIA 4CQMB 3NT5A 4E5NA 2GPTA 5EERA 1I8TA 1JU9A 2GRAA 1JWBB 5K9ZA 4RF5A 1RM0A 2NLOA 1NVMB 3BMCB 1UP6A 3PLNA 4BNHA 4YR9A 1E7QA 3MJEA 1FDUA 3P2OA 3U62A 1GD1O 3GNSA 1HYGA 4WEQA 5CEJA 2B36A 1FK8A 1WZIA 3AWDA 3PFWO 1DAOA 4ALKA 1YBMA 4U8GA 2IRWA 3OJFA 4ZD6A 4CLOB 5JO0A 4KOAA 3ZW9A 1QRRA 3JD1A 4N54A 3SBOA 1P1FA 2W2LD 3CSDA 4YT4A 4QT0A 1V3UA 3E5MA 2DTXA 1A4IA 3E9MA 3GAFA 4CMBA 4HNGA 1PX0A 4FFNA 3D3WA 3A06A 3BTSA 3WGOA 1YVEI 3GY0A 5TJHA 4JX8A 2W98A 2HK7A 1LSOA 4B7CA 3RU9A 1DIGA 2DUWA 3KSDO 4Z9YA 5T67A 5TRTA 4A2CA 3DXFA 1PL7A 4HNHA 4ZQHA 5G0SA 1NFQA 2OOSA 2C7VA 4LMRA 4CQLA 1B14A 1HE4A 3VZPA 2DBRA 3U4IA 4IIUA 4BNYA 3HG7A 4GWGA 5A06A 1GTMA 1A7AA 4TZTA 2YW9A 5A02A 5FEUA 2O48X 3NGLA 4PG7A 1R0SA 2BELA 2PLAA 4JGBA 4DXHA 4ESOA 3ZV6A 4B79A 3WDSA 4CMGA 3NRCA 3OIFA 3NKLA 3Q9NA 5IDXA 1K89A 3D4NA 4A0SA 1AGNA 1HRDA 3LF2A 4O63O 4XRRA 4AJHA 4B7UA 1YWGO 1U5AA 1Q0QA 1PGQA 3ADOA 2FY8A 2UAGA 4AG3A 3LT2A 2FR8A 4AJ1A 5ENVA 3PFFA 3MZ0A 2NACA 4M55A 1D3AA 4J4BA 1AXEA 4RCVA 1XU9A 4HP8A 3PIIA 1BSVA 5ES3A 5I7FA 1EUZA 2DC1A 2PV7A 3AUSA 1H6CA 1LLQA 3GK3A 3HDHA 2DM6A 2F00A 4BO2A 3FSRA 1OAAA 3H9GA 3K2BA 1NVTA 1UH5A 1YQXA 2C59A 1BDMA 2Q50A 1T4BA 1QV6A 1JVBA 2OUIA 4K1LA 2P91A 2WYVA 1SZJG 2EV9A 2YYYA 4FB5A 4CMIB 1XA0A 1A9ZA 1R4NA 3IKVA 3JQ6A 1OOEA 4HXYA 2ZCVA 4RF4A 3MTGA 3S2EA 1CDOA 4BO9A 4PG4A 4D43A 1O95A 8ADHA 3Q0EA 3D4OA 1S6YA 3G79A 1KEVA 2A94A 3FTPA 3QVTA 4Q3AA 2J3IA 3KTDA 3AY3A 5BQFA 3F3SA 1ZXBA 1J6UA 3WFJA 1LLUA 1NR7A 2VZ0A 4NU5A 2VYVA 2O3TA 2X58A 3PQDA 3DWFA 4D7AA 1GV1A 1O0SA 1U3TA 4G2NA 1KC3A 3DOCA 1FJHA 1Z75A 1J4AA 1X1EA 1KBZA 3GOHA 3O26A 1Q0HA 4NBVA 4NZ9A 9LDTA 3TQHA 4W7IA 4E30A 3INGA 2BLLA 2JD2A 1HE5A 3IOYA 3PJEA 4DLLA 3OMLA 4E5PA 5JXWA 1RKXA 1E3IA 2ZQYA 2Y1FA 1YOVB 4JROA 3JQGB 3ZWNA 5G0WA 2X86A 2GZ3A 5JMWA 2O23A 2YJZA 1KOLA 4BNKA 4GKBA 1LSUA 1PWXA 2FOIA 3QJ5A 1QYDA 1ZMTA 3NDRA 4PG8A 5ITVA 3NTQA 4NJOA 1MV8A 5IF3A 3QP9A 1DPGA 4YAEA 4IINA 1M6HA 4CUKA 4FFPA 2Q49A 4JP3A 2Y1OA 5DNAA 2PKQO 4J16A 1O89A 4WPGA 2BGMA 1N8KA 5CG1A 1HDOA 3OQ6A 2ZTLA 1ZO8A 4H3VA 3P5SA 5H83A 3ZV3A 4NK5A 3A1NA 4NI5A 1P1RA 3K9QO 5I9MA 2DTEA 2J5KA 5I9NA 1E92A 2IXBA 3RIHA 3UW3A 5IN4A 4YRDA 4BNTA 2VWGA 4PLCA 3ROQA 1HEUA 2AMFA 2ZB8A 5C5IA 1NAHA 4XR4A 3B70A 5KJCA 5AXDA 1MB4A 4GGPA 3BTUA 1HE3A 3L4BA 4Q3EA 5JLAA 4LSMA 3WJ7A 1XLTA 1PGNA 2D4AA 1E0DA 1JVSA 3EGOA 2R00A 4O0LA 3WS7A 5DOVA 2F1KA 2JAHA 4R9SA 3KYDB 3WGZA 4Z0HO 2JD0A 5TX7A 3S8MA 2WEKA 4IXWA 1M75A 2W4QA 2HMUA 4Y8VA 4OSOA 4B4VA 4IDGA 3ZWXA 5DULA 1VSUA 2YHIA 2BFAA 3GGPA 3PQFA 3RUIA 2Y99A 4U6QA 4RVGA 4RF2A 4D42A 1T2DA 2H1SA 5TLSA 2VUUA 1M76A 2G5CA 3KRTA 1KY5A 3FBTA 3WB9A 4Z3DA 1UXHA 4NHEA 3JYPA 1V0JA 2CY0A 3BMQA 1SMKA 1LSSA 3ZWBA 1WMBA 3I1JA 4Y6PA 3NGXA 1ZBQA 4CMIA 1PR3A 5JFOA 3WGHA 3BXXA 3GN2A 4IY1A 3STHA 4KWIA 1V3TA 1MGOA 2YQ4A 3FWZA 1GYRA 1PZHA 2Q1TA 1U5CA 3U4DA 3X2EA 5A9RA 1V6AA 4UEKA 1P45A 4ZQBA 2JJYA 3PP8A 4DQUA 3O38A 3GHYA 3ZHYA 3U4HA 2Y66A 3HADA 1SOWA 2FR0A 3VPXA 2BFMA 3GFBA 3IC5A 5LC1A 4E4YA 3VHRA 1Z7BA 4XX0A 3S1LA 1XKQA 3PZRA 4DREA 5IXYA 5T8KA 4HKTA 3ZN2A 2FP4A 3RUFA 4DL9A 5FFFA 2BMAA 3JQ7A 1SAYA 2YUTA 3Q6IA 3KM0A 3ZW8A 1ISHA 3U5TA 4NBUA 1J49A 3TZCA 4K6CA 1J0XO 1YOVA 2HQ1A 4WASA 2Y1CA 3BHMA 3EYWA 4MVJA 2B4RO 4KDFA 5B4VA 3JQAD 1WZEA 2YV2A 4DLBA 3I9OA 2HMSA 2B5WA 2Q4EA 3D7LA 4OO3A 4PLYA 2EJVA 2Q1UA 4IZIA 4RGBA 2GZ1A 1WNTA 5GY7A 3M6IA 3BA1A 1UJMA 4CR7A 1HTBA 4J3FA 1ZCJA 3OICA 3FBGA 2Z95A 4MKZA 1EMDA 2HSDA 4K28A 1LDYA 1XQ6A 4MIYA 5COBA 2QX7A 4RQTA 5ITWA 4M49A 1PR9A 4HFJA 4R16A 3D5TA 4BO6A 1ADCA 5DOZA 5KKAA 3VPHA 2YY7A 2V65A 4N5MA 1JQBA 4PIVA 4FFLA 5DCWA 1GAEO 5JE8A 2EF1A 4F3YA 2OO5A 4NNJA 4UUOA 4CUJA 1G0NA 2EGHA 3DBRB 3LC2O 2ZATA 3W4IA 4ZA2A 1EQUA 5AVOA 4CM7A 1LU9A 4U6SA 3ZHBA 3OQBA 4NMHA 5F1PA 4XQCA 3KYDA 1Y5MA 4GX1A 3VZRA 4GX0A 1CEQA 3O03A 4JP2A 4BNFA 5A9SB 1PJ2A 4ND4A 4PZEA 4KP7A 3NUGA 5LCXA 1E3EA 3CMMA 2NU8A 5I7EA 3WICA 3JQCA 4FPXA 3SXPA 1OFGA 3HDQA 2O50A 5KVSA 3C85A 1V3VA 3GVPA 1KERA 1VL8A 9LDBA 1NPYA 4Y9DA 4B7XA 5HS4A 2PD4A 3KOUA 3RC1A 1QP8A 3JD2A 5HA5A 4CMKA 1P0CA 3DTYA 3RROA 3ETDA 1UDBA 4B3IA 4CJXA 2C7GA 3DHYA 3NTRA 5H81A 1MFZA 4EJ0A 3QVSA 5A4DA 4JJIA 3X2FA 5KVCA 2Q99A 1U2DA 5L7YA 2YDYA 1LUAA 4C7KA 4QEDA 3LQFA 4BNIA 3H7AA 2B0JA 3B20A 5U9CA 2GO1A 4BGEA 3DAGA 4MOWA 2PZMA 3E5RA 3PGXA 4IJUA 3LLSA 5DDIP 3S2GA 2YFQA 3DMTA 1I3NA 2EP5A 4UUNA 2ZTVA 3FR7A 3HFSA 3FR8A 4A73A 2HRBA 3ZWVA 3GVCA 3FTNA 4OGWA 4YVFA 1O94A 3KSUA 4MVJM 3TFQA 5JYDA 4M87A 1CF2O 1I2CA 1UR5A 3DBHA 1MXFA 2DBVO 2Q4BA 4WOKA 4RJTA 2VCYA 1NQ5A 5F1KA 3OEWA 3DQPA 3L4BC 4C4OA 2IXAA 3I83A 1ISMA 3CUKA 3ICCA 4C7JA 2CVOA 2O3SA 4Z0PA 2VHVA 4GX2A 1XDWA 4RPJA 2CFCA 1EK5A 3RUCA 1GCOA 2DPHA 1SEVA 2VNAA 1T2EA 4QFCA 3DZHA 4B4WA 2EW8A 4IS2A 1YE3A 1P31A 1PQUA 3ZNPA 2PZJA 1WW8A 1G1AA 4YAJA 1E7MA 4D46A 4L9RA 5L45A 3GG9A 3HJAA 1Z7EA 3VH1A 4R1TA 1DRUA 2IEDA 2BI8A 1MC5A 3OP4A 3NEPX 4ND1A 3ZNNA 4YPOA 1CERA 4DC1A 5TNXA 3WGTA 5THKA 3EHEA 3W6UA 4BB6A 2UV8A 3I52A 4R9RA 1W6UA 4BNWA 3UH1A 3V2UA 3WR5A 4IDCA 1RM4A 3I5MA 3WIEA 4YJFA 4GVLA 2CD9A 2O7QA 3DHNA 4DA9A 3VAZA 2X9GA 4YT2A 4AJOA 3DFZA 2C5AA 1UXIA 3CKYA 1X7GA 1ULSA 1F14A 3UXYA 4YCAA 2EJWA 5TT1A 1OBFO 4MKXA 4QO8A 5DP1A 2Y93A 1UAYA 4RDIA 4HBGA 4PLHA 2Z5LA 4A27A 2BKAA 1M2WA 2HJSA 4OM8A 1GZ6A 1KEUA 5AXBA 1E6UA 3CMCO 3QE3A 4A7PA 1HSOA 5A3JA 2OFPA 3AFMA 1C14A 3CE6A 5HM8A 4P22A 4JBIA 5FI3A 1I2BA 3MJTA 5CDTA 4J1SA 3LVFO 1B15A 3LT1A 3PDUA 2VT2A 5CEFA 3JCZA 5BSGA 3WMXA 4OQYA 5KCZA 4GX5A 7ADHA 5FI5A 3LT4A 2VUSA 2I6TA 3GPIA 2PNFA 1NYTA 2AE2A 2NTVA 3QVXA 4PFJA 4X54A 3WBFA 2DAPA 4Q9NA 2D2IA 4GAEA 1UDCA 1N7HA 5LDGA 1IHXA 4G65A 3NTOA 2NV6A 2Y0CA 1ISIA 5BSEA 4UEOA 3IUPA 3S55A 2NVUB 3DBLA 1ENPA 3GVIA 4OAQA 2HMWA 1KC1A 3K8ZA 1BRMA 1C0LA 2RHCA 4FJ0A 3TFOA 3DFUA 2HJRA 4FJ2A 4XD2A 3SLGA 3PLRA 3I4CA 5DBIA 5DBFA 4NFYA 1Q1NA 5TT0A 1F8GA 4IQ0A 2BRUA 4DPLA 3NJ4A 4W82A 3WGYA 4DBZA 1ZK0A 2G82A 1B7GO 1J5PA 1ENZA 1NAIA 2C5EA 2JL1A 3F5QA 4XQEA 1GPDG 5T5QA 4BV9A 4CLHA 1EEHA 4P4GA 1NBOA 3HDJA 1LC3A 4MVJH 2XXJA 1ONPA 1P33A 1X0XA 5IN5A 5DCYA 3ENNA 4AJLA 1LXCA 4GQAA 1UZLA 1T1SA 4NBWA 1B8UA 4J90A 4J2HA 1E7RA 1KYQA 4RPKA 1QORA 2VHZA 1XU7A 2QHXA 4WUVA 2NVBA 3GRKA 2VYND 2UDPA 4KWHA 3KXDA 1JAXA 1P1KA 1QV7A 5K6AC 2V7PA 4BMSA 1VSVA 2HO5A 2QYSA 1ZSNA 1AN9A 2EIHA 2PTGA 2NU9A 2O2YA 3KZVA 3UN1A 3V5NA 4IBOA 2NWQA 4EZBA 1BG6A 4QUKA 5GZ3A 2FSSA 4PLGA 5T57A 1PS0A 4CM8B 1U28A 3F9IA 3FPCA 4BQPA 5L4LA 4CR6A 1KVTA 3VDQA 4F46A 4PLVA 1I33A 3AY6A 4HADA 4MP3A 2FHSA 3DMTC 1E7WA 3ZWOA 3I9MA 3TPCA 1W73A 3G49A 2R6JA 3EVNA 1CRWG 3BMOB 2V6BA 4DYDA 2NADA 1PZGA 1RPNA 4N7RA 4YJGB 4EDFA 2X5JO 3DAFA 3WX0A 1Y8RB 1EDZA 1ADFA 5L51A 5THQA 5DBGA 5I7VA 3M2PA 2EKQA 5DP2A 4PRKA 4WLEA 1FDTA 3K30A 4MIOA 1NWHA 1E1NA 1DC4A 3MCVA 3HB4X 3O8QB 2ZK7A 1RYDA 1YS4A 4G5HA 4L75A 5TGDA 3RI3A 4DYVA 2AXQA 3PTZA 1EK6A 1I3KA 2O3QA 2V6MA 4MJLA 1HLPA 3HN7A 5TC4A 2DVMA 5IZCA 4YEDA 4Z6KA 3OEYA 2I66A 3FNFA 3E1KA 4B8ZA 1GYQA 3LF1A 4IDEA 2PKRA 1P44A 2P5YA 4DTIA 1X7HA 3JQ8A 3ITKA 2C54A 2UYYA 3GGGA 4LRTB 5TF4A 2BFPA 1E3WA 1ZZEA 3PQEA 5EJ2A 1YBAA 4L4SA 2AEFA 1WP4A 3G1TA 3AOEA 4Q3BA 2WD7A 4CM9D 3PJDA 4GSKA 1WDLA 1ZMOA 1R12A 3KYCA 4L74A 1P74A 3HE3A 2A35A 1U3WA 3DEYX 8LDHA 1IL0A 1MG5A 3TZKA 1W4ZA 3H9EO 2GN9A 5CHEA 4CM3A 1EVYA 3GAZA 2GGSA 3JQFA 2P9EA 1SCUA 4XGKA 3WYBA 3A14A 5U1PA 4XRGA 4P38A 4R5MA 1DSSG 1X15A 2QYTA 2IDZA 2X8LA 4H15A 4P4LA 3VTFA 2DU8A 3IDSA 2AQKA 5L4SA 3LYLA 2C29D 2VOJA 3F5SA 1H6DA 3RFTA 2BFOA 2CMDA 1JN0A 4EW6A 5A04A 1C0IA 3JQAB 4J9UE 3DOJA 1GQYA 1UZNA 1Y8QB 3VVBA 1FXSA 4I5GA 1N5DA 1ZXLA 4OXYA 2RCYA 2JCYA 1UDAA 1HDZA 1UXJA 2W8ZA 3H5NA 3H9UA 2WWRA 3IP1A 4L0QA 1PJTA 4BS9A 2VRCD 1N92A 3H5AA 2WD8A 3ENKA 5I8ZA 3TL3A 2EKPA 2OXIA 4LVUA 5C7IO 1PZFA 3RWBA 5TIIA 5L4NA 2C0CA 2YV3A 4KTTE 3RBVA 3UCXA 4D0SA 3GEGA 2Q45A 1F0YA 4LN1A 1EVZA 4OXNA 4PVDA 5AXCA 4ZRMA 3QSGA 5EL0A 3ON5A 1EE2A 4TMFA 4WCDA 3DAPA 2I9PA 1TLTA 4MVJG 1QLHA 4YJHB 5H82A 4KQWA 1RWBA 2X9NA 3HHPA 1DIBA 4CMEC 4QXMA 2VZ8A 1I0ZA 1NQAO 2Q2QA 4KUHA 4D0RA 4OKIA 3W4JA 3OIDA 3VH4A 3AUAA 1K5HA 4RF3A 4KUEA 1YL5A 4CLEA 2WSBA 4HX5A 1GV0A 2WE7A 2X5OA 1PJ4A 1DJNA 3DOOA 1UAGA 2J5RA 4ZJUA 1PS8A 4ZQGA 3PHIA 2RIRA 3GMDA 3HZZA 1BXGB 1Y8RA 3VOSA 3WQSB 2I65A 4XA8A 3RC7A 5GZ1A 5JAMA 4KZPA 1YXMA 3FPLA 1YQGA 1LDEA 4ZU3A 4RV9A 3K2EA 4LGVA 3AU9A 3OFSA 5B4TA 3F47A 4FGWA 4CQMA 2WM3A 2VQ3A 4W9NC 3ZU4A 2VZ9A 4J7CA 1YRLA 3O8QA 4CV0A 2X9VA 3LU1A 1EFKA 5ILOA 4J2OA 4JQCA 5T6BA 2UUPA 3BMCA 4CL8A 2D3TA 4GWKA 3IKTA 4Z0TA 1X1TA 2C07A 1B16A 5DZSA 1DIAA 5FWNA 1EDOA 4PCVA 4BO3A 1ZK4A 3G0OA 2BGLA 4I9UA 1U3VA 2TMGA 4CLOA 3RBXA 1KVUA 4IDDA 4OJNA 4WCFB 2BD0A 5GZ6A 5HBRA 4EJMA 3KEQA 4MO2A 2OBNA 3AI2A 3ZNQA 3DZFA 4YYZA 3D4PA 2BI7A 1DIRA 4CLXA 3PYMA 2PZKA 3F46A 2B4TO 3DC2A 2PWZA 5IDQA 3KV3O 5KKCA 3F1KA 5B1YA 3UOGA 1E6EA 1LNQA 3JQBA 4IM7A 2QZZA 1AHIA 4ND3A 2E37A 4L4RA 1R15A 1TI7A 4R54A 4CODB 1NX6A 2IEBA 1E5LA 2NM0A 2Q1SA 3HN2A 3DZGA 1ARZA 1IZ0A 2PGLA 4BGUA 4BNGA 3UUWA 4DQVA 4EYEA 4HFMA 1TT7A 3MEQA 1R6DA 1ZH8A 4BNXA 4A5OA 2RAFA 2GYYA 3GNTA 2YHUA 1AE1A 4ND2A 4YACA 3I9JA 4BUCA 1E7YA 2RBEA 4NBRA 5CDSA 4NFSA 4CMHA 3NJ8A 3IJRA 1Y8QA 3B1FA 1YONA 2POQX 1E3JA 1OC4A 1YDEA 1ISFA 3DZBA 2RHRA 2AG5A 4J7XA 3RUDA 5TS3A 4TVOA 1CETA 4NIMA 4YTEA 5JO9A 3OQ1A 1XCBA 3TSCA 4PLTA 5IZCC 5ADHA 3PIDA 3TZ6A 2Y05A 2VHYA 2CZCA 3ZHZA 4UVDA 3F1LA 4UVGA 4EJ6A 3TL2A 4DGSA 4I9HA 3VH2A 1MUUA 3AW9A 4YJHA 3OJOA 5IAAA 4PVCA 4ZICA 2G1UA 3GGOA 4FBGA 4NU6A 3AOEC 3GA0A 4JBGA 5JDIA 5A05A 3QWBA 2PY6A 3ZWYA 1YJQA 2VN8A 3ROPA 3IS3A 4HFNA 1I3LA 1EQ2A 1I3MA 1PGPA 4OKNA 3HB5X 3LC1O 4FOOA 4GMGA 1G6KA 2EKLA 3RQSA 3JQFC 5ER6A 1R0LA 2G0TA 2VYVD 3TN7A 3H6KA 3OJ0A 5CFZA 1W0CA 1PJ3A 4HWKA 5C7LO 3ETGA 1GADO 2Y0DA 4K6FA 3AK4A 3UCFA 2Y67A 1WPQA 1LDGA 1YDWA 4PLWA 4BHTA 1B2LA 3ZHXA 3RKRA 5G4LA 2YQ5A 1ML3A 1U2GA 4IDBA 4I8XA 2QQ5A 2Q2WA 5F5LA 5KNLA 4OL9A 5G0UA 4DIBA 1H6AA 4YJDA 4R4JA 2HK9A 3JSAA 4FFMA 2ZTUA 3BHJA 4LCJA 3V1YA 3ORFA 1LDBA 3Q1LA 3RU7A 1T4DA 1GFSA 4J43A 2Y1EA 1LA2A 1LJ8A 4B3JA 1LC0A 3PXXA 3JQGA 4BO7A 2ZKLA 3ONDA 1L7DA 2NU6A 4MP8A 5BNTA 1H2HA 2WJPA 1MX3A 3RASA 3E6AA 4RORA 4ZHSA 3U4CA 3WWZA 1JKFA 4O59O 3PJFA 2ZJ1A 1IYZA 4XQGA 4BIIA 2G76A 3F4BA 5G0VA 1F8FA 5B12A 1U9JA 2EP7A 5IG2A 3ASUA 3IAHA 5G2OA 3CZRA 5HTOA 1IHYA 2ZYDA 4II3A 1NXQA 3LDHA 3IP3A 3PZBA 3G3EA 4IDFA 3GHHA 4BKUA 1BXZA 4JCOA 1XR3A 4AJKA 5EPOA 4PLFA 2CDCA 2VUTA 1BVRA 2VWQA 1NR1A 2HMVA 3GR6A 1NNUA 3CZMA 4ZVVA 3VKUA 4E6PA 3QA9A 4WNCA 4HFRA 3D3EA 1Y7TA 1FDWA 1VE9A 1UXKA 3ZWMA 4BNUA 4F6CA 2GCGA 1PSDA 2D59A 2Q46A 4LISA 5C3MA 4TWRA 3GFGA 4ROSA 1W8DA 2B35A 3WLEA 4Z3KA 1R16A 2D5CA 4OHUA 3WJAA 1SNYA 1BW9B 1KY4A 5JC8A 3D1LA 4DLAA 4UUPA 1HLDA 4BNVA 1GUYA 1K2WA 4YXFA 1ID1A 5A3VA 1E7SA 1NPTO 1YB1A 3U09A 3TRIA 3ANMA 4O1MA 5ENDA 3HFGA 3JQ9A 4FW8A 1NQOA 3L9WA 3IL2A 4YB8A 4E3ZA 5HS6A 1WAMA 3PWZA 4RZHA 1YKFA 5I9LA 2VWPA 2AQHA 4UAGA 1P77A 1QYWA 3GUYA 4E33A 2WTBA 2O2SA 4AL4A 2BH9A 4YAIA 1N2SA 1I5RA 1DXYA 3PVZA 2NTJA 4H16A 4U7WA 2FZWA 4IMPA 1IY8A 2H6EA 3JQBC 3JD4A 3E82A 3KEOA 3KVOA 3VZQA 4BOYA 5JDCA 1ZFNA 1DDOA 3UCEA 4XJSA 4Z9XA 1MA0A 3KO8A 6ADHA 1HF3A 1E1MA 1SBYA 2OMEA 4KMSA 2JFHA 2HLPA 3N74A 2AEMA 1JDJA 3SVTA 2P9CA 4EGFA 3C3XA 4XQ9A 1JKIA 5T64A 1B3BA 3AUUA 3PPIA 1B8PA 1I10A 4I1IA 2VWHA 1N1GA 5JPIA 4IMRA 3KLPX 4CM4B 1GQQA 1NHGA 1ZEMA 1E77A 3QIVA 1VC2A 1CQJA 4INAA 2OGUA 2CF5A 4FN4A 4S1VA 4XGNA 5F5NA 1MP0A 4ZGWA 4RQUA 1U4SA 2PZLA 1TT5B 1B0AA 1OZAA 4QFDA 2OP1A 4MVJD 4II2A 2FR1A 2AW5A 1HZZA 4XR9A 2R00C 1RM3A 1VKNA 4HY3A 3ZCXA 3RD5A 3H2SA 4GVXA 4NDNE 3QVWA 4BKOA 1K6XA 5AQ1A 4BNZA 4FC6A 4IXTA 1JAYA 1E1KA 5JMPA 1N1EA 3K73O 2JD1A 3RC9A 5KJ1A 2I3AA 1H9AA 4BKPA 1XHLA 1XG5A 3GG2A 1DLIA 1XGKA 2X22A 2C2YA 3U49A 4F6LA 1HYHA 5BR7A 2XF8A 3B1JA 4YAGA 5KTKA 4YQYA 1GDHA 2CUKA 4BKQA 2GUGA 2VTEA 4RLHA 4O5OA 3PDJA 2IE0A 1DC5A 1DFHA 1C0KA 1PJBA 1V8BA 1ULUA 1R66A 4AFNA 2AHRA 4EUEA 3H9QA 4CM1A 2J3KA 2NQTA 5JDIC 4J91A 1E1LA 2TMDA 3DBVO 3WTCA 4TVBA 1WWKA 5CAEA 1I32A 3GRPA 1OI7A 2VOEA 1KIFA 5COAA 1C1XB 5JCJA 1P1HA 3A9WA 1IPEA 2O7SA 5DCUA 1O5IA 1U7HA 1Y9AA 2YV1A 3GZNB 2X0RA 4WLVA 4J1TA 2Z1MA 2O4CA 1ZKMA 2AQ8A 1E6WA 2AG8A 1Y9EA 2VTDA 3DBRA 4MVJE 5F21A 2UUOA 6LDHA 2C20A 4NG5A 3CH6A 4OYRA 4G81A 1M6WA 1SB9A 4FDAA 4BNJA 1ISGA 1PJCA 5ICMA 3SEFA 5T8KC 3FD8A 5A9SA 2FZEA 4TRMA 1R0KA 5G4KB 1GPJA 1CYDA 1LQUA 1I01A 4BB5A 1H0KA 2WDZA 4YRAA 5TQVA 4DPKA 3ITDA 3HDYA 4I5DA 1ONNA 1R37A 4RPGA 3I6QA 2PR2A 1GZ4A 4AJJA 3JD3A 3TZQA 4JIGA 4H7PA 3PHLA 1UP7A 2PD3A 4UREA 1PEDA 4YDRA 3GEMA 1VJ0A 1X7DA 4GSLA 4JBHA 3TWOA 5JC1A 2WYUA 2HRZA 2CSUA 4RPLA 5JS6A 1T2AA 1E5QA 1ZVMA 2FN7A 2IZ0A 3TJRA 2EXXA 2Y0EA 5F1OA 1MG0A 1DEHA 4PN3A 4XWYA 2QIOA 3S2IA 4CM5A 4BNLA 4R5HA 4D41A 1YQDA 2CDAA 4WLUA 3RBZA 3OBBA 1KVSA 4KQXA 3EY4A 1IOLA 4DBVO 2ILTA 2XAAA 3LC7O 1ZIDA 1KEPA 5KIAA 4JN6B 5EQFA 4CM4A 2XPCA 4JXKA 2J6IA 4RL6A 1F12A 3IJPA 4XCVA 3JQEA 5JAIA 5F3RA 1ZJZA 2NUAA 4TZKA 3RKUA 3INTA 4NQZA 3LK7A 4PZDA 4CMAA 1HETA 4DVJA 2V6GA 1D4FA 3D0OA 4RLSA 4XDZA 1CWUA 3D3WB 3R0IA 4GKVA 4CV1A 5JAZA 1A9YA 1NQTA 1A27A 2FPIA 2W2LA 3GDFA 4TROA 3SX2A 2GZ2A 2GR9A 4UVHA 1NFFA 1JWAB 3TF5A 3WWYA 4CM6A 3RJ5A 3E03A 2GDZA 3P2YA 5EIOA 3FNHA 2G17A 3NYWA 4LW8A 3RFXA 3ZU2A 4TRNA 4JJFA 2C2XA 1ZEJA 5IDYA 3N58A 3ZV4A 4CQLB 4D79A 1TEHA 3ZU5A 4L8VA 2B83A 1HE2A 1DFIA 3GUCA 3WSWA 3ZWWA 3JD0A 4CV2A 1EUDA 3EZLA 4E5YA 3K6JA 3MTJA 1A72A 3N7UA 2X23A 3MOIA 4YBZA 3K31A 3AY7A 2WYWA 1PIWA 5JCJD 3MWEB 1NPDA 4UULA 1H6BA 4BNMA 1LRJA 2B69A 5CDYA 4E2ZA 2UVDA 3E8XA 3A4VA 4BGVA 1WLYA 2X1HA 4QSMA 4AICA 1EZ4A 2E82A 1DRVA 2AA3A 5C7OO 1LI4A 1Q2XA 4BMVA 5COQA 2OHXA
chains in the Genus database with same CATH superfamily
4WECA 3SF8A 4EY4A 1UJ6A 4J0DA 4KSBA 5AM0A 2XECA 3ZEIA 5IVPA 4L1KA 2GQ0A 2X76A 4OJMX 1UBJS 1REQB 1IB0A 2GBLC 4IDAA 1YCGA 2NAPA 2I4TA 3A11A 4WDQA 3W7VA 2BJHA 2QVGA 3FGOA 1G8MA 1W48A 2I8CA 3AY0A 3L0BA 4AZ3A 4YLGA 5IKMA 3SNKA 2AYXA 2EYUA 1EFHA 1N8SA 2AUMA 4INJA 2IS6A 4WLFA 3V4LA 4KR2A 1RBYA 3NB0A 4JMPA 3TSOA 2CVQA 2DCUA 3H1GA 4YXWA 4TSKA 3R7WB 3OQMA 1OYOA 5EGNA 3FDZB 1Q7CA 3TDKA 1KI3A 1IN6A 1ZD5A 2WJ6A 1RR6A 3N39C 3ROXA 5CT4A 5KCMA 4TOIA 3U48A 1F2UB 2I1VB 3LVQE 1OPXA 5H1YA 3P19A 4OBWA 2CJWB 5KQLA 1NY6A 2TYSB 1DAPA 4IUYA 4WHMA 3RYFB 3FZYA 4F5ZA 1T5TA 2WAMA 2JI8A 2O8BA 2A0XA 3B6MA 3VYWA 4ZI7B 4LBZA 3PXGA 5EIHA 3T9BA 3E5HA 1SQ5A 4YRLA 5TVGA 2DWQA 2CUNA 4OBXA 3W3ZB 1QOQB 2NQ8A 3DKIA 2PSFA 4G5GA 4L76A 1K6EA 4D9HA 5FKJA 4BQRA 2QZ9A 2WHXA 2ZCUA 5DMHA 5K2OA 2IYLD 1M8GA 4NKRA 1FTNA 2NVUA 3ANNA 1VPVA 1MMFB 4LJSA 3GIWA 2W2TA 4KQ1A 4KGXA 1FDRA 4OL0A 5KSPA 1FYDA 4MW6A 2AKAB 1RCTE 2I2BA 1XZKA 4NFHA 3KUDA 2IOFA 1UQRA 4ZVNA 2O8EB 2AMYA 3WKBA 2EBHX 1PFYA 1R8YA 2SCUA 4MAAA 1GL7A 3PGVA 2WABA 4AUKA 4OK5A 1GZDA 1DT3A 4ZOLB 5IYZB 2J3JA 2X0IA 2C7OA 3ANTA 3MGKA 2XUHA 1KI4A 4PRYA 1VLVA 4WZZA 3TLAA 1GSAA 4QUAA 2OHVA 1COZA 2P4SA 2BC9A 3F3KA 3R3XA 5JNLA 4EWLA 3R7LA 3OIYA 3O47A 3EWAA 3C7KA 4KVFA 1NGSA 3FYUC 3H0EA 4REOA 4RCYA 2V4ZA 2IYZA 1T3ZA 5D6NA 3VVCA 3UUEA 4AJ2A 2CF6A 1EDBA 2R44A 4QLOA 4BMNA 4WK6A 4DNXA 5HJ5A 2QJRA 3ZCRA 1N6LA 3OSZA 1V16B 4MHOA 3SU8A 1ND5A 1VE1A 1OX4B 3AHEA 2W2PA 4O4IB 1H85A 2KB0A 3BMNB 2QSZA 4AS3A 2DPLA 4JEUA 4MVXA 4YCMA 1SCIA 4W5HA 5JSFA 1VRWA 1ZL0A 3RUEA 3DZCA 1DADA 2QEQA 3DTTA 4IUDS 4WA7A 2ZJ0A 4CV3A 1UPCA 1ZGZA 2R48A 4MV1A 4DIMA 5CB4B 3DL2A 1IY1A 1H5QA 4N7JA 3TIFA 3BVPA 2ZPTX 1L4KA 3L05A 3GLFE 1V7ZA 1IRXA 2D0IA 2DBQA 5IT0A 3GP8A 5EE3A 3ICEA 5IJZA 4H60A 4FYKA 1NWCA 5I7WA 4PX2A 2OV3A 1NVGA 3IPLA 1T9GS 1VDZA 3BCSA 4LI0A 3NO4A 4D44A 1DBVO 4K81B 4HWOA 2OV1A 4LYEA 3RSOA 3FLBA 8ATCA 1M34E 3HXTA 5IARA 5CDUA 2VA8A 2ZJOA 3O4VA 4RGYA 3V33A 5HKKD 1PJLA 1JJAA 4D6YA 4K03A 3WLTA 2CEKA 4EEXA 1JFSA 1SHKA 4CN9A 1R8JA 2NZVG 2H2WA 1YNSA 2YJGA 4QQRA 1QIJA 4YJGA 2GAIA 4ZVOA 1A88A 3SS8A 3WO1A 3HKCB 4GDMA 4FOSA 5LA6B 4QZVA 5DK6A 1FP1D 2CB9A 4LNUA 1ZN2A 5JZBA 3CX6A 4M0PA 3V1TC 3WNBA 4ZHQA 2WTAA 3H2JA 4EKIA 3BC1A 4PNEA 4L9SA 4Q3LA 1QONA 2E48A 5JOQA 4BVBA 4MA0A 4F9FA 2WWHA 5AHKA 2VDMB 2DQ4A 4UZSA 3BMQB 2AN9A 3NBQA 3LP6A 1RQRA 3FM9A 5DTIA 5AVJA 1BGXT 1Y4ZA 3CH7A 3NQ41 4I50B 4AJPA 1RYYA 2C00A 4JDUA 1B3RA 3UB2A 1KVQA 1E3LA 2GZDA 4FGZA 3EXIB 4RADA 4X20B 1UBFA 2AC4A 3VC1A 1CIJA 5A0FA 3EXEB 3TMYA 4O0MA 1XI2A 1R0BA 2X6TA 1CJSA 1CY1A 2ZUWA 4G37A 2R751 1YR6A 4C2TA 4HPWA 1VIYA 1R27A 4IVNA 1EX6A 2ZYTX 3VTZA 1OJ7A 4UUAA 2BCJQ 2F3PA 3ZWPA 2WWIA 5FBKA 3H4MA 2W37A 3EEFA 4NE9A 5UKDA 4NJMA 3RAFC 4XEHA 4XARA 4DIOA 2W2KA 3FOCA 1QX3A 3HUTA 1JIVA 4FC7A 4IKPA 4IIVA 3AF2A 2VDLB 4Y98A 1SR8A 4ZCSA 2XZDA 2AF3C 1KPGA 1Y6JA 4FYYA 5DF1A 3SS7X 2JKVA 3Q3EA 1U28C 1PGOA 2QPOA 4XX0B 3SC2B 4DM3A 3I9NA 4QOEA 1VJRA 2DUMA 1RAEA 1YIDA 2YHAA 4IIFA 4ZEWA 4CF5A 2P68A 3A2MA 4F71A 5HXAA 5KX5B 5JNVA 1PGJA 3KETA 2IVFA 1ODKA 3NDPA 1YSCA 2FVXA 2XDWA 3U1TA 5IJAA 3E7XA 4RVOA 3REQB 1JI3A 1KYZA 5CBPB 1C8VB 3KX2A 3H4IA 4P54A 4D9MA 2GUWA 3EDCA 3VKGA 1G7RA 3VH3A 4NZZA 3QBEA 1C3LA 2IODA 2XJ9A 2NMVA 2OC4A 4CLRB 2L69A 2W6IA 2WUWE 4KUGA 5DYYA 1OBCA 1OHHD 3MCAA 4WE3A 2ALJA 4EUKA 4PCAA 5JBIA 4JDPA 4JLBA 4NK4A 4YO8A 3A28A 1NMEA 3G5TA 3E9NA 4FHDA 4IVRA 3VU1A 5JH7F 1R0RE 1Y8ZA 3I8OA 5IJWA 1JT9A 1SQSA 2GF9A 3HLYA 1F9EA 1J1ZA 4MV5A 1C3XA 1ZN8A 3GT0A 1L5MA 2NXNA 3B3FA 3KCNA 2XF2A 3ABOB 3L02A 2XQIA 5I8PA 1EBBA 1XFAA 3PUKA 4MCIA 1U2PA 3QPUA 4G0OA 2IPMA 1C1DB 2R7AA 4P3YA 3COSA 3W79A 2NUPB 4JXXA 3QSYA 4OHMA 4GI3A 1S4QA 2HN9A 1Q95A 2IHUA 3UHAA 3C1TA 2WVAA 3D0QA 2FW0A 4YLEA 4PFSA 3V8PA 2PUHA 1EGHA 2H9IA 5CFOA 1NVVQ 4QTTB 2HWKA 1QOPB 2QX8A 3PHGA 5E6RB 3RSHA 1MBZA 4UM9D 4KPFC 4XM2A 2VJMA 4UEWA 2B61A 3LX5A 4ALJA 2ROQA 2JIRA 1K9VF 3THYA 3HNPA 3C98A 3C87A 3K0EA 3ORSA 3D6AA 2PRJA 4J9VA 5DT9A 1AH2A 4L85A 5IJ9B 2DFDA 4K9SA 1IVYA 5LB4A 2GT1A 1G6OA 2Z43A 3PC8A 2HXSA 4N3NA 5JQGF 3ODPA 1T0IA 5SZHB 4KTVE 1BGVA 4PLZA 5KMGB 3SYNA 4EATA 2XXAA 3KAQA 1XTJA 4DR5B 2GD2A 1OWMA 3RHFA 4JJAA 3CR8A 4LRSB 4NZNA 4M54A 1BVUA 2I4LA 4RFLA 4GZLA 5HE8A 1FEZA 2I2AA 2LDBA 5CK4A 4CQMD 5ICEA 2ZBDA 4GNKA 4TN1A 3OE4A 1UFQA 3FMIA 1OD6A 5FI1B 4UVEA 2X4DA 1U1IA 3A4TA 3H8WA 4IIJB 2X7HA 3CZCA 1TQDA 2QOEA 2DWPA 2Z5GA 4KRFA 2REBA 2IOYA 4X7BA 4LF6B 3NNSA 4IV0A 1SCQA 3CYFA 1YQEA 4L08A 4P3PA 1SUIA 1U7PA 3G2MA 3KU1A 4TL7A 4OP3A 1ZYUA 4P81A 1P4GA 4JL5A 1HDGO 3MMZA 4GI1A 4WZBB 3IQXA 1C4KA 3UJDA 1CIPA 3TCXB 1MO6A 2FXIA 3IOEA 4NG4A 4UVIA 2X0DA 1X38A 2BBTA 1ZGGA 3L6RA 4HN9A 4A15A 1IULA 2QM3A 1EAMA 2DECA 2W6JA 2QI9C 1G18A 2CSXA 4MYCA 4DC0A 1SKQA 5JAUA 2ISQA 5KHLB 2IU3A 2W90A 2QB5A 1HZJA 2ODAA 4GBJA 1VFPA 3IUQA 4B3CA 1HOXA 1PV1A 2KMLA 5ER9A 1JA9A 4EGJA 1N2OA 1YHNA 5CFRA 4EHLA 4EG7A 1UT8A 4BMCA 2GKGA 4YAGA 3IO3A 2IYPA 2DKNA 5BNFA 2G71A 1O08A 4GBED 4L5BA 4BQNA 1XO1A 5K8LA 1IN4A 3WIUA 2BHLA 4MVJF 4UDOA 5ECYA 4UMEA 4MVJI 2QUKA 2HA4A 5JR3A 3B6ZA 3DE3X 4GC5A 1Z4KA 1HT0A 1YRAA 2GJ4A 2C3OA 1IJEA 2HH9A 3EIEA 4LHZA 1N9KA 2RHMA 2G06A 2J3DA 4XYBA 3OQOA 4XFKA 2QW8A 3CW2A 3KJIA 5D5PA 1UFVA 3CH5A 3M4JA 1TO6A 2BKUA 2AEJA 2I67A 2ZTHA 3BH7A 5AW0A 4LOLA 3EMVA 5ERGB 4G0QA 5B36A 4CT0A 1GITA 4IIYA 1OMOA 2IPXA 3RGGA 1NVWQ 2X3UA 1J33A 2B8WA 5BV7A 1PS9A 1WIWA 2GLUA 4UNIA 3DV0A 1MXHA 1TD1A 2GBFA 3PC7A 5ALYA 2R8RA 1M2HA 4GOND 5DT2A 3DDZX 4CCWA 1PN3A 2ECPA 1JIKA 1PHRA 3JPYA 3LG2A 3LGAA 4B34A 3HJBA 4MTCA 3HMKA 1ZN9A 3CRZA 4U0KA 5D3MB 1WX1A 1OIVA 4KN9S 3ROEA 2JLVA 3BB1A 4XJVA 3N8NA 5ABPA 3N0RA 4QECA 1U6IA 2HU5A 8LDHA 1SXJB 2CNDA 2VHWA 2WIAA 4FS3A 5EESA 1GGVA 3VNBA 4S04A 3FNQA 2OYSA 3PUJA 3T7CA 4RVDA 4KR7A 1OBOA 1EWTA 3KQWA 4GYJA 2VK4A 3BAZA 4RVSA 5H9WA 2CMHA 4DVGA 4C0XA 2Q0SA 3A7EA 3Q3CA 4KX5A 4E0BA 1A1SA 5K20A 3F5MA 3NBMA 3NBYC 4ZQIA 1TMYA 1Z63A 4Q3NA 1WY7A 2BEUA 4ZXPA 1PZMA 2JIMA 1CIVA 3H18A 1QCYA 3W3AD 1ZVKA 3F4LA 1Z62A 3N75A 1X1QA 3RIGA 4MRAA 4LDNA 1VKOA 3L43A 3G0DA 5LQCA 3MPUA 2RE8A 1FLAA 5FLEX 3PDIA 1G3MA 1G8SA 4UAVA 5BNWA 1DX9A 5KSZA 4N65A 2BH2A 3WRWA 2AG0A 4DMGA 2D4HA 4ZKDA 3IEKA 3WYEA 3CPSA 4G8DA 3PK0A 2V7TA 2OXTA 2NTNA 2CDBA 3VR0A 4ETIA 5C1PA 5B7GA 2YDXA 3FCOA 3P9CA 2X5KO 3PHHA 3H97A 2ZTMA 3QXJA 1LTKA 3N07A 4PRLA 3OZEA 2PYIA 4FE3A 2REOA 5EIAA 1E1RA 1UC5B 4LDRA 1QKKA 1UDWA 3K9BA 4EHAA 1A2KC 1JG4A 3JYLA 4E1AA 5B5SA 5K6AA 2J85A 4MULA 4V0NA 3ZGYA 5FTJA 5EJ5A 4DUGA 3CINA 2YZ7A 3NHZA 1ISSA 4JLNA 3G6WA 1DHTA 3OETA 2O05A 3R5JA 1XEAA 1QMPA 3AJRA 1QSGA 2IW3A 3FHLA 4CTOA 4XYLA 2PX0A 2X8WA 1TB4A 5DNCA 1Y1PA 3RVOA 2H92A 3ONVA 4RVFA 2GFHA 1EESA 3FZNA 4CEHA 3I73A 5CTJA 5FUMA 3AZPA 2B20A 2WIJA 2RGUA 1F5SA 5JVDA 2BN4A 1NT4A 2WTUA 2JH9A 2P11A 1PVOA 1U0FA 2X0JA 3Q3JB 1RBQA 2AOTB 1RRCA 1PFQA 4HH0A 4RV4A 1KFCB 2OFXA 1YB2A 2OORA 4KDEA 3DBLB 2H7XA 1QH1B 2RK6A 4YRNA 2C9ZA 1M0SA 1B41A 1XMSA 3SYTA 4HLNA 3VX3A 3ZVMA 4JENA 5BURA 2O8FA 3EXFB 5EXPA 2PA0A 2QXUA 1V1RB 4MWZA 1DG9A 1FVFA 4MROA 2QQGA 2VSNA 1E79A 1DJPA 1GAWA 1NXSA 2OB1A 4U63A 2MIIA 3TTTA 3L7KA 1F48A 5H3LA 5BYBA 4R8LA 2O7NA 4ITUA 3HU1A 1EGVB 1NX9A 1US8A 3N2GA 3WOHA 4AB1A 3G2HA 4QO7A 3F49S 4JUIA 3AP3A 1TZJA 2NQ2C 1EWQA 2MDTA 5AM1A 1JTFA 4EA6A 4ZODA 3JYOA 4LMBA 4RHUA 4MI3A 1VL2A 3C6YA 5C8YF 2YV4A 4ZOCA 4DBLC 1G3RA 2BGTA 2A1TS 1KAMA 2RH4A 4KGVA 4C5CA 2B30A 5F7OA 1EFLA 2PZEA 1Y1LA 1XRLA 1SZCA 1Y1RA 1U6JA 2G5GX 1ZN7A 1JRLA 1K06A 1P91A 3H5RA 4UFNA 2C8VA 2FUG1 5JNSA 2G1KA 2EYQA 1YB6A 5DSXA 3RRJA 5CM2Z 1E8NA 1V9SA 1YRBA 1HSZA 3SJ7A 3DR3A 3B9QA 3ICPA 3KKQA 4L78A 5DNWA 5FIUA 5JAOA 3EQ6A 2X5NA 1P1BA 1TUEA 2H7CA 3FI9A 4DF3A 4JSYA 1KS9A 1DZIA 3R3YA 3EJWA 4DMCA 3IDAA 4YP6A 4WTOA 2NU9B 2ARKA 3WFIA 1N6OA 2VYNA 3UWMA 2VAMA 2GZRA 4Y1RB 4ARCA 3QVLA 5JJCA 1RYNA 2VQDA 1SH7A 1J2EA 2XVYA 3NYIA 2YNMA 2ZJ3A 3FVRA 2RH8A 4MWCA 1PLLA 1SCKA 3GAMA 1VKRA 4OB7A 1HQYE 2FPUA 5TQ0B 1Z5GA 3L8EA 5CM9C 2G07A 4MKRA 3WLKX 4DA4A 2QRZA 3OE5A 2M6RA 1FMCA 2JAXA 1T5SA 1QC5A 1EVJA 1GL3A 1X7XB 2A9PA 3KHTA 4OVKA 3DTVA 4YDSA 5GAJA 3NHSA 3NPAA 2J5QA 1P0QA 1DTWA 1LX6A 4WVLA 2CV2A 2QNRA 1K3TA 4UUMA 3JYQA 3I9LA 1L4HA 3IIEA 5KOJB 1P7PA 1VLLA 5IDWA 1AHNA 1Z2NX 1JDBC 1YQQA 2HMTA 3IUMA 1ESDA 1U7WA 2FOLA 4R8KA 5HDQA 4YECA 1XD8A 3JV7A 4N8EA 5H9VA 5JTTA 1NSTA 1O9BA 2GCNA 1BC5A 5AKIA 4WCFC 2GXSA 3WSVA 1BO6A 1ACJA 3NHWA 2P40A 4BU0A 4OLAA 3GZJA 3OZSA 4Q39A 1YO6A 1G8PA 1NVDA 1UXOA 1TVEA 3IB3A 2RJ3A 4N5LA 1DJOA 3ZQKA 1SBTA 3SK0A 3OM9A 4PCLA 4AUNA 4HEJA 4XIJA 1WSBA 4E1VA 4DPMA 4H4DA 3E9YA 3IAS6 4KQKA 1ADBA 3EZ9A 4M8LA 4Y1GA 1CHNA 1A5AB 2WHPA 5EQDA 2CDRA 4IS3A 4AJNA 1F8UA 2ZWAA 4NBKA 4PICA 5K8UA 3DCYA 4I5IA 1PQWA 3EC2A 1RRPA 5ESDA 4A0FA 1AKUA 2GN1A 3QPCA 5GIPE 2C2HA 4LDJA 3GMSA 4CCYB 1ZJYA 3AI3A 3G17A 2WI8A 4TMXA 3FPAA 1RJWA 2QS9A 4JLSA 2QAIA 1D03A 1FZQA 4V38A 5AI5A 3U3MA 5CDGA 1OKKD 1P5ZB 4DM4A 3GDWA 3IUSA 4MH0R 4LECA 2QAGC 2VXBA 3VGJA 5ALJA 4B81A 5A4AA 1X7ZA 4W6ZA 4BLPA 4E32A 4WK2B 1NNEA 2DLDA 3FOWA 2AOWA 2PSDA 1INLA 2PLFA 5MDHA 4JJGA 4UBKA 1NBME 4KAXA 2V58A 3BIOA 3AM3A 5I9NA 2HK8A 1RYBA 1UMDB 1JKJA 5DYTA 1SKMA 1QJCA 4RETA 1DQRA 2ZSAA 3JS5A 4Q12A 1D2GA 2ZWOA 4Q3KA 4CEIA 2CJYA 3RFCA 8OHMA 3PBKA 3MM4A 3H3JA 2WD7B 1Q12A 5BNIA 1B26A 1JQDA 4V39A 3KYCB 2J7PD 3LFTA 3VNAA 1XV5A 5E1BA 3NGMA 4XEUA 4Q7QA 3H42B 2PU5A 1RPTA 2OEPA 2F2TA 4IWYA 3T4XA 1L5VA 3I42A 2ECOA 3GJQA 1T26A 3QU4A 3R3SA 3GH3A 1FNCA 1EBUA 2RHGB 5AOVA 1VJCA 1O5OA 3ASZA 4M1YA 4WRRA 2LCQA 4DDMA 1U4NA 1XZCA 3CX4A 4P2GA 5EWJA 5BR8B 3U7FB 4ZO9A 1IOWA 4Z9AA 3VO8A 4MQUA 4R69A 4BZPA 2ODQA 3CX3A 4EITA 1S02A 1SC6A 1WB5A 4HDRA 1EBFA 1BMTA 3P0JA 2VQ6A 4NBTA 3BZUA 5KDOA 4W9NA 1KAEA 1RI5A 2VK1A 1TTTA 2OCYC 2P90A 5L3ZA 1KZ1A 1IQPA 1SURA 3ENWA 3WKAA 3W8DA 3Q8WA 4FYJA 2PQ0A 2QGFA 1VKZA 5FLKA 3PNLA 5K8IA 2B25A 2PD6A 4IO1A 3I2FA 4D6PA 4ZVPA 5BN5A 4REQA 3GT7A 5LBUA 1GRRA 4IPTA 4YK7A 3LVBA 5F2KA 1DKUA 1H4TA 1H2XA 2PH5A 2R6CA 2YJTD 1C1XA 1FYXA 5CT5A 3R24A 4HYTA 3BQNB 2JRCA 5CXSA 5KNCD 1XX6A 2EZTA 4GGOA 4MVYA 5JHGB 1P0FA 4YONB 3VDNB 4LVCA 2VP4A 1XHEA 3GLGB 5HZHA 1XKTA 4KMRA 4MV0A 2CHEA 1XNRB 4MKHA 5L7WA 1QQ6A 1W0KD 1WXGA 4HT3B 2HJGA 3EMDA 3D8NA 2GN2A 1XF9A 4FD3A 4K26A 3EMKA 1ORIA 1Z2AA 4HD8A 5JJIA 3BWXA 4M60A 2AVDA 4QYMA 4TL9A 1IAVA 4EUHA 2P35A 2VRCA 3RUHA 1GUFA 1Y5NA 4K2HA 2C4UA 5ALTA 2R97A 3TOVA 3TW0A 3KOWA 2YH2A 1A0OA 2GOYA 3LT0A 4RTLA 3HKBB 5HKAA 2IIQA 3RLIA 3WKCA 3GC6A 1PWHA 3NRBA 4XB1A 3RVQA 2ZRMA 3U9LA 5AVQA 5K3CA 3T1VA 3QFFA 3G9QA 1I24A 4YLYA 9ABPA 3TNLA 1B1AA 2FW7A 1C41A 5TY0A 4ZAYA 1H94A 2VUHB 4X63A 1Y1QA 2O6LA 4CR8A 3ICQB 1OWOA 3NXKA 4YT5A 4REMA 5L40A 3BGWA 1OLUB 4F1WA 4OLBA 5E9QA 4ZK6A 3VSAA 1BROA 3GU3A 3WZLA 2PVSA 5C4IA 3IULA 1T8UA 3BORA 3OCJA 1LPAB 2Z1NA 2BM8A 3EVTA 3HPRA 3OQJA 3WTBA 4KJXA 4YQFA 2PH3A 1R9JA 3RV3A 5M34A 4D5GA 3MTEA 5A3QA 3D7KA 2Z3VA 2EERA 3W9SA 3PKJA 4OHOA 4MMYB 2DPGA 4DN6A 3QWHA 2Y9MB 4BGIA 2EHDA 4CQMB 1OILA 1YK1A 4O08A 4QARA 2K7ZA 4LXGA 1QF6A 1JWBB 3PFIA 4L6IA 1O0CA 5EMKA 2MR5A 1RM0A 4IFTA 3S7TA 5GONA 2FVYA 1NUTA 4KPUB 1E7QA 4ZT2A 4EDHA 2H65A 1GRCA 4XXHA 1THGA 4MUIA 3A3YA 4Q7EA 3X44A 4BUJA 3KALA 5ALVA 2B36A 1CHDA 4M7WA 2BBWA 1PVVA 1DUVG 3AWDA 4B3TB 1DAOA 1OQAA 3F7OA 5K0NA 2HLDA 4ALKA 1LK5A 3RRXA 3I34X 2B92A 2SKDA 3HCBA 4JT2A 1KSHA 2WINI 2IC5A 4N54A 1ZX1A 3T3IA 4E1BA 1T34A 1GZ5A 4G8CA 1CQZA 4H08A 5ALRA 1V3UA 3E5MA 1UKCA 4Q37A 2OYCA 3BFVA 3T9EA 3TJMA 3QKSB 1CKEA 3CWQA 1GQSA 5ARCA 4UTOA 1PX0A 4RA9A 1KJYA 4DM7A 1SVUA 4EW3A 3D3WA 3A06A 3WGOA 4Z4FA 2GAOA 4B48A 5C35A 3OE7D 5TJHA 4JX8A 1FSFA 2HK7A 1ZY2A 2RG1A 4R8MA 2VJOA 4B7CA 5TRTA 4BV3A 4PNZA 5T67A 3RTGA 3ZDZB 3J7AC 2BFDB 3IUYA 1P7VA 1PL7A 2G25A 1USWA 3V4ZA 4JBWA 4ZQHA 5JI2E 1N36B 4RK1A 1VGRA 2QPAA 2QI9F 1GT91 1II0A 2AKYA 3ZHCA 6REQB 4BWFB 1UEXC 3R6GA 5CYGA 5HOEA 3CVVA 1NG1A 4EO4A 4R1QA 3EW9A 1JG6A 2WSSD 5MN6A 1J99A 3ZK7A 1P7YA 1C9MA 1SVIA 1G38A 4P5EA 2ZVJA 1XMPA 3Q6MA 4TZTA 5A02A 5FEUA 2ZULA 3TAUA 2O48X 5HW0A 2I7DA 3N6RA 1AKEA 1DDGA 1N2IA 4JGBA 3K0SA 4ESOA 1MU0A 5REQB 3ZV6A 4DIEA 4DIUA 4CMGA 1E3MA 1BOOA 3OIFA 4ZANA 1NF2A 5ADVA 1XN1A 3ML1A 1O97D 4GOXA 3LMKA 4IRXA 1D4OA 1IBCA 4HG2A 1AGNA 1KKUA 2YASA 3PQ4A 4Q9KA 1X1BA 3W0LB 4BWGA 4XRRA 2BEWA 4F11A 2ERYA 1YWGO 2PSEA 4C0QC 3GXBA 3K70B 2UAGA 1FRZA 1U2SA 4P08A 1W4BA 5FV4A 2R6DA 5KTMA 1P29A 3AEQA 3CZQA 4AJ1A 1B1CA 5CFLA 2FG7C 3IIJA 1SU7A 3MZ0A 1NQUA 1REQA 4ZT4A 1SWVA 3M9LA 3KQTA 3RTDA 2W6NA 3T5TA 4QDJA 4J4BA 4RLFA 1TX4B 1AXEA 1ECBA 2F8LA 1KXJA 3FFTA 3I2KA 3KIPA 1EFRD 1XU9A 1CTQA 3NCTA 4RCVA 2BGWA 1BSVA 1KDOA 1MAWA 1YJAA 3B2QA 5ES3A 4PW0A 3RYIB 4QJ3A 2YY6A 5JQGB 1CBUA 2V5VA 1RCUA 1ONSA 4ETNA 3VNVA 2IOHA 3GK3A 3HDHA 3F7MA 4KZKA 3R7WA 1RHUA 3R3VA 1PT9A 3AKEA 3FDZA 2WHRA 1MV5A 1QV9A 3FSRA 1EA7A 2ZT6A 3TTUA 4ZKEA 1YQXA 1F2UA 2J3EA 3ELWA 3LM8A 5FA8A 1T4BA 4BJ5A 1QV6A 4Y30A 4ZCTA 4Q4DA 2CJWA 1QO7A 3K05A 4K1LA 5HM6A 3UKJA 3RYFA 4UDNA 2YYYA 4D98A 4LXIA 4Z7JA 2CYBA 2QMZA 4UBJA 4EA9A 4ZI7A 3MTAA 5KWSA 3MTGA 1JSLA 1WCIA 4DEXA 4PG4A 5A5VA 3K4HA 2PKEA 5DHPA 5BN1A 3STVA 5C2JB 5IVKA 2OSVA 2PQ2A 2A94A 4ZEOA 5L6LB 5MHTA 4CIDA 3ZVLA 3IIMA 1HLGA 1BYIA 1N5LA 1WMDA 5IHXA 2XZTA 1EA5A 2GEVA 3NC1C 1ZXBA 4NE7A 4PSAA 4ZVQA 3QMVA 1LLUA 2VZ0A 2L18A 4NABA 5BQ3A 1EXVA 1BN6A 3S5UA 5CT9A 1XRSB 3NM4A 3ZTTA 6LDHA 3REFA 1OSNA 3PQDA 1O0SA 3A4NA 3ZV7A 1KBZA 2BFNA 4PZYA 4NBVA 3ZLUA 1LF0A 3Q5GA 2BUBA 1DKOA 4NZ9A 4D3ZA 5HIAA 3AVUA 2O8EA 2Q1XA 3QXGA 4N0PA 4RESA 2ZRGA 1QDLB 3INGA 1QK4A 3H8SA 2BLLA 3TBKA 2OD9A 3JSXA 4UBNA 2QY9A 4O4LF 5DLEA 3V34A 3M34A 5K45A 3EFOA 5AUOB 1YOVB 4UPDA 3FHCB 4JROA 1B74A 4PSVA 5HBGA 5IYZA 4MS1B 2XT9A 3AETB 1UF9A 3KB8A 2XX3A 1QLWA 2XAUA 3HWSA 4KG7A 1JDVA 2GZ3A 4TTSA 5JMWA 4PEVA 2QTHA 2FSVC 1I7QB 5CB0A 4KVGA 1KOLA 2H51A 4MCAA 3LPLA 4OGKA 5ICGA 3C3CA 1QYDA 2F1RA 3NDRA 1N78A 1JR2A 2WZBA 4LWOA 4N49A 4XTRA 4G0WA 1DPGA 4GRDA 1M6HA 4CUKA 2CLKB 4OFWA 4JP3A 2V7VA 1V16A 3PNBA 2DHDA 1NBIA 1UIMA 2IF2A 2RI0A 1O89A 2BOVA 2IQIA 4RQBA 4QOHA 1OX4A 1QIGA 5B7NA 1GG5A 3LFHA 3OQ6A 3AR2A 4O4IA 1T9AA 5H83A 4US2R 1ITZA 5SY4A 1U1CA 4NK5A 5EVJA 3TVTA 4F5YA 2IU0A 5KYWB 1FFBA 2ECQA 2DTEA 3K9QO 3LLMA 3I9FA 4IV8A 5ALMA 4B71A 5AKJA 5BNZA 2GPYA 2IXBA 2QRNA 4OXXA 3RU2A 4X44A 1NYLA 3WHLA 4MICA 1HEUA 1Z0SA 4HWTA 2BM9A 5CB4A 2HNAA 5KJCA 1XZQA 3LXRA 1A9OA 3DEAA 1WU8A 5B53A 4YUAA 4RTQA 4Q18A 3HUUA 3TUZC 1C4WA 4PNHA 4H18A 3RLFA 3UM9A 5BN3B 3L4BA 3WJ7A 4EFDA 1PNRA 1XLTA 4UHHA 1H1DA 1F8XA 1JXMA 5EYPB 5E4JA 5FOUA 3PVSA 3U6KA 2AFIA 4H7IA 3WS7A 4W1SA 4DDWA 5DOVA 2JAHA 4FYPA 2XKJE 3KYDB 4R9SA 4ESHA 3G6KA 1SD1A 5M2QA 3DE4X 2YYSA 2JD0A 2OQVA 3HUFA 1KSGA 1M75A 3LX6A 3F5FA 2HWWA 1IZ8A 4LVOA 4B33A 5ECWA 3EVGA 1IFXA 3O75A 3ZWXA 1P4RA 2O8VA 1U02A 2BFAA 3HKCA 3ZI7A 3JRXA 5LA6A 2ENWA 5L6MB 4D42A 2C3MA 3ODGA 4LQDA 2H1SA 2VUUA 1YDFA 1KJNA 1IK4A 3ZY3A 2G5CA 4BFCA 1NT2A 3FB1A 4OI1A 3PPXA 2XRMA 4KXXA 5IBCA 4GC9A 2Z2KA 4Z3DA 3HLKA 3H1TA 1Z4NA 2FCAA 2CY0A 2PWAA 2QL6A 3URKA 3RF7A 3BMQA 4X60A 1SMKA 1ZISA 1TPZA 4MUYA 4I50A 2J09A 4RMHA 3N5KA 3UIEA 3NGXA 4HDOB 1SA0B 4CMIA 4BIMA 1M73E 4X20A 5EVCA 4EA7A 2G9ZA 4MNTA 1YMQA 3IAFA 4K9OA 1KHHA 5HGXA 3WGHA 3BXXA 1F0NA 2ZRKA 1M2GA 2HC9A 3G13A 3PC4A 4IY1A 4DWWA 2YQ4A 4PAGA 4DEVA 1A8SA 2Q1TA 4QQKA 1U5CA 4ZXFA 4A8JC 1IUPA 1R9GA 5LQRA 1V6AA 1P45A 4LV8B 3H11B 3EDYA 3RJZA 2SBTA 5CVCA 3GHYA 4YP0A 4C1NA 1EX1A 1KYVA 5EJEA 5M29A 2Y66A 4QJ4A 1PYOA 1ORWA 2BFMA 3GFBA 4KDCA 2AYZA 4TYNA 3A3PA 2NZ2A 2I91A 1E58A 1GQRA 2Q3FA 4M3NA 3MNFA 1XTPA 3KE9A 4XX0A 5KAPA 2IXTA 3SC2A 4DREA 4MPRA 3SP1A 5K4HA 1OH6A 2ATEA 1CY4A 3ZN2A 2QJTA 1S3GA 1K27A 1T8TA 5KX5A 5DMXA 1WUYA 5F7XA 2I34A 5E3JA 1THZA 5F4ZA 3TLKA 4PFKA 4BRSA 3I6MA 3COVA 5HVNA 4MWOA 4B4DA 3S81A 2FWNA 1V47A 3REQA 4NBUA 2FR8C 1V8OA 4B44A 1CUWA 1SVOA 1VZ2A 4K6CA 4QG7A 5CBPA 1C2YA 1OX6A 2Y1CA 5DASA 5I7RA 1YR1A 4ZDIA 2B4RO 2JGIA 4KDFA 3HXLA 1GNPA 1XALA 2YWCA 5B4VA 5IT5A 1LS1A 4KI7A 4OQ4A 3I9OA 2UUBB 1R00A 3BSWA 4G9BA 4PLYA 2EJVA 2Q1UA 4G1FA 5ICFA 2E1RA 2ZVDA 1WNTA 3HA2A 3IURA 4LXYA 3RSCA 2X77A 3IT2A 1QVVA 1J42A 1J70A 1Q7EA 3V4FA 1RRKA 1Z6QA 3M8KA 5EIWA 1NW7A 5TQ2B 4BBZA 5JCJD 1KK2A 4HJXA 4H4EA 3S28A 1ZCJA 2VPTA 2X3FA 2R47A 4MKZA 4NHOA 1EMDA 4PS1A 5FUBA 5K3SA 3VVLA 4EFKA 4IQ4A 1DCTA 5COBA 1GIAA 4MIYA 4TMKA 4JEHA 3VOBA 5CAEB 4HUTA 4RQTA 3L1UA 1ZU4A 3IVAA 2AWNA 2NUPA 4NYJQ 2VZLA 3FCUB 1SCBA 4XDHA 1GDTA 4PN7A 3EH2A 1WL8A 3DXZA 4R16A 5JHHB 2UZ1A 3DO8A 4JYPA 2G70A 2YWFA 2YY7A 5ADUS 3QBJA 1N2JA 1NNSA 2H1LA 1JQBA 2EEPA 1KL7A 1URPA 2GARA 1T1EA 1GAEO 1KNQA 2EF1A 1QE5A 4O29A 4I3FA 5JE8A 4F4FA 4TUYB 2VPXA 4BPRA 3SIXA 3D6UA 1Y6RA 2IPOA 1KARA 3VR5A 2EGHA 1UBUS 2WJAA 3WAGA 2OLJA 1NN0A 3W4IA 3H0KA 3GDHA 1CB7A 4CM7A 4GVPA 1LJLA 4OM7A 5KMGA 4V2IA 3VVMA 4R2JA 2AHOA 1CZNA 2KWIA 3FYUB 4FFDA 2VDOB 3ED5A 4HXGA 4V0RA 5D86A 1V8PA 3MRTA 4YREA 3TPZA 4JP2A 4GF5A 3TD6A 5E9AA 4IL5A 1P60A 4DT1B 2WYOA 4PZEA 4WBNA 1LLFA 5JQWA 1HNNA 2QTBA 1TM5E 1XL0A 3FFBA 2FPKA 4KYIB 4URHA 3PHCA 3WICA 1G5PA 3SYLA 1FLVA 1V3VA 3GVPA 2P30A 3ZUPA 9LDBA 4IIJA 4DCNA 3GFVA 4INOA 4DHEA 3RNOA 1X19A 3DE1X 1FLNA 3JD2A 5HA5A 3RC1A 4V02A 4CMKA 3SR0A 2ENUA 2R79A 1DX4A 3DTYA 3EA0A 3RS5A 1UDBA 2QTCA 2ZBRA 2C7GA 4CJXA 3LUBA 1UIRA 1XRMA 4OG2A 4HNUA 2JG3A 1R5JA 4EJ0A 4TWAA 4XI9A 3S1AA 2ZIUB 3OEEA 4WZBA 2CN1A 1BMFA 2R2AA 2E9SA 5ENZA 1TW2A 3OOEA 4LQ4A 2C61A 1TLFA 2A8YA 3F6PA 3LQFA 4ZAFA 2ZRIA 3FNBA 1UFRA 3I1IA 3K0CC 2HIHA 3H7AA 1LS6A 4MUXA 4BNIA 2PUCA 2D1TA 5U9CA 2GO1A 1FQJA 1OI3A 4EJ2A 4MOWA 3SM9A 4PGHA 2XADA 3E5RA 3X1KA 4DV2B 4IP0A 2AJTA 2Z1DA 3CWCA 2ZRHA 3OQVA 3ESYA 3QX9A 4F3CA 2OD7A 1ZINA 1OZGA 2HBZA 2ZTVA 3HYCA 3M4XA 3ONNA 1KS2A 5EP1A 3ZOZA 4A73A 2HRBA 2HHJA 4TT8A 3P9YA 3FTNA 2H00A 2AMVA 3PCXA 4MVJM 4MPJA 3TFQA 1H05A 1CJBA 1P6QA 3PT5A 4IIGA 4P7FA 4PINA 4DCJA 5AICA 3BFKA 4DQKA 2P9ZA 1Z5VA 1N5OX 1QB8A 1EK1A 4HS9A 3DNFA 4RY2A 3CN9A 4Y2HA 4ZT3A 1RAFA 3DLCA 1E2GA 2P2LA 2BE9A 3FSEA 4YROA 3VYTB 1XDDA 4Z0PA 4GX2A 5ALHA 4LHYA 5TPZA 3DNPA 5K0CA 3DDWA 3RUCA 2UZ3A 1T2EA 1QHXA 3DZHA 1FBNA 1ZNYA 1DBWA 2EW8A 3FMPB 4BLOA 2OTCA 1D2NA 3A70A 1YE3A 5HMMA 3OIWA 3QHQA 1XXLA 1KI2A 1OE0A 4YAJA 4C2BA 1Z8HA 3A9TA 1M5UA 4LJ4A 1JPNA 2X14A 1IDOA 1K8QA 3GG9A 4CL0A 3HBJA 4PX5A 4RVNA 2BLNA 2VHEA 4MV4A 3OP4A 4N40A 3FTEA 3G9XA 1EK0A 4ZVLA 2HADA 4WN9B 5D3MA 5TNXA 5THKA 3WGLA 2AC7A 1SCDA 3L0PA 3W04A 4FNAA 2AD5A 1EB9A 4H7KA 1VKJA 3A1WA 3D0KA 4FU0A 1UPAA 1AKRA 2B98A 3LX8A 3OZIA 1RM4A 3STWA 3EOBI 4G3XA 3ZD9A 4N0EA 4IOKA 4CEJB 4DA9A 4LXXA 1DBRA 3BE4A 3VAZA 2ZSJA 4M21A 1L9KA 4YT2A 2KYRA 1VGQA 2C5AA 3ONWA 4U7JA 5HZGA 4TQAA 2G9UA 5HF8A 1OLOA 1FP7A 2XCIA 2WVHA 2W4IA 3PNPA 4YCAA 5GM1A 2YVAA 4CTJA 3MMPA 5BMVB 1PW5A 5D1NA 2K7FA 4KPYA 1IG0A 5FLYA 4J76A 3M70A 2WKPA 5DP1A 3KKMA 2IP4A 1K7FB 1QIEA 3A4YA 3D1VA 3DDCA 4U2DA 5BPFA 3ESDA 5ELLA 3E3LA 1U2ZA 2AXEA 2E5WA 1WBDA 3NDBB 4JHXA 4D26A 2IELA 2LCFA 5FORA 3PR3A 1YUNA 4JEIA 1JU3A 1M83A 1PJRA 1ZI8A 1Z0ZA 3A6EA 3CVJA 3GJ4A 1M2WA 3KD3A 3L06A 3Q7QA 5I5EA 3DMPA 4ZV4A 4PYQA 1KFJB 1GZ6A 2ZLBA 3EVCA 2APJA 2G0AA 1GGKA 3FAZA 3GCWA 3FDJA 1KYYA 2XJ4A 1HK7A 3QVUA 4JBNA 1HSOA 3B6IA 2H1WA 4A7PA 3CE6A 1C7FA 2GEDA 5HM8A 3ADCA 4JBIA 3WL7A 2DQKA 3E3AA 1V3QE 3ORRA 4JL8A 2UUAB 4L7QA 1B15A 5JXIA 2DKOA 1JHQA 5CEFA 4ZMRA 2PYZA 1LB1B 2LE0A 3CM0A 3LQ4A 1ZD1A 3PKIA 2GF0A 5KCZA 2JI6A 7ADHA 5E6SA 5FI5A 2QD5A 3AEXA 3LT4A 2VUSA 4OAOA 5H02A 4Z0NA 5IN4A 5K0FA 1MVOA 2AE2A 3PXEA 4TMYA 4UTPA 3WBFA 3F67A 3GWZA 4HAZA 3R9WA 2DAPA <