5ES3A

Co-crystal structure of ldh liganded with oxamate
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
328
structure length
328
Chain Sequence
KDQLIVNLLKEEQVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase A chain
publication title A Streamlined, Automated Protocol for the Production of Milligram Quantities of Untagged Recombinant Rat Lactate Dehydrogenase A Using AKTAxpressTM.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 113
structure length 328
sequence length 328
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2015-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5es3A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5es3A02
4DXHA 9LDBA 3PWZA 2H6EA 1JLLA 1UP6A 4F45A 3K5PA 4LMRA 3RU9A 3BZUA 4ZQEA 1LEHA 3ZU2A 4A7PA 2O2SA 4UEOA 2GYYA 3ZWXA 4E31A 1Y81A 1YH3A 1MA0A 3SEFA 1FDTA 4I8XA 1XLTA 1BRMA 2W4QA 4PLGA 1CYDA 3ENNA 3FTNA 1NQ5A 4BNVA 3JQ7A 5G0UA 4A5OA 3UN1A 1JN0A 4DMMA 3GG9A 3LC7O 3FD8A 1LC3A 4FIZA 1KIFA 1QG6A 4QSMA 1HWYA 2O4UX 1D4FA 3AUSA 4ND3A 4TROA 3WLFA 4CL3A 4GQAA 1ZMTA 1UZMA 2AEJA 4UVDA 1QYCA 3DHYA 4C7JA 3ADOA 3VZRA 4GLLA 3VTZA 3ZWOA 3SXPA 3KEQA 4L75A 2GZ1A 5L7YA 4DQUA 4YR9A 2GNAA 4R1SA 3EHEA 3FWZA 4PZEA 4BGEA 1DC5A 1H0KA 2BGLA 3GFBA 1HLDA 4F3YA 3PHGA 4KUGA 1B3BA 5F5LA 5KKAA 5G4KB 3DAGA 2I76A 2ZYGA 2EEZA 4BVAA 4B7XA 4ZQHA 1T2AA 4RZIA 2WWRA 1GCOA 5I7EA 1JWBB 4HY3A 3O8QB 2P9GA 3GMSA 2W2LA 1GL3A 1HEUA 3AM4A 2NM0A 2PY6A 3RBZA 3B1JA 4CLDA 4IY1A 4L8VA 5ADHA 1B0AA 1DRVA 2I5PO 5BQFA 1XR3A 4CQMA 4GH5A 1ML3A 4BB6A 1E7QA 3E9MA 3HFSA 1PQWA 1WPQA 1ISJA 2FPGA 3JQDA 4DWVA 2GF2A 1KVRA 1U4SA 3PGJA 4XRRA 1F0YA 1B8PA 4IGFA 4CV0A 1MFPA 1YS4A 2D1YA 4DREA 1O89A 3W4KA 1ZKMA 3F46A 5G0SA 2YFQA 4ALJA 5ENDA 3C24A 2CNBA 1YGYA 3D3EA 1U5AA 3X2FA 2GZ2A 2IXBA 2ET6A 1ZJZA 3Q9UA 1DAPA 3FF4A 3AOEA 1JAXA 4G5HA 4P4LA 4BO6A 1E3IA 1B26A 2WYVA 3INGA 1GQYA 3IUSA 3PHLA 4K28A 2IZZA 3CZRA 3RUEA 4FC7A 5DCWA 4XZ3A 4YAIA 2D0IA 2ZTMA 4R41A 2CY0A 4UVGA 3QA9A 4Y6RA 1O95A 3WGOA 2ZTLA 2CZCA 1HT0A 1SZJG 1HE4A 1JVSA 4XJTA 1GUYA 1PJTA 4UULA 1VSUA 5JAMA 4K9DA 4WOJA 2P4QA 3BHJA 3DBRB 1EBUA 4NBTA 2ZYAA 3HUDA 4JN6B 4Y67A 3GLQA 2ZKLA 4NI5A 1PL6A 4JJFA 1E1LA 4YAEA 1TVEA 3MJ4A 1WMAA 3KYCA 4J0FA 5IZCA 1JA9A 1YB4A 4RF5A 5BSFA 1V3VA 2WM3A 4J4TA 3JYLA 8LDHA 4YCAA 1U3VA 2XAAA 1VI2A 1XHLA 5T8KA 1I2BA 4BO0A 2YDYA 2PGLA 2DT5A 1PZGA 1LJ8A 3NGXA 1YJQA 2J3JA 3JQ8B 3PYXA 3B1KA 4TZKA 4QXMA 3NT2A 3KSDO 3PJEA 4QTZA 1DIBA 1FJHA 1J5PA 1RM4A 3PYMA 2YHIB 1FK8A 1BDMA 3N74A 1IHYA 1NFFA 1KC1A 5EMHA 3OH8A 3ITKA 4ZICA 2VHYA 3NDIA 1T24A 5AVOA 2C0CA 3U3XA 3A4VA 3R0IA 1C1DB 1CERA 4CMAA 1PZFA 1I24A 4GWGA 3SC6A 3BXXA 4ID9A 4I08A 4IQ0A 4PLPA 3VH2A 4BB5A 1P1HA 4BNMA 3ROMA 5KOIA 1C0KA 1UXJA 1K3TA 3AY7A 3H9UA 1MG5A 3EY4A 1L7DA 3GRKA 4FFLA 2YQ5A 1QYDA 4QFDA 1Y8QB 3AJRA 1NXQA 4TRRA 1M67A 4L4RA 3TL3A 3F4LA 4FFMA 5DBFA 3UCXA 3HSKA 3PZBA 4NBWA 1B14A 2BELA 3PHHA 2GN6A 3BYZA 4CL8A 5IN5A 2VRCD 1PJ4A 3OSUA 5AXBA 2F00A 2HDHA 2QRKA 1SCUA 4NU6A 1N5DA 4Q3DA 1YBVA 1L7EA 3WQRA 2HJSA 1Z74A 4M49A 1VRWA 3KSZO 4UUPA 2QZ9A 1AN9A 3H5RA 3F47A 4XYBA 4LRTB 1EVYA 4U8GA 5IAAA 1B8VA 3PFFA 4CM8A 2FN7A 4CM8B 1IL0A 3VH1A 1U3TA 2HMVA 2HK9A 2Q1UA 3G1TA 3ROQA 2O50A 5KVQA 3ZWYA 3JYOA 4DPLA 2B4RO 2P9EA 5A05A 2G0TA 3JSAA 2V6FA 4PLHA 5KJ6A 1Y5RA 3DTYA 1N1EA 1CQJA 3VHRA 5EL0A 2VTEA 5DULA 4B8WA 4GVLA 3JQBC 2QHXA 5DT9A 4BKQA 3BTOA 4CQLB 5EIOA 5HRUA 4FB5A 3HN2A 5KJCA 3K31A 2EGGA 5DF1A 3JD4A 1X1TA 3JQ9A 3LK7A 3DDNA 3K6JA 1EK5A 1KVUA 2GZ3A 3L9WA 2WD8A 2W2KA 4GX1A 2W2KB 5JDCC 3WBBA 3ZHYA 2JFGA 3WBFA 3U4CA 4AJEA 4U0JA 4UEKA 1LRJA 4C7KA 5JSFA 3LF1A 1H6CA 2WJPA 2O3JA 4QX6A 3RBVA 3EUWA 2IZ0A 4Q3AA 1H6DA 3LLVA 5JCJD 5IN4A 1PR3A 1U3UA 2Y66A 3HDJA 3T7EA 5EN4A 5JO0A 3HHPA 1V6AA 3AY3A 3DAPA 4CMGA 2EKPA 3BA1A 3ASUA 2BI7A 1KYQA 3JQAD 2IZ1A 2VWPA 3PQDA 4J90A 1PJBA 4UUMA 5FEUA 3GF4A 1WDMA 3O03A 5DN9A 3RWBA 3VC7A 7MDHA 4E5MA 1G0NA 3R3SA 5LDGA 1IPEA 1BXKA 4GSKA 1IYZA 3CSDA 1HKUA 3QE3A 2D2IA 5TGDA 2DUWA 2FR1A 3GAZA 1MXHA 4HV4A 2QX7A 3H9JA 2GN4A 3WQSB 5HS4A 3FHLA 4WCFA 4WCFB 2HU2A 2X9GA 3H9EO 4IQGA 4LCEA 3L4SO 4D7AA 2CFCA 1VPDA 4D41A 1R4NA 3RBXA 1R4NB 3FPLA 4RVFA 3DC2A 1H6BA 4EUFA 1RM0A 4P38A 1Z73A 1GZ4A 2EJVA 4RF3A 1S6YA 1ZNQO 5I7SA 2DC1A 4DUPA 2WYUA 4I5GA 3FBTA 4RLHA 4I9UA 4HFMA 1KS9A 4O6VA 4E21A 4FFNA 4XQ9A 5TX7A 1DFHA 1M6WA 1QYVA 3DOOA 1K5HA 4ZVVA 4E13A 1XCBA 2DTDA 3ZHXA 1GPDG 5F3RA 1RYEA 5L9AA 1ZK0A 4GVXA 3HG7A 2VHWA 1ISHA 4PG7A 4MVJF 3WDSA 4YT2A 3ZNNA 1I0ZA 4D0RA 1T2EA 2DUUA 4PLZA 1WVGA 1NPDA 3UHAA 1VSVA 3ZHZA 1BVRA 1ARZA 2Q1WA 4BV9A 2JCXA 3RUAA 4Q39A 3RC1A 2B69A 1TT7A 4W99A 1V3TA 3AOGA 3EMKA 3I9LA 5I7FA 4JCOA 3HB5X 5JY1A 3QLJA 1R4MA 1R4MB 5T67A 4BO9A 1BTOA 3VH4A 4CR8A 1RPNA 1BSVA 2ZQYA 4I5FA 4DGSA 2XXBA 1GZ6A 1HE3A 4IIVA 4UUOA 4W9NA 3TRIA 3RUIA 4J4HA 4A10A 2Q4EA 3VPHA 4MVJD 1HDZA 5KWEA 1Y8RB 2FP4A 4J2HA 4EW6A 1ENPA 3S1LA 2IEBA 4IDEA 2FPIA 4OIMA 3WTBA 4HWKA 3NJ8A 4RPKA 2D5AA 1DLIA 4DRYA 3D5QA 4OSOA 1I01A 4OGWA 1YB1A 4FS3A 3GVPA 4OM8A 4NK4A 3TSCA 2AQKA 2GGSA 4L4SA 5JDIC 1Z75A 1YL6A 2CF5A 1OZAA 4YJHA 4ALIA 4FBGA 3ZW9A 1PL7A 3DOCA 4LSWA 5I9NA 1A4UA 2E4AA 3WGTA 4BO7A 4NHEA 1S7CA 1X7HA 4ZA2A 4FN4A 3JYNA 5JC8A 2BFMA 4IMRA 3TZKA 3QWAA 3H9GA 5F5NA 2VZ0A 3F1KA 4M54A 1GEGA 3TDKA 3OJEA 1P9LA 3QVSA 4CLEA 1XGKA 3HNPA 3S55A 2GD1O 5AXDA 3VZQA 3KHUA 5KKCA 2V7PA 1P31A 4U5QA 2CVQA 1AXGA 3A06A 3PXXA 2Y1FA 2I6TA 3G3EA 3DMTA 4BMVA 3RAJA 4B4UA 2WD7A 3KO8A 1VJ1A 2B37A 4ILKA 2AG8A 5CDTA 2H63A 4WECA 5ILOA 3NUGA 4CUZA 1UDCA 4JIGA 4PLFA 3WNQA 3OJOA 4XX0A 3S2FA 2D4AA 4H3VA 3D7LA 5COBA 5L3ZA 5CFZA 3UKOA 2PA3A 1I8TA 3TZQA 2BFOA 2DBQA 2NACA 4RF2A 1ZMOA 3JTMA 4NJMB 3UF0A 4DLBA 5HM8A 3MOIA 2PKQP 3E9NA 2GR9A 3PQEA 1ZEMA 4EITA 3WICA 1M6HA 1WXDA 3U4DA 5ITVA 1X7DA 2BFAA 2QRJA 2W8ZA 4PLWA 3LLSA 1NX6A 2PWZA 1ZSYA 4EEZA 4GL4A 1DOHA 4WEOA 1QLJA 3S2GA 4WEQA 3TWOA 1QYXA 2GASA 3T7CA 2HCTA 3EK2A 3JQ6A 4KOAA 3IL2A 5KTKA 4YEDA 4XGNA 1XIVA 3V1UA 4RF4A 1AXEA 4XB2A 1MC5A 2NU9A 1H2HA 1YQXA 1VLLA 4LMPA 3DO5A 3I9NA 3IP3A 4FSHA 3I4FA 3WFIA 4BNUA 1VL8A 3ETDA 4R68A 4WLOA 4B4WA 2Q3EA 1QMGA 4LCJA 2DBRA 2FR0A 4DLLA 2P9CA 2GERA 5HA5A 1YKFA 4YB8A 4J7CA 2YV3A 3FI9A 3TFQA 1RWBA 5KVCA 3L4BA 4M1QA 1UZLA 3GEMA 3PDUA 4OYRA 1PX0A 3I9JA 4FJ0A 2FPPA 2V65A 4MVJM 3T4XA 4MDHA 2DFDA 2EIHA 5CDSA 5THKA 3ZWMA 2OBYA 3AUTA 3GGOA 2P5YA 1RKXA 1ZJYA 4EJ6A 1QYWA 2FHSA 3H8VA 4OOEA 5EESA 1Y1PA 3NGLA 4I9HA 2UVDA 4MKZA 4JX8A 1ZW1A 1P74A 2BRUA 2AEFA 4PZDA 4UVHA 4XEHA 2CVOA 1QKIA 2VHVA 2I99A 4WPGA 4GLOA 1Q2XA 3H6KA 3KZVA 1O6ZA 3VVBA 5JNLA 1P77A 2CUKA 4OO3A 3FBGA 4YAJA 1ZEJA 1VL6A 3OQ1A 3PLNA 2XPCA 2VYVA 3FNEA 4I5EA 1P1JA 2Y1EA 4UREA 1KEUA 4BMSA 3PVZA 4PLYA 2R00A 2HRZA 3RU7A 4ZRMA 4BO8A 1I36A 1WAMA 4XCVA 4TRJA 2DM6A 3LSYA 4IZIA 4MPDA 4MVJE 4D3SA 1ZCJA 5L40A 1SMKA 3ICPA 3Q0EA 3ZWWA 4ZQBA 3P2OA 1A9ZA 2Y1OA 4B7CA 4LGVA 2YY7A 3PHIA 3BMNB 2HUNA 4WNIA 4ESOA 4CLXA 3JQGB 2CD9A 3CEAA 3BMOB 1DFIA 2J5KA 2O3RA 3L0DA 3QV1A 3O4RA 5GZ6A 4B79A 1K6XA 4GPD1 2NQ8A 2HMSA 3DTTA 3I9MA 2JD1A 3CMCO 1MLDA 5F1OA 4II2A 1UXKA 4FDAA 3PDJA 3OHSX 4YWJA 3UH1A 3H7AA 2PGJA 5JC1A 2AE2A 4YJDA 1H93A 1NYTA 2DPGA 4S1VA 1LDEA 1LDMA 2Y99A 1KVTA 5AOVA 2VOJA 4IPTA 1A7AA 1SO8A 1UH5A 2X4GA 1OMOA 4NK5A 2EP7A 3ZWBA 3JQAA 3LU1A 4JBHA 2QYTA 5A9TA 4AJKA 2PKRA 4YACA 1SEPA 1W0CA 1E0DA 3AU9A 4ZHSA 1NASA 3RUFA 4HFNA 5LDHA 4FCCA 3MJEA 4CM5A 3QVWA 2EG9A 5CDGA 5KJEA 5IDXA 5B12A 4E2XA 4BGIA 1CF2O 2Q2WA 4U6SA 3K73O 4QO8A 1YOVB 5EQFA 3VVCA 3RFTA 4BO4A 1E92A 2NSDA 2Q4BA 3LT4A 4P22A 2FZEA 2VHXA 4O63O 2J5RA 2NLOA 3QWHA 4MVJP 3GHHA 4B7UA 1LSUA 4MP6A 4NDNE 3ZV5A 4RGBA 2OP0A 2PZJA 5L7TA 1B2LA 1T2DA 3G17A 4HKTA 3UGKA 1JDJA 1XU7A 2YZ7A 4TQGA 4D42A 3FR7A 5T57A 1LRKA 5MDHA 3CMMA 2G82A 3VPFA 3ULKA 4CM4B 5I8ZA 1Y6JA 2WSBA 3GOHA 2FWMX 2DAPA 2JHFA 4K1LA 4ZJUA 1LI4A 3MCVA 4RDIA 2O2YA 4CV3A 1Q7GA 3PGXA 1NQOA 3U0BA 1HRDA 1PTJA 3B6ZA 1E6WA 2X86A 4YVFA 1DRUA 1HDCA 2NV6A 3CTMA 2QW8A 1WZIA 4TMFA 1EUCA 3FTPA 1JW9B 5H81A 3CXRA 3UAGA 3JQEA 3GVIA 4E0BA 5K0ZA 4LW8A 4EUEA 1VE9A 1SPXA 1U8FO 3C85A 2QG4A 3DBHA 1GAEO 1YBAA 3DBVO 3JQ7B 4I1IA 5FYDA 2CDBA 4RZHA 5CDUA 1DC4A 1KC3A 3S2EA 2Z95A 5C5IA 4R4JA 3O9ZA 1E3SA 3MJVA 4K6FA 3VZSA 2DQ4A 1LBEA 4ALNA 1DIHA 3NYWA 4CMBA 4ZQFA 1SB8A 1I30A 2IYOA 4W9NC 4NU5A 1ENOA 3DONA 3QW2A 2YQ4A 3K2BA 3GGGA 3MJCA 3ON5A 4GMFA 1CETA 1LQUA 4IS3A 3TZCA 3WS7A 3OQ6A 2TMDA 4A0SA 4MO2A 2JFFA 2JHGA 2HK8A 4CODB 4XB1A 3RQSA 1OBFO 4Y6SA 3HE3A 3BMQA 2A35A 3ROPA 2I67A 4BKPA 3L6OO 2VTDA 2PK3A 2JJYA 5DBIA 4PRKA 3TF5A 1H9AA 5A3JA 4MP8A 3QY9A 3EC7A 4U0KA 1GV1A 2C7VA 4CQMB 1UDBA 3AI1A 2JCVA 1JKIA 2EERA 2JD0A 3H2SA 3GDFA 5JAIA 4KP7A 4MKRA 4B8ZA 1UJMA 2B36A 4ONEA 3SLGA 4N5NA 3GGPA 5KVVA 2UAGA 4KUEA 2VUTA 4GX5A 2I9PA 2DVMA 1GYQA 4EUHA 2VN8A 3H5AA 5IF3A 2ILTA 4Z9YA 5I9LA 1LTHR 1E77A 3U49A 4E6PA 2O7SA 1U4OA 3PQFA 1EDZA 5BSHA 4BV8A 3LC2O 4CLHA 1I3NA 1Q0LA 2H5LA 1GYRA 3FNGA 3NT5A 3IUPA 3OBBA 4CUKA 4IDGA 3P19A 5F21A 4QT0A 3RJ9A 3KETA 1R0KA 3JV7A 4LVUA 2AMFA 2DBZA 1GADO 1N92A 3IS3A 4BIIA 1ISIA 4EBFA 4M86A 1LNQA 1E7WA 4NBRA 4CM9D 1ADFA 3ASVA 1SB9A 3OIDA 3OJ0A 1H5QA 4XR4A 4WLNA 1M76A 2IODA 1Y5MA 3HJAA 3QSGA 2AG5A 3NEPX 3MTGA 4RVHA 4F6LA 1K6JA 3VKVA 3VH3A 1H94A 1NFQA 5BNIA 2OORA 1CEQA 4TVOA 4E2WA 2Q99A 4ND1A 5FFFA 5T64A 3ZU5A 5TNXA 4A03A 3DEYX 1WZEA 3AY6A 3KYCB 4R9SA 1KERA 1U2GA 2O3UA 1F14A 4XYLA 5FF9A 5L95A 4NG5A 4GBJA 1C1XA 3K92A 5F1PA 1R0LA 2Q49A 2VHZA 3GZNA 1N2SA 5JFOA 2VWQA 1LDYA 5TRTA 1EUZA 2NUAA 2X5OA 2CVZA 3OIGA 4C4OA 5JE8A 4O1MA 1CQIA 1E7RA 1JVBA 3KTDA 1PJSA 4MOWA 2VT2A 2YDXA 3TL2A 1EDOA 2BGMA 3DZGA 2VNSA 1NHWA 1M75A 4M8SA 2DTXA 1GTMA 2ZB3A 1VM6A 4DQVA 1CWUA 3IC5A 5JBIA 4CM3A 2BD0A 4AJNA 5JS6A 1G1AA 2RHCA 1K0UA 1KVSA 2VT3A 1LLCA 4IJKA 2AHRA 2PH5A 2C7GA 1MC4A 1W4ZA 3BTVA 4D3DA 2CF6A 2CSUA 2PD3A 4CLOA 3VTFA 4E30A 2FSSA 3JQ9C 4H16A 1BXGA 4JNKA 4E33A 2FZWA 4MIYA 1KY5A 2WEKA 4MIEA 3V2GA 2UV8A 4CJXA 3WR5A 1PQPA 5F1KA 4PLCA 4OQZA 3PHJA 4DTIA 1LLUA 3EDMA 5JPIA 1PGPA 3FCOA 1DIGA 1OOEA 3ZW8A 4OSPA 1U3WA 1U7HA 1MG0A 2ZB7A 4TKMA 5BSGA 2EHDA 1SAYA 1XG5A 5TF4A 1NWHA 4A27A 1PSDA 2EXXA 3ZCXA 2ZCUA 4E5PA 1ONNA 3RKRA 4QECA 2Q1TA 3MWDB 3EGOA 2Z1NA 4R54A 3TOZA 1EQ2A 4GMGA 1R37A 3E18A 1P45A 5IG2A 4HNGA 3GH3A 3R1IA 4XGIA 3VKUA 1U2DA 1XKQA 3WXBA 1ZK2A 2HRBA 3SJUA 3VPSA 3RUCA 1OC4A 4R01A 4DIFA 1U7TA 2YJZA 4XD2A 4NZ9A 2OGUA 4BNTA 2EGHA 3MTJA 5JO9A 3DZKA 4E2YA 2AQHA 1XQ1A 2Q2QA 2RIRA 3MEQA 3ZNOA 2Q1SA 4RLSA 4BNHA 2AW5A 4J16A 4FGWA 1YONA 4WCFC 1HZJA 1ORRA 2X23A 3F5QA 3O38A 2PR2A 4Y8VA 5H83A 2FSVA 2JD2A 3UVEA 3DHEA 1Q0HA 4A73A 3AM3A 4RCVA 3VPXA 5ICSA 5U1PA 3E1KA 3BMCA 1T2CA 3BMCB 3GA0A 1YDEA 4IDAA 3OM9A 4JXKA 1U1IA 3OA0A 4KQXA 1CIVA 3TFOA 3UICA 3NX4A 1ENYA 1YXMA 3OJFA 3Q11A 1GUFA 4AJOA 2TMGA 3ZU3A 4QUKA 3JQCA 4Q3EA 3ONEA 1HDYA 1UR5A 2VCYA 3K30A 5BT9A 1PJQA 4DVJA 2B83A 1EVIA 4FQ8A 4IXTA 1Z7BA 2Y0CA 5C7LO 2ZCVA 1FDUA 4WGGA 1HSOA 4X54A 2Q50A 1HYGA 3DZHA 5HS6A 1I33A 1NNUA 4J7XA 4PLTA 5TT1A 3VZPA 1DDOA 3E48A 3HDYA 4L9RA 3OFSA 4D3FA 1A72A 4AJPA 4O5OA 4TWRA 4RPJA 2GO1A 3WX0A 5HTOA 1RYDA 2HQ1A 2J3HA 2EKLA 5ICMA 3H2ZA 1HL3A 2OOSA 3HQ4O 3CZMA 3NTQA 4FFRA 5DP1A 3ZZNA 1DIAA 5HBRA 3I5MA 4UUNA 2DBVO 3DB2A 4IZHA 3E5MA 4ZU3A 3WGHA 3D4NA 3GRPA 3W6UA 2NTNA 4UAGA 3HFGA 4Q3NA 1MP0A 2X0RA 3WMXA 2Y0EA 2GSDA 5A9SA 5I9MA 3M2PA 2C07A 4JK3A 3AU8A 1YQDA 3KLPX 4BKOA 3QJ5A 1LRLA 1LU9A 3KSUA 3ZDFA 3LVFO 4F6CA 4PG8A 2EWMA 1JTVA 2OMEA 3C1OA 4FFOA 3RI3A 5A4DA 4ZN6A 5KVSA 1WLYA 3QVOA 4L76A 4OHUA 3JQBA 2ZK7A 4BQRA 1ULUA 1V3UA 4J3FA 4URFA 4J49A 3IOYA 1DLJA 1FDSA 4YBZA 1D7OA 2J3KA 3A9WA 4DMLA 4TVBA 2BI8A 1FDWA 1ZSNA 2Z1MA 3RUDA 5ITWA 3PLRA 3V2UA 2DU8A 4B4VA 5CG2A 3RCBA 3WOHA 4JBGA 4N54A 4OJNA 4AJHA 3MWEB 5JMWA 4RQTA 5JYEA 2QIOA 2D59A 3I3OA 3DMTC 2DTEA 1V8BA 3JD0A 2BMAA 3PJFA 4DYDA 2D3TA 4BKRA 3RUHA 1D1SA 1HTBA 2FOIA 3EVTA 3BTUA 2EKQA 2HMTA 3H5NA 5C7OO 2NNLD 4IMPA 2AE1A 1D3AA 1WMBA 1DHTA 3W1VA 1PZEA 3G79A 1KOLA 3AM5A 1LDNA 3SBOA 1UP4A 4Z3KA 1E7YA 3OMLA 3WB9A 3TOXA 4E4YA 1PS0A 1YBMA 3LC1O 1IPFA 1ZXBA 1P0FA 4NFSA 2HSDA 2B4QA 2R2GA 3H3FA 1A27A 1ZZEA 3AFNA 1B8UA 3ZWCA 5JYDA 3PP8A 4YJHB 1G0OA 1RJWA 3NRCA 1O9BA 5GMOA 1X0XA 1YVEI 2X5KO 1TT5A 3KYDA 5B1YA 4HNHA 4MKXA 1NWCA 4R5HA 4BNJA 4JROA 3KV3O 1XELA 5ENVA 2Q45A 4WUVA 5B4UA 2YV2A 3GR6A 4U7WA 4DLAA 4HUJA 4J9UE 3PWKA 4YA6A 5A04A 3U62A 1QV6A 3FNHA 4CMEA 1Q7BA 4RO0A 2YW9A 1ADBA 1DFGA 3HADA 5T5QA 3MZ0A 4BNIA 1HF3A 3ICCA 2Y1CA 1HLPA 2D8AA 2C20A 2E49A 1OFGA 1UAYA 3OIFA 2W2LD 2X0IA 1LC0A 4IDCA 1PGNA 1XWFA 2WD7B 1K89A 1MXFA 3KB6A 2PV7A 2HKIA 3U5TA 3BAZA 4HXYA 1XQ6A 2NTJA 3OICA 1H6AA 1NVGA 4BNYA 1HSZA 5IJZA 4TRMA 3ETGA 3JD3A 4B3JA 1KEPA 4RL6A 3EW7A 4GX2A 2VNAA 4RQUA 3HB4X 2HLPA 4O59O 1N9GA 1N9GB 1DJNA 4CR6A 1YB5A 2CMDA 1WDKA 4YJGA 1JQBA 4YJGB 1YJ8A 2JFHA 5A1TA 2HAEA 4ALKA 5A02A 4OXKA 4BNFA 1HXHA 4WE3A 4I9NA 4Z9FA 1GZ3A 1TXGA 2IE0A 1N7HA 1X0VA 3CPSA 3NT4A 4XIJA 4II3A 3ZWVA 1OI7A 2C5AA 5KCZA 3E9QA 2OFPA 4XQGA 4LSMA 3DBLA 2WE7A 3DBLB 2HK7A 3GAFA 4KMSA 5THQA 1XYGA 5L45A 5TLSA 3ZI0A 5TJHA 2IDZA 4GGOA 1E6UA 4R16A 4ROSA 1UXGA 1EK6A 4PG4A 1N8KA 2EW2A 4Y9DA 3QVXA 1X1EA 1UZNA 3QRWA 3CE6A 2R6JA 3LYLA 3QWBA 4FOSA 3Q1LA 1VJTA 4JP3A 4XQEA 1R0SA 3TN7A 4CLRB 4CM1A 4CLRA 1E3JA 2X7HA 5JDIA 5G2OA 4M89A 3E5RA 1EE9A 1MUUA 2C2YA 1MB4A 4IIUA 1IY8A 1LSSA 3EYWA 4AJJA 1EFLA 4IBOA 4M87A 4E2ZA 1BGVA 1M2WA 1GEEA 4KUHA 4XWYA 5CPFA 2VUSA 2PZLA 2VWHA 2NU7A 4MVJI 1BW9A 4ZGWA 1E3WA 2Y0DA 1WP4A 2J8ZA 3LT0A 1ZXLA 3GMDA 2X5JO 3LF2A 4R1UA 4A2CA 1EE2A 4YJFA 4YJFB 3F4BA 1EFKA 2O7QA 2E48A 5B37A 2VRCA 6LDHA 1Q1NA 1OC2A 2C59A 3DOJA 4HADA 1TB4A 6ADHA 3W8FA 4AG3A 2C2XA 2E37A 1HYHA 3E8XA 1EBFA 1ONOA 4QO7A 3RJ5A 1GUZA 2B5VA 2X8LA 4RJTA 2P4HX 4TSKA 1EZ4A 4P8RA 1GCUA 4BGUA 4JP2A 3D4OA 3ONFA 1SNYA 3RROA 2PFGA 1HZZA 1PS8A 2JAHA 1DHRA 2BH9A 4B4OA 3UOGA 4FFPA 1GQQA 5G4LA 1SEVA 3FPCA 4XJSA 3D3WA 3TZ6A 4INAA 1I3KA 1NVMB 3IDSA 1UAGA 2I66A 4PVCA 3SX2A 1N1GA 4DC1A 3QWFA 1Z45A 2BLLA 2X0NA 5FWNA 1P44A 3GNTA 5B4TA 1YE3A 2I65A 3W4JA 1YQGA 4FPXA 5FI5A 5JCXA 3NJ4A 3ZHBA 2RCYA 1KVQA 2VYND 3QHAA 1JAYA 4OXYA 4J4BA 1LA2A 1Y9AA 2RHRA 1RM5A 3Q2KA 3IJPA 4L0QA 4UVEA 3RVDA 3AI2A 4XRGA 4BO5A 2PH3A 1T1SA 4UVIA 4S3MA 1DJQA 5TQVA 4RVSA 4W4TA 2RH8A 3RFXA 3EZLA 4MINA 5JCJA 1E1NA 3AI3A 3HDHA 2UUPA 4CV1A 1NBOA 4J2OA 1O0SA 4EYEA 2FY8A 3GG2A 5H82A 4BNZA 2PD4A 3JQAB 3R3JA 2VOEA 3OJLA 2Z5LA 5BR7A 1CJCA 5G0VA 1H9BA 1JWAB 3PTZA 4E32A 1LUAA 1I5RA 2Y68A 3OETA 8ADHA 1M66A 1LDGA 5IXSA 1YL5A 3DXFA 5LCXA 4OQYA 3SC4A 4BQPA 4YPOA 5AQ1A 4AICA 3SJ7A 2JAPA 4NIMA 1PEDA 4GX0A 4BMNA 3DZBA 3IJRA 1E6EA 1NPYA 2O3TA 4D45A 2W98A 3P2YA 4N5LA 4GKBA 4YT4A 4NFHA 4N7RA 4WJZA 4DBZA 4R1TA 3K96A 1SBYA 2P5UA 4PG6A 5CP8A 4EDFA 5JAQA 1PIWA 5DCUA 1NQTA 2WYWA 3F6YA 4AJ1A 1GPJA 4JJGA 1PZHA 1PGJA 1X15A 5A3VA 3V1TC 4AVYA 5A5EA 2FMUA 3ORFA 4J7UA 1XA0A 1BHSA 1QORA 4NFYA 5G0WA 3RD5A 3UUWA 2WTBA 3VPGA 3PI7A 5DDIP 4WKGA 1DC6A 1VJ0A 4Z0PA 2ZJ1A 4ALMA 3GUCA 3PZRA 1ZUD1 2FRDA 4CMKA 4PFJA 3RFVA 1F12A 4BUCA 1X7GA 3JQFA 1GYPA 4WLEA 5CAEA 4EJMA 2VQ3A 1LXCA 4CR7A 4XA8A 3CINA 4RDHA 4B3HA 1DPGA 2POQX 5CEFA 1F8GA 2WE8A 3GNQA 3ZWNA 2RAFA 3S8MA 4L73A 3JYPA 1HETA 5I8WA 3H9QA 1HDXA 1QP8A 2O48X 3F5SA 3DBHB 3PJGA 1LSOA 1NAHA 3L9XA 3CKYA 3TNLA 1HDRA 4AL4A 4YQZA 4RPLA 1TI7A 1XDWA 5BSEA 3DFUA 3JYQA 1IUKA 4IJVA 4OXNA 3D64A 1D1TA 3OEWA 3GEDA 3TPCA 4DPMA 1R12A 3ENKA 5K9ZA 3AOEC 4IM7A 3M2TA 4MVJA 3ZH2A 2Q2VA 3WTCA 4ITUA 4ND4A 4D43A 4HFJA 2X22A 3WSWA 5CEJA 5K6AA 4Z0TA 1P1FA 3GN2A 4J6FA 1J0XO 3T4EA 3GN1A 4RPHA 4WCDA 1SOVA 4D79A 4LVCA 3BMQB 1J49A 1PQUA 1B3RA 1X14A 4XQCA 3JD2A 3F9IA 3C7DB 3K9QO 1GFSA 2ZB8A 4RV9A 3ZGYA 4XYGA 5IZCC 2WDZA 4N5MA 1NTOA 5I7VA 1UDAA 4K26A 4DC0A 4FJ1A 5T8KC 5U4QA 5TSDA 3D5TA 3WIEA 1BMDA 2Y1DA 5G4KA 3A1NA 1FMCA 3G0OA 3H4VA 3A14A 2NU8A 4JQCA 5A9RA 4J1TA 4MJLA 2ZTUA 4GSLA 3NV9A 3UXYA 2O23A 3O8QA 3OA2A 1SC6A 2JKVA 4LK3A 2B5WA 2LDBA 1YL7A 4YXFA 4CMCA 1R15A 2PTGA 5BNTA 3INTA 1P33A 2HJRA 4F46A 3GNSA 4ZD6A 4ND2A 3DQPA 3ST7A 3GVHA 4OKIA 3OEYA 4IDBA 5IDYA 3ZV4A 2W90A 3WJAA 3GPIA 5TJ9A 2H1SA 2PD6A 3STHA 1TLTA 4CV2A 1Q0QA 3PJDA 5L4LA 3ZWPA 4DQXA 1IHXA 1NAIA 3GZ4A 1VC2A 2V6GA 5FI3A 3WGZA 3V8BA 3JCZA 3V1YA 4TZTA 3IQDB 3ZU4A 2NVWA 3PK0A 4U6QA 4H7PA 4J91A 4NQZA 4AJ2A 2QRLA 3WYEA 5JAZA 3NAQA 1DXYA 4BNLA 2B4TO 5A5FA 3B20A 4R3WA 1Z7EA 1C14A 4BO1A 3OF2A 4NJOA 1ZH8A 4BO3A 4JGBA 4TRNA 4E3ZA 3KXDA 1EQUA 2BGKA 3I6IA 1LX6A 3PEFA 1JKFA 3CH6A 3DZJA 4XYEA 2J5QA 1O5IA 1ZO8A 1T26A 1C1XB 2VZ8A 2C54A 3UW3A 1FDVA 3GZNB 1W8DA 1KEWA 3ANNA 3DBRA 3W6ZA 4L74A 3NDJA 4HFRA 2PZKA 4WASA 1I3LA 4RPGA 1P3DA 1AUPA 3WYCA 5DP2A 5EQDA 3VDRA 3L77A 2ZTVA 3COSA 3GDGA 1AGNA 2IXAA 5L4NA 4KTVE 2JL1A 4G81A 3V5NA 1RM3A 1PR9A 2ZB4A 1ZK4A 2P68A 1KY4A 3I6QA 2B35A 2P91A 3DR3A 3LT2A 3JQ8A 4FR5A 3UCEA 5DBGA 1ZBQA 4YDRA 1HDOA 2YHIA 4CLOB 4EI2A 2XOXA 2EF1A 2NQTA 1BXGB 4Z0HO 4O0LA 4E12A 4RVGA 4NNJA 1C1DA 1T4BA 4ZRNA 1T2FA 2VZ9A 3M6IA 3ROKA 2LDXA 4Y6PA 4BL5A 4WK6A 2OXIA 1FXSA 1IE3A 4B3IA 3ONDA 3DFZA 1C3VA 3WGGA 3AFMA 3MOGA 3PIIA 2OBNA 4J1QA 4YRBA 1ZK3A 5JW6A 3GUYA 1GD1O 5L53A 2OHXA 1Y8QA 4YT5A 2OUIA 3B70A 4Y98A 1MGOA 4L4XA 4N18A 4PG5A 4CMIB 4OL9A 4CMIA 3C1TA 3QIVA 2OP1A 4R1NA 1PGOA 2VUUA 3DZFA 3KRTA 4OH1A 4PVDA 4AJ4A 2I3AA 5JLAA 5J23A 2UDPA 4JLWA 4PRLA 3WYBA 5DCYA 4KQWA 4Z9XA 1P0CA 4EJ0A 2PGDA 3RIHA 4NH4A 2VYNA 3UFXA 4DPKA 2PZMA 3S2IA 4LISA 4LN1A 3BHIA 2C29D 4QEDA 2UUOA 4Q3BA 5IFLA 4FD3A 3DWFA 4GAEA 1HYEA 3IKVA 3HWRA 1T4DA 3VOSA 3C8MA 1C0IA 1XSEA 4ND5A 4BNGA 4CMJA 2VYVD 4FW8A 2BHLA 3C1AA 3NKLA 3U4IA 1QXSA 3W8DA 2X0JA 5IDWA 1R16A 2G1UA 4K6CA 4PGFA 3WG9A 3INRA 2HMWA 3ABIA 4BS9A 4FGSA 1HE2A 2V6BA 2ZJ0A 5LC1A 3MJSA 4BNWA 3GC6A 3GK3A 4CMHA 2NU6A 4KZPA 2G17A 3C7CB 3UCFA 4HBGA 1QR6A 1PJ3A 4CQLA 4W7IA 1GV0A 1ISGA 2H9IA 4WLFA 5AYVA 2IRWA 5CEEA 4IGEA 1YO6A 1VKOA 1CRWG 2OL4A 4UEJA 4DYVA 2HMUA 3WIDA 1KEVA 4IXWA 3M1AA 4HX5A 1IB6A 1TA4A 1W6UA 4FC6A 3TJRA 1T1RA 5L4SA 5DOZA 1P1KA 3WGIA 2NVUA 4CPDA 2NVUB 2F1KA 4PZCA 4TKLA 1DBVO 1GU7A 2ZYDA 4NBUA 4DBVO 2E6UX 1WDLA 2J6IA 3EAGA 3U09A 3IMFA 1WNTA 2PLAA 4R51A 3W8EA 1DC3A 1VKNA 3QWIA 1AHIA 4IDDA 4BNKA 4IS2A 2Y67A 3ADPA 4YAKA 1IZ9A 1WW8A 4HP8A 5CDYA 1BVUA 3P5SA 5ER6A 2PNFA 3WJ7A 2IEDA 4J0EA 3IAHA 5A9SB 2VWGA 3N58A 1W73A 2J3IA 1R66A 1HDGO 3MJTA 1YRLA 5EINA 5T6BA 1XU9A 3E6AA 2A9FA 3QQPA 3U4HA 3AUAA 3ZV3A 1VL0A 2YFHA 1U9JA 1V0JA 1V9LA 3WGQA 4DIOA 2IYPA 3KYBA 4ZQGA 3D1LA 1UXIA 3GQVA 1J4AA 3DZIA 4D0SA 4CMEC 1K2WA 1PJ2A 4IUYA 5JDCA 3GDOA 1CDOA 1I2ZA 2A94A 2QYSA 4QQRA 4CUJA 3K8ZA 4XDZA 1U8XX 3I23A 4DL9A 2G5CA 4I5DA 3L6EA 2E82A 2SCUA 3PIDA 2BFPA 2AEMA 4W82A 2CDCA 1O94A 4RVUA 1NR1A 2X1HA 3KLMX 3R6DA 3WLEA 2NADA 5KIAA 1PJCA 4OKNA 4RORA 3RKUA 3KOUA 4YAGA 3K2EA 3GVXA 2GCGA 1FF9A 3RC9A 5EPOA 2AQ8A 2P2SA 3P7MA 1DRWA 2ZQZA 1I3MA 1EEHA 1MX3A 2D5CA 4IJWA 5A06A 1NFRA 3IP1A 3RC7A 5C3MA 1PU2A 3FR8A 3FSRA 3NTRA 3SVTA 3Q3CA 1F17A 3O26A 3Q9NA 5ES3A 3QVTA 4AJLA 4R5MA 1Y8RA 9LDTA 1H2BA 4BHTA 3W4IA 5KJFA 1ADGA 1TT5B 1IOLA 3KYDB 1C0LA 4FOOA 1L1FA 5A03A 3VDQA 2DPHA 1IULA 1GDHA 1NQAO 4KTTE 1EVZA 2NWQA 2PKQO 5GZ1A 2JCYA 3GVCA 4CM6A 4PCVA 3ZV6A 3PPIA 1A9YA 4WOKA 1DIRA 1ZVMA 3WWYA 2C5EA 1UXHA 3PRJA 3A28A 5AXCA 2XXJA 3HN7A 4E5NA 1NVTA 5BNFA 4MIOA 1Q7CA 4YYZA 4GGPA 1ZIDA 2YHUA 1LDBA 2B0JA 3KEOA 1YWGO 2EP5A 3Q2IA 1E7MA 4CM9A 4PIVA 3EVNA 3H65A 3CUKA 3GY0A 1DAOA 2EJWA 3C7AA 3NTOA 3L4BC 2X58A 3GFGA 5C7IO 4NBVA 2DFVA 3LZ6A 4GWKA 4CQMD 5JY6A 1XEAA 1N7GA 2EV9A 3FNFA 3FWNA 1ISFA 5JXWA 1E3EA 3PFWO 1SOWA 4AFNA 2CDAA 2YYYA 3PYLA 5B4VA 1E5QA 1E1KA 4OAQA 1AHHA 3ITDA 1MFZA 1LLQA 4YTEA 5EJ2A 3H3JA 1T25A 2A4KA 4W7HA 1F06A 2X9VA 4BNXA 3AWDA 3TZHA 2O4CA 5GZ3A 3C3XA 3WWZA 5U9CA 2NTVA 5KJ1A 3KUXA 3I1JA 1PJLA 4NJMA 2R00C 4IDFA 5TS3A 1NHGA 4OMUA 3L07A 2HO5A 3I9KA 4RVDA 2UYYA 2GUGA 3DMYA 5JMPA 4JBIA 3OP4A 4MVJH 1A5ZA 4EEXA 5ILGA 2V6MA 1ULSA 1ZSVA 1E1MA 4P4GA 2AQIA 4FJ2A 3GPDG 1QSGA 3GHYA 1Y7TA 1OAAA 1ONPA 1NR7A 4MVJG 2OZPA 2EW8A 1Y9EA 1QLHA 4DIBA 3FRJA 2O3SA 1A7KA 1BW9B 1E3WB 2GDZA 3AK4A 3ETEA 3AUUA 4IJUA 1ADCA 3WMWA 1A4IA 4NPCA 4J43A 4BOYA 5MGBA 1R6DA 5ER9A 2GN8A 2Y93A 3AW9A 3WNVA 4YRAA 5TT0A 2C82A 7ADHA 5L7WA 1J6UA 1PL8A 2A92A 1PWZA 4PN3A 1HE5A 4Z6KA 2I3GA 2QQ5A 3I52A 2FR8A 4D44A 3ZNPA 4WNCA 1U28A 1Z82A 2YV1A 4J1SA 3NDRA 3LQFA 3I9OA 3D0OA 1G6KA 1DEHA 3SLKA 4J1NA 4PLVA 5HWSA 4R9RA 4YRDA 3KM0A 4P4NA 1QV7A 3WSVA 4GI2A 1BG6A 2GN9A 3LT1A 3CIFA 5DOVA 2DKNA 3D3WB 2Q46A 5L51A 2BKAA 4NMHA 5COQA 4QFCA 3TQHA 4EZBA 3OECA 4Z3DA 2WMDA 5CG1A 2QZZA 1ZK1A 3LDHA 3KBOA 3WFJA 3JD1A 1E7SA 3WQQA 2O3QA 3G49A 1BWSA 4BGVA 4IQ8A 5TC4A 3FN4A 3D4PA 2G76A 1GY8A 3HDQA 1PGQA 2VRBA 2GRAA 4Q9NA 1UP7A 4NR0A 1F8FA 5IDQA 4BO2A 1ID1A 2AXQA 4KWHA 1EMDA 4WLUA 3ZN2A 1QRRA 4BNNA 4A26A 1EVJA 1GR0A 3X2EA 1LSJA 1NP3A 1P1RA 3ANLA 1JU9A 1BXZA 3KVOA 5TIIA 1ENZA 3DL2A 4Q3CA 1DB3A 1DO8A 1LLDA 4IINA 1K6IA 4R69A 4W6ZA 3JQFC 1KETA 5CHEA 3RSHA 3V2HA 3U9LA 2ZATA 3DHNA 3N7UA 1LQTA 1UUFA 4BKUA 3BMNA 5COAA 1IZ0A 3VAZA 3JQGA 3BMOA 4G65A 1B7GO 1C0PA 1B15A 2OO5A 4OOFA 3BTSA 2AA3A 4XR9A 4KDEA 3F1LA 3BHMA 3IKTA 2ZIZA 4YQYA 1DSSG 5AXAA 4XGKA 4D46A 4XIYA 3I4CA 3GT0A 5EERA 2DLDA 2X9NA 5IXYA 1A71A 5GY7A 1GQ2A 1O8CA 1TEHA 1Z6ZA 3M1LA 3I83A 1WWKA 4DA9A 1B16A 4XKJA 3L6DA 2BF7A 1BDBA 2GPTA 2X6TA 2YUTA 4JJIA 4H15A 4EGFA 1KBZA 3G1UA 4G2NA 3RC2A 1ISMA 3Q6IA 1AE1A 2RBEA 4YT8A 2NVBA 1YDWA 3DAFA 1E3LA 4R3NA 2XF8A 3ZWAA 3PWSA 1I10A 3F3SA 4AJIA 3E03A 4LRSB 4CM7A 1ZFNA 4E5YA 1X13A 5C37A 4GKVA 3BIOA 5K6AC 1EUDA 1YOVA 3WGYA 1P1IA 3ZNQA 1PS9A 4XDYA 4MP3A 3GEGA 5DZSA 3B1FA 3E82A 5CPBA 1NM5A 1V35A 4J9VA 3EZYA 2Y1GA 2GLXA 2RH4A 3OQBA 4WLVA 5IZ4A 1PWXA 4XYMA 1NPTO 3RASA 2Y05A 1JKJA 3HZZA 3QP9A 3IIEA 1I32A 1E5LA 4KDFA 1D8AA 4M55A 1I2CA 4KWIA 5DNAA 3ANMA 1U5CA 5G0TA 4CM4A 1MV8A 4E5KA 5KNLA 4ALLA
chains in the Genus database with same CATH superfamily
9LDBA 3BSWA 3IT1A 1QR2A 1JLLA 2AZDA 1CSEE 4QKQA 4LHVA 4V24A 4M4SA 4NEQA 2O2ZA 3A9TA 3PE3A 1JQ3A 2I6UA 4LMRA 4ZAWA 3RU9A 2ZPTX 2W22A 5D3ZA 3RF6A 4GBGA 4LNHA 3KLNA 4Q01A 1PTKA 1LEHA 1FVXA 2N47A 2GAFA 2GYYA 2COUA 3TR5A 3ZCQA 4E31A 2WNSA 1RAHA 2AOVA 4IIGA 3T5BA 1FDTA 3HXOA 4G0UA 1BOOA 1XALA 1HYBA 4PLGA 3UNXA 1J8MF 2AXNA 3ZQ4A 1Z5GA 5G0UA 4WIAA 4BNVA 4C5BA 3UN1A 4DMMA 2XA9A 2DETA 4DLSA 1G8KA 2AK2A 3LC7O 2QNRA 1DTEA 2JH8A 4WDQA 3WHKA 2IUEA 1X6VA 5HBGA 1KIFA 5KEIA 4EUSA 1DCKA 5E4TA 2XKKA 1QG6A 5KVAA 2O4UX 2V96A 4EA7A 3TAXA 4GR5A 3OM1A 3ZHCA 5FBKA 1P0QA 4UVDA 4F2HA 1W5SA 1U0NA 4BZZA 3DHYA 3GFRA 4V38A 1NDUA 4BJ3A 4DR2B 3ADOA 1DU4A 4YAOA 4FMCF 4HGYA 2LIVA 1S3GA 4YR9A 2GNAA 1Y82A 2CXOA 1KF0A 4OIFA 3ZGXA 7REQB 4N03A 3M33A 3TBHA 5DYNA 1AQIA 2QP3A 2PIDA 4ZANA 2BGLA 5IC4A 1SG9A 3GFBA 1V8FA 2BE7A 4MV0A 4F3YA 3HN6A 3OCJA 3L0OA 3PHGA 1QG0A 2G8LA 3LJKA 2IYUA 1P2UA 1TW3A 3CF0A 4KACA 5KKAA 4E08A 2I76A 1V5EA 2H9AA 2NSHA 5LR6A 4B7XA 4C43A 3P94A 2A5JA 1PEKE 3QFRA 2UZIR 1JWBB 2JCSA 4IRMA 1FXWA 1KBOA 2P9GA 3A0UA 3KQVA 3PR1A 4MWOA 1GL3A 5KTOA 2NM0A 2NO1A 4HDSA 3DZDA 3RBZA 2W0MA 1VL2A 3X3HA 3JR3A 3FZEA 4L5JA 3H87A 1GRRA 4D8UA 5P8WA 4EKNB 1OTYA 4CQMA 2GDJA 2AZMA 4ZAXA 2D7CA 2D1QA 9ABPA 2H85A 3WC4A 4BNDA 1U2EA 3KKMA 1AM4D 1R9MA 2O8FA 4CCYA 1VJCA 4UHHA 4DWVA 2GBFA 2GF2A 3W1EA 1S1CA 2XYGA 3BDIA 1NG1A 4OBXA 1F0YA 3F7MA 4I1UA 1LV8A 1YS4A 3EA0A 1O89A 3C3JA 1BQ4A 1ZKMA 2QLTA 2VXYA 3C4QA 4MGHA 4UJ3A 3W4KA 2PSFA 4F4JA 2DLCX 1NJGA 3C24A 2CNBA 2CVHA 1VMEA 2EL9A 2I1WA 2OHHA 4F86A 4LF8B 2HW8A 1M34E 4AS3A 3F5MA 2H7CA 5DXFA 1IWOA 2VQEB 1DAPA 3GPCA 3ZXXA 2VDMB 1W7AA 1JFFB 1PDOA 1J2RA 1VTKA 4QXAA 1KI1A 5FOXA 3INGA 4K28A 5LOVF 3CZRA 5DCWA 4G63A 3C6ZA 5J1SB 4QQ8A 4Y9SA 2WOOA 2D0IA 3Q41A 5LMUB 2JLVA 4HQFA 4GM4A 5JJKA 2FUKA 2C7RA 4FZRA 2FYTA 3LFTA 4ZKDA 2ZJBA 2W2XA 2XLBA 3DV0B 4R3UC 2QZPA 1JVSA 2ZRPA 2R4TA 3QLEA 4EA9A 4LDZA 2IPMA 1PJTA 1VSUA 2R1VB 4XWGA 5MN6A 1CFJA 1JSXA 3DBRB 1RQ7A 1PLJA 3OTGA 4NBTA 2ZYAA 3UMRA 2E3JA 2HIGA 4L28A 3P0EA 1GARA 4IIFA 2JH3A 1X7ZA 2QD3A 2QTAA 3OU7A 1YDFA 2IOHA 1E1LA 3REGA 5HF6A 1W5AA 4LJ5A 3MJ4A 5KQMA 4CIAA 2W6OA 3EPLA 5CLHA 1JA9A 1FFSA 3UYLA 5B2FA 5BSFA 1V3VA 3LDGA 2WM3A 3RWOA 4DR5B 3KYJB 2GZDA 3FZNA 1XHLA 1XVIA 4Y2RA 3RVLA 4BO0A 1Z5ZA 3H2JA 1NVAA 3OQIA 2DT5A 1VHTA 1VI6A 2D2VA 1RTKA 4HS9A 1QZ3A 2CL6X 1YJQA 4MUEA 3WMFA 5KZMB 3JQ8B 1NNEA 4TZKA 1H1LB 1CFZA 2HSWA 4LJ7A 4FHFA 4M0EA 4HX9A 4JJEA 4TKUA 2QJWA 1J5PA 1YNSA 2GCPA 2DH5A 1E5TA 4OMCA 4B0OA 3LA8A 4UCWA 1BDMA 3IBFA 1WBJB 1A0OA 3L5KA 4H6WA 1HQCA 1KC1A 4LJ4A 4MA0A 4L78A 2A9OA 3OH8A 3E5HA 1T24A 4FMDF 1HH4A 2FQ1A 1CUFA 4M3NA 1WUTA 1NW7A 2E4YA 4L5BA 4MWEA 3U3XA 3M5DA 3U44A 2G4LA 3ND8A 1I24A 1GGHA 1QHXA 3VH2A 2VSXA 4BB5A 5HVNA 1K5DA 3ROMA 1C41A 1MR3F 3TZQA 4XW2A 1L4GA 3ID6C 4PNZA 3EY4A 5EZYB 1TJPB 1WY7A 3KPUA 4OU5A 4C7MA 5AW3A 1YVUA 4QU0A 4YUVA 5D84A 4B3FX 2YQ5A 4OU4A 4TOIA 5KQLA 3FWKA 5DXJA 1KDYA 2QS9A 4ZOQI 5FNVA 3P26A 4TRRA 2CUZA 3QU7A 4OGGA 4L4RA 4OXRA 2X41A 4F38A 3OT5A 4FFMA 3PVCA 1QQ5A 3JTEA 1MQ8B 3A4YA 1NJ6A 2ZYUX 1ZW6A 2BELA 1F38A 3CX7A 1AUQA 1O87A 2R6HA 1GL7A 3BYZA 3NYIA 4HYEA 4YMGA 1PJ4A 4HLQB 2KSQA 2PVSA 3RB8A 3PD0A 2V97A 1KNQA 4LBWA 2ZIXA 3O1IC 3ORYA 4JJ6A 2B98A 4QBFA 1KYIA 4NU6A 4B3SB 1TQ6A 2ZWPA 1L7EA 3IFSA 2HJSA 3W5UA 3GCZA 1EM8A 1BZYA 4FFWA 3F98A 2RH9B 4UUPA 2GETA 1VA4A 2V7GA 3EEIA 4EW3A 4UZSA 1EVYA 5AI4A 3O4VA 1LI7A 3TTYA 1GGJA 3TGLA 1EHCA 1IL0A 4QRDA 2NZXA 1GTG1 1URPA 4I2NA 3ER9A 1SBCA 3EXFB 3A6JA 1N7JA 2HMVA 4V02A 3ROQA 1RLTA 4JR0A 4EQ6B 4D6XA 1IHPA 3OCYA 2CMFA 1J2UA 2F59A 3F9CA 2FNAA 3Q6MA 1PR5A 2RHGB 5MGNA 2V6FA 3VM6A 4B44A 4INZA 4PLHA 4F21A 4PZAA 4Y2XA 3GFFA 3R23A 4TMYA 5D7NA 1WD5A 2FAXA 3RE1A 1Y5RA 4LAFA 1DRKA 1FNDA 2NU6B 5DTMA 3RDPA 4G0QA 4C87A 1JIXA 1V45E 4C07A 1Z12A 3NHSA 2JI7A 4G9EA 1DJLA 3QUQA 4GVLA 3ZX4A 4B8WA 2YINC 2H2FA 2V5UA 3ZKAA 5FOSA 1JHUA 5FO0A 4LJ8A 5EIOA 1SGWA 5KJCA 2ZRCA 4D2IA 4MDEA 1ISSA 4F4DA 4UDYX 5EYPB 3JQ9A 3TIXB 1MPTA 5ICEA 2P65A 5BMVF 3DDNA 1I4EB 3I32A 3UHFA 4DB2A 2WD8A 2ZIVB 3R0JA 1OH6A 5EFOA 4GX1A 3KFVA 1COWA 4AJ9A 5FUQA 2WJ3A 3CBQA 3C7TA 4YN3A 1XAGA 3CKMA 2QJOA 3R7LA 4EW2A 3N2LA 1H6CA 3OIUA 3RBVA 4E5VA 1M2OA 1SVUA 1KYYA 1SY7A 4JY7A 5HJEA 1SK9A 1H6DA 1KAHA 5IBRA 4M53A 1MIOB 1PR3A 4EJFA 1AZLA 1N4AA 5BV2P 2Y66A 3NOXA 1PR4A 1QTRA 2BUAA 3ASYA 5D00A 4Y0VA 4WBXC 4JJAA 2J87A 1JP7A 3N8IA 1DKUA 2KQUA 3O73A 3HCNA 3JQAD 3PQDA 1KYQA 1TOAA 1XZIA 4IUCS 1JEAA 2E2WA 4J90A 4E03A 2Q5JA 3NBZC 3I5XA 2MT9A 3OBIA 1UT6A 1YCGA 2L0XA 1WDMA 3B51X 3EE6A 3D3NA 3O03A 1WTAA 1ZINA 3RWBA 5I5EA 1B6RA 2YMLA 3KK0A 3NZEA 4LNUA 3WLLA 4E5MA 5F4BA 4P83A 4KDRA 3Q3JB 2W4IA 2EJCA 3F90A 4IAOA 1F8UA 1R0RE 1Z8DA 3E3MA 4CFYA 4LXXA 4M9UA 3R6WA 3GJ0A 4MV7A 3SZUA 3PGVA 4HV4A 5HM6A 2FW8A 2I6QA 2QX7A 3H9JA 4OBEA 2ID8A 1SUAA 2INGX 5BURA 5EMMA 4HDNA 4LJ6A 2CD7A 2NO0A 5BVHA 5FV4A 5HS4A 2C8LA 3JALB 3DULA 3LUKA 4WCFA 2Q0XA 3DYVA 3G8BA 4K9MA 4C7KA 1L4KA 2ECPA 3HK2A 5AK6A 3L4SO 3QU5A 3LP5A 2EF0A 7AT1A 2CFCA 2G1JA 4D41A 1EVLA 1WL8A 4G0ZA 2IU0A 1FL9A 1XD2B 4MUAA 4TWBA 1F3OA 4AN4A 1F5SA 3V46A 1Z73A 3BWVA 2CWWA 4ZYUA 4JODA 5J4YA 4JYMA 4EL0A 2F9FA 3HKCB 2FPRA 3AF0A 5I7SA 2DC1A 2P9YA 5FLYA 4DUPA 5IVPA 4WDRA 2BM0A 3FCUB 4PXAA 4I5GA 2QE6A 3SVZA 5BV1A 2EX4A 3JU3A 4I9UA 3UT5A 4OEHA 4HFMA 1F0KA 2JA1A 3JAKB 2C96A 4KO8A 1DFHA 1M6WA 1QYVA 1D4OA 1XZHA 5TX7A 2IYVA 3SZLA 1XCBA 2BBWA 2IHKA 4ENVA 4NMWA 5L9AA 4QPZA 2GPWA 4B6GA 1ZK0A 5FOUA 5BUQA 1C7ZA 1OVGA 4HAWA 3RVSA 3WDSA 1ISHA 4PG7A 5HFNA 4S2EA 5BWNA 1I0ZA 2JLQA 1T2EA 1C9DB 2VSQA 4UTXA 2OD9A 4R9UC 1NPDA 1CE8A 1JLSA 1VSVA 5FR1A 1D2GA 1HOXA 4LZOA 2P9JA 2Q1WA 4ZFNA 1ZQ1A 4R8LA 3GAAA 1WUYA 3G1WA 2JASA 2HZBA 3MWEA 2W2OA 3BFJA 3TVTA 3OPMA 1XJ0A 1TT7A 3TW4A 3AOGA 2V7QD 4F93B 5I7FA 5J43A 4JCOA 3IAAA 2TRSB 3HB5X 1Y37A 3RS0A 3QLJA 2VAPA 4F7DA 3U39A 1MV5A 4N4AA 2EU8A 1BTOA 1HTWA 1IWBB 5BPHA 1O54A 1ESMA 4E7PA 3O83A 3IEKA 2RGNA 3M6LA 4IIVA 4UUOA 3DVSX 3VSAA 1HX7A 4C0BA 2A59A 4A10A 4A16A 5BQOA 1OHHA 2Q4EA 3LD9A 3QPDA 1KTIA 2FP4A 5E95A 3TW6A 3FCCA 1T35A 1H22A 3OHPA 3O74A 1NIJA 4IDEA 2FJ0A 3WTBA 4CKZA 4EQZA 1XMVA 3Q85A 5LJIA 4RPKA 4AM8A 3ADBA 4FIDA 1U8ZA 1DLIA 4DRYA 4FUQA 3U81A 3FOAA 2OZLB 2J4DA 2QG9A 4IDPA 4NHOA 5EHXA 4RE5A 2QSYA 3BCHA 4MYHA 4YJ2A 2CNOA 1JDUA 1SRQA 4H6VA 5CX4A 3HJTA 2ZIAA 3V1LA 4ZXFA 1QC5A 3AUXA 1OZAA 4YJHA 4ALIA 2P4SA 2C3MA 4FBGA 1R0YA 1QFYA 4LSWA 3VPCA 5I9NA 2F43B 3NKVA 1AO0A 2YOFA 2MSWA 1YS1X 4OQMA 1S7CA 1SUSA 1QOZA 2JB9A 2PWAA 1R5JA 4W5JA 5E2AA 3GLGE 1DOAA 5C80A 1JPNA 1WU7A 3FSGD 4ZAFA 1RAEA 5JAHA 3QA3E 2CLLB 3H9GA 1SXJC 1WV1A 4Z2YA 2VZ0A 4M54A 4RFSA 3TDKA 1N0UA 3T06B 2OVFA 4B6QA 1RADA 4IHKA 2YOHA 4HRYA 5IT0A 4FMPA 1XXHA 3K35A 1P31A 1DAKA 4LS3A 4U5QA 5JTUA 2CVQA 3A06A 1O4WA 4MI3A 2Y1FA 1KMHA 2UVPB 3G3EA 3DMTA 3L46A 4BMVA 1YF3A 4BLVA 4RK0A 2FWJA 5D86A 2ZWVA 4ER6A 4M7PA 2B37A 4Z4FA 4WECA 3IDZA 1SVIA 2ZI3A 4HUQB 4YWHA 1NI5A 2WFZA 5ILOA 1SELA 3B3QA 5E1MA 1UKZA 3WNQA 4EHLA 3D7LA 3IH5A 3D9QX 2GSWA 4GXRA 4AF7A 1OSNA 1QFJA 1I8TA 3UF0A 1QK5A 2CFIA 5CCEA 4V1CB 3JTMA 4NJMB 4ZCPA 5T4FA 4KMRA 2CMKA 2CMGA 3E3AA 3U19A 5LP6B 4Z1OA 3GRZA 3E9YA 3UKDA 3VJKA 3BN3A 4ZCIA 3PQEA 2WVJA 3WICA 4GPTA 2IYXA 1B00A 2H3EA 4HLDA 2VK1A 3P97A 3IP9A 2XNKA 2BFAA 1P7VA 1CV2A 4PLWA 2LCQA 1DZ3A 2GPAA 1B6SA 1NX6A 1G4UR 2RK6A 1ZICA 2ZBEA 4IOMA 3H5VA 4HPXB 4N47A 3S2GA 4WEOA 2IUSA 4S24A 3WLIA 2HCTA 3R3YA 4NFLA 5DYTA 4D4KA 5JH7A 3TH5A 3JQ6A 2I03A 3I2GA 4R84A 1TIPA 4KNVA 4YLEA 1KHHA 3I28A 4ENTA 5CFOA 3HI6A 5KTKA 2Q5EA 1ZJ4A 5FWXB 4IDOA 3AF2A 4BLUA 1XIVA 4RJIA 2DJ5A 2IX9A 4RF4A 3CCCA 4MPRA 2NU9A 5LYJB 1JIUA 4NCJA 4ZT6A 4ZVKA 4FSHA 3FFAA 3I4FA 4DC9A 4G4SO 4TPKA 1IBRA 3EEBA 1VP3A 3RANA 3CF2A 1L5YA 1XE3A 2P9CA 3U16A 2XZDA 1E0KA 3KKNA 1AKVA 2ARKA 3Q8KA 1YKFA 4YB8A 1XTPA 1CJMA 1RWBA 3GEMA 4ENWA 4JI3B 4GKKB 4O2RA 2FPPA 3WLJA 3BB1A 2V65A 5LD2B 4M9ZA 2E1RA 4KN6A 2RHLA 5YASA 1HEIA 5CDSA 3VR4D 4AUEA 3EIWA 4S1WA 5CVCA 3ZWMA 3SWWA 3SYLA 3FYDA 2OBYA 4F5WA 2NUPB 2AFHA 3GGOA 3FCYA 5FPKA 4EJ6A 3CHYA 4URWR 2O5RA 1J0AA 4OOEA 2FWIA 3VJLA 2XSZA 2W6JD 2J3EA 2A7QA 1U2TA 4HF7A 4I9HA 4JX8A 5JD3A 2OY0A 4PZDA 1TIKA 4EKDA 1QKIA 5CBPB 4ER5A 4AS2A 4WPGA 1I4DD 2V3WA 1QWSA 3WMGA 4G5SA 2YXPX 3KZVA 1S3FA 2HHAA 3IIKA 5DBOA 3UH0A 2X2FA 2QT0A 3USZA 4DWOA 4X65B 3TZLA 1K8ZB 1VL6A 2Z56A 3X1YA 3WLTA 1DBSA 1A4RA 1P1JA 2Y1EA 3FYTA 4UREA 3SZ3A 3L49A 1KO5A 3SBEA 1XL0A 1ZUIA 5JFGA 3WKDA 1SIBE 2VJAA 4PSDA 4UNSA 4OI1A 4A0GA 4TTAA 2DM6A 3AR8A 4MVJE 1SZPA 2A1TS 3D31A 5L40A 1MQ9A 1V11B 2DY1A 2WDPA 4QOIA 5L3SA 3PU6A 2Z30A 3SHQA 4ZGBA 4IKOA 3SC2B 5DLYA 2XR1A 1JJFA 3DG9A 4KITB 4GOXA 1YR9A 4WNIA 1UF9A 4EI7A 3BMOB 2PFKA 2J5KA 2ZGVA 1KOGA 2HCFA 3HC7A 4GC5A 1TJ4A 2P3QA 4GZ5A 2JD1A 3CMCO 1S9HA 1MLDA 3K0AA 4XFDA 3CF4A 4KR0A 3A2LA 5GAJA 3EG9B 4AF8A 4FDAA 2FSHA 2Q5QA 2VDWB 1PYGA 2YRWA 4HVTA 2CE2X 4KXMA 3H7AA 4ZZ1A 1GL6A 3F2IA 2Y1LA 4JZKA 1KAQA 4YRMA 1E96A 2DPGA 1BEUB 2O7NA 3NP9A 1LDMA 2Y0PA 5EPEA 2Y99A 2QN6A 1SO8A 1UH5A 1GKLA 2YY5A 3LXMA 1EFCA 1XTRA 1Y9JA 2YICA 1VB3A 4DUGA 1VJDA 2HD4A 2QLJA 4IIXA 1X7YA 2EP7A 3M6VA 4NOKA 3JQAA 3W5JA 4KLCA 2IL1A 3U7HB 3CNLA 3I53A 3TMYA 3W3AD 4LV8B 1SEPA 1W0CA 1WX1A 2QEQA 5GM1A 3AU9A 5FBRB 1HE1C 1Q77A 2C4NA 1VIMA 4B47A 2ZVJA 2HHLA 1CF2O 4U6SA 5F9HA 2ATCA 1BCSB 2Q7DA 5TS2A 2QP4A 1MKYA 3CNQS 4X20A 1JE1A 4BO4A 1RZRD 3LKDA 4O63O 2J5RA 3ZK9A 2F48A 4CIXA 3GHHA 4B7UA 1H69A 5JJLA 4MP6A 2BWJA 3QKRA 5IKXA 2OP0A 2NPIA 1CJTC 1FP6A 2AC2A 4N9WA 3T9DA 2P5SA 2XI4A 4RFVA 1B2LA 3JATA 4K03A 2XECA 3QBEA 2F8TA 3DBOB 1JDJA 4G0OA 5DEOA 1R0ZA 4N8DA 4I1PA 3ZLUA 3I3SR 1E8NA 5E6RB 4Q19A 4TXHA 3W6NA 3CMMA 1M33A 2G82A 5AM4A 3BJRA 4BUZA 2VJLA 3VISA 3A27A 6REQB 4CM4B 4ARCA 1NW5A 3FYUB 4MHOA 3MLEA 5HK8A 2DAPA 2JHFA 2F64A 4G1VA 3MCVA 2HL6A 4RDIA 1JLLB 1NBAA 4CV3A 3D6UA 1H05A 1Q7GA 1Z8HA 3GA5A 1P3Y1 1GSIA 4FWIB 5DPMA 5LQSA 1CRZA 3WKAA 5ES4B 4YRFA 3B6IA 1E6WA 1WMEA 2X86A 3FOBA 3PNSA 4JQZA 4LGYA 4YVFA 3NONA 3CTMA 5I01A 1VPVA 2ANBA 2QW8A 2BC9A 4KBYA 4TMFA 1EUCA 3GJRA 1V2GA 3UV7A 3N0WA 2IIPA 3IBGA 5H81A 3JQEA 4MNTA 1HT3A 4NATA 3FNQA 5K0ZA 5KQRA 4LW8A 5I4KA 3FKQA 4KAXA 3ELUA 1Q15A 3C85A 2OXFA 5AKJA 3UG7A 1CIJA 3DBHA 4PAMA 1CQPA 3VYVA 4D25A 4D98A 1NZDA 2BN4A 2H17A 4H4CA 3ZE6A 1YR1A 4MW9A 1IQPA 1FUEA 1J06A 4DIMA 3K1AB 4QM6A 2CBXA 1SCAA 2C4VA 2JFUA 3F67A 4O8CA 2B61A 3GEHA 3H9CA 4R4JA 1E3SA 4Y18A 2C2KA 2JS7A 1D9ZA 2XMBA 1DIHA 2BMEA 2X8BA 4ZQFA 1HG0A 1SB8A 4E3WA 5EJ6A 2OHJA 1ZGZA 4GPZA 2IYOA 4M98A 1EINA 5EMLA 3W5VA 1XLVA 5C8YF 2RHWA 3PRKE 3WZ2A 3QW2A 4CFSA 1YA4A 2YQ4A 3L6BA 4JOCA 1MT0A 3ON5A 3MJCA 1LQUA 2D0DA 3KB1A 3TZCA 1Z2DA 1GDTA 3DJFA 2TMDA 3QPUA 4FNGA 3VSEA 5KTRA 3EFOB 3IULA 2JFFA 1Q21A 2JHGA 4HQOA 4RCYA 1XI2A 2HK8A 4XB1A 5BXQC 1OBFO 4JR2A 3HE3A 2AKYA 3QVKA 4JYCA 3F4KA 4NEGA 5MHTA 1E9DA 3ROPA 3D8SA 2I67A 2HYDA 4TYPA 4BKPA 3TTWA 3EWSA 4HDSB 5JXGA 1QJ4A 2F67A 4YFYA 3TTTA 1P60A 2IEYA 1V16A 1JR3D 1K06A 4YPVA 3UMYA 5C1BA 1N3BA 3HS3A 3LCVB 1IM8A 1YRHA 2IY8A 3HGMA 4CQMB 1UDBA 5CT5A 3AHFA 2HCJB 3TD9A 3IB6A 3EF0A 3H8SA 3I2YX 4BNDB 3Q3VA 5HYVA 1GNVA 1YTLA 3HPRA 3IBYA 4CCYB 1BMFD 4TV8A 4N8EA 1Y4UA 2B36A 4B8ZA 5BR4A 2QTHA 4ONEA 1SCNE 2OXEA 2QLLA 2XNDD 4X91A 1AQJA 4TT3D 4HGRA 5JRJA 1AV7A 3IJ5A 2PJZA 5BUCA 5KVVA 4RZ2A 4KUEA 2VUTA 3GIWA 3CZAA 2VBFA 1V5IA 1JSLA 3M6UA 3SOZA 3FZGA 2ZAIA 2NSYA 3TE7A 2DVMA 1GYQA 3KXLA 3PJRA 3H1PA 5CTJA 3FPAA 4PC1A 4E6PA 3PQFA 3TSYA 4CLHA 1Q0LA 3FXAA 5GPBA 2OXCA 4L0MA 3BDVA 2GCIA 3L93A 4EFLA 1JRLA 4U4AA 4BEVA 4MYDA 3FPSA 2F6RA 3P19A 1NQUA 5CB8A 4QOSA 4RPCA 1MPXA 4Q4JA 3OZXA 4ZJPA 1EWYA 1YV9A 2ODQA 1Y42X 2DBZA 2PAFA 4OL0A 1ISIA 1OI2A 3TMAA 1LNQA 1E7WA 3URMA 4LY9A 3HHEA 2MU1A 4EBFA 3OJ0A 2FZ4A 1D2MA 1H5QA 4R6WA 2X1LA 1ZIYA 2PO7A 1TF5A 3QSGA 1GPWB 2AG5A 2R8XA 2AG6A 2Z2YA 3NEPX 5FQNA 2YY6A 1DKPA 4HWRA 4F6LA 1OZGA 3VKVA 1H94A 1MO2A 3TNFA 2OORA 4QWMA 4TVOA 3OM0A 2HTFA 4QSHA 1UXOA 1XF9A 5FFFA 1X7ZB 4OI4A 3O47A 1F0PA 3ZU5A 1X2BA 5DMHA 4XOIA 3WRVA 1CDDA 1JHMA 3AY6A 2FEKA 3PFGA 3KC2A 4R9SA 4Y2HA 1CJKC 1ZIPA 1IEQA 4LDPA 2K7FA 3LOQA 4BTVA 3B52X 2KX7A 5L95A 1XZDA 1AB5A 1XZMA 5E2IA 5DXAA 1HM5A 3K92A 3OQIB 4RHYA 2XNCA 2Y4OA 2GJ4A 1JDVA 2NV0A 3H05A 4U7FA 2WC1A 3G88A 3C5EA 5IC6A 5TRTA 5JSFA 2BTQB 3NXKA 2COKA 2WR8A 4LQDA 4YDSA 1L2TA 3G2KA 3G9XA 3K1TA 2VT7A 1E7RA 4MJ7A 1OFHA 2OHOA 3H4TA 1AQYA 2HBRA 1C9EA 1GDDA 4QYTA 4U02A 2VEDA 2JDID 4MOWA 5FPQA 5J2TA 5IJ9A 3SHOA 1EDOA 1Z36A 4EB0A 4MWDA 3MWGA 1E1YA 4XD7D 2VUIB 5EE9A 1NHWA 3D2BA 1BOFA 2QTWB 2YASA 4IKPA 4EGCB 3U44B 3JYHA 4CM3A 4Z9BA 4LDNA 1K0UA 2GK3A 1EK2A 4BRWA 1FZTA 1KVSA 3B3GA 1LLCA 1TQ4A 4IJKA 1Z39A 2PH5A 2XODA 4PZPA 2C7GA 4COKA 4BQOA 3GBPA 4GFDA 1MC4A 1W4ZA 3UW1A 4D8TA 1MQSA 3SX0A 4DSZA 3UQYS 2JJQA 3VUEA 2FSSA 2WMOB 3FPGA 5FOWA 4B2LA 2FZWA 4OX9B 5FNVB 4C22A 1WB4A 3R3UA 4MIEA 4DLRA 3GDWA 2Y2VA 2XKBA 4TLMB 2HMAA 4CF4A 1SXJD 2R7MA 2UYHA 5FQOA 4FTWA 3V3KA 4A0QA 1A98A 3GLTA 2REQB 2M98A 3RSCA 5REQA 1TYZA 3EDMA 1PGPA 3BXFA 3FCOA 3BL5A 1WS6A 3KT8A 2ZIXB 3FYCA 4LOHA 2I7TA 1OOEA 2EFEB 2WG0A 4LZLA 2EBHX 4RL4A 2EW1A 4OSPA 1LK5A 2HTEA 1HG1A 1E9EA 2B4YA 3TW0A 4IF4A 1NWHA 4AURA 2EXXA 3R09A 3SN6A 3FNRA 4LHXA 5JD4A 2H18A 3K72B 4O33A 2X13A 5AESA 1A9QA 4XLLA 1O1YA 1B43A 5FUWA 3KR2A 3ED5A 3L8DA 2OSVA 4FD2A 4Z1MD 2I62A 5DGHA 5E1OA 1E9RA 3UENA 1P19A 2JK1A 4Z4HA 1YKGA 2YH2A 4L5IA 2NUTA 4JI8B 3B2EA 2YYAA 3UY4A 3ZTTA 5C0OE 3C3DA 1QBKC 5DYYA 2GT1A 3EQ8A 1KSJA 3HJRA 3GLIE 4XD2A 4BNTA 1F5NA 1KKMA 2ZLBA 3HYRA 1UBEA 1YR2A 5CB4B 1XPRA 3W5AA 4E2YA 4LIPD 5J4VA 1QE5A 4P58A 2PBZA 5C8VA 3L6CA 4UJ5A 4KRGA 1HZJA 3O38A 1KFKB 2VYCA 2BM8A 4Y8VA 3TPZA 1XOIA 3D2CA 3EAQA 4DSOA 3OEHA 2JD2A 1NP6A 4BFCA 4EYKA 1ZNWA 4QG3A 1Q0HA 4A73A 5L3QA 1BH2A 1Y9ZA 3PNOA 4RCVA 3VPXA 4EECA 2K6GA 3QGMA 3OTQA 1DEKA 4HK4A 3BMCA 4KI0A 4XIIA 5TE9A 5SYMA 3FOFC 3YASA 4EDHA 2YMQA 4IDAA 1N3IA 1G2OA 1U1IA 4HNSA 4KQXA 1CIVA 4IHJA 1CEYA 1VJ5A 3UICA 2UKDA 1CCWA 4HVCA 1R6XA 4G0NA 3Q11A 3RJMA 2P2CA 4I4LA 4D9HA 3ZU3A 2BGUA 5CIQA 1UR5A 1TQ2A 2VCYA 3K30A 4MQEB 4PQRA 5BT9A 1RZRA 1PJQA 2DP4E 1A9PA 3HCBA 1T0PA 3HB0A 2ZR7A 5D3MA 3HXTA 3TLJA 1XPUA 3SIXA 1RWKA 1Z7BA 1F2TB 2Z4RA 3ZG6A 1FYVA 2JGIA 2ZCVA 5JNTA 1A9RA 1FDUA 1HSOA 3DNFA 2Q50A 4WGGA 4XASA 4R7GA 5IVDA 3V00A 4EX7A 2F90A 4G6ZA 1I33A 4PLTA 4QBTA 4WZBE 5TT1A 1RVDA 4RD1A 3VR6D 4C05A 1DDOA 3CSUA 3EDYA 4H7KA 1RRCA 1GCAA 3FTCA 4CHGA 2DPLA 2DPXA 3Q8WA 2VAWA 4CG1A 4MX8A 3AFHA 3T1QA 4XSVA 5AUNB 2GO1A 1ZUHA 2YXNA 4XM2A 3DMGA 3NORA 5ICMA 4EX6A 1Z6XA 3HQ4O 1II8B 1JR4A 4ECAA 4FFRA 5KTMA 4RELA 4EARA 4JHLA 5HBRA 3MN1A 2P9HA 1QGED 4FCTA 4GMKA 4HD8A 1R18A 2PXCA 2O8VA 4HDNB 4OQQA 3OZBA 3F49S 1WXHA 1XA4A 2XAUA 2DH6A 1VMIA 4ZU3A 4I6JA 3EA5A 5IDVA 5TB5A 4HVAA 5FTMA 2PTHA 2OFWA 1MP0A 3WMXA 3EMDA 4O2BA 3PSHA 2DKFA 3NYRA 2GSDA 4DCPA 3FYUA 3BSYA 3GLRA 3H16A 3R5XA 3OTIA 4L6CA 4MTCA 3KSBC 4AKIA 1ONBA 1U8CB 1OXVA 1G9SA 2ZKIA 3KLPX 3ZZ0A 1LU9A 4F6CA 2YVAA 4BXOA 5KWIA 1JTVA 1E9BA 2OMEA 1LQ2A 4MS1A 1KEKA 1N0WA 4D0NA 4I14A 5A4DA 1B1CA 4DV0B 1U9IA 2FFJA 3AX6A 3ZGOA 4OHUA 3QTBA 3UT5B 2K5UA 2CCKA 1RCUA 4F92B 3I4LA 4QGBA 3W04A 4AYTA 2LNDA 5B55A 4J3FA 1CY0A 3V4PB 4X45A 3A1EA 4YRTA 3F0TA 4YBZA 1CW2B 1ULTA 3QMWA 4WJLA 3LW7A 4TVBA 3OAAA 3T0FA 1FDWA 1BD4A 1GNPA 4S05A 2FFAA 2JIMA 4FK8A 5CFNA 2IGTA 5AJXA 3TXYA 1OBVA 4EVQA 5ITWA 3CRRA 2XA2A 3PLRA 2DU8A 5B58T 2HQSA 4JOBA 3WOHA 3TB6A 1GP2A 1L4YA 1OXKB 1WXQA 3MWEB 3I61A 4X1IA 2B2CA 1ZI6A 5JMWA 4RQTA 2HJWA 5JYEA 3EVZA 2D59A 3LTEA 1Q1ZA 2NW6A 2DULA 5K05A 2M1ZA 3DEIA 4FQ5A 7MHTA 1I4TD 121PA 1VKRA 2DWPA 3D7KA 3RUHA 4KVGA 1HTBA 1RU3A 5IT4A 3U3ZA 2WF7A 3T1TA 3HVKA 3H5NA 5C7OO 4U2FA 2NZJA 2OO3A 1NI3A 2PPVA 2OV8A 4IMPA 2P11A 1UFOA 2FP4B 5HE8A 2OYRA 3ENQA 3G79A 1KDTA 4KLNA 1LDNA 1O8BA 1QUFA 1GN8A 1UP4A 2R8PA 1JR3A 1XRMA 1JPUA 1KBQA 1Z5NA 2V1XA 1GT6A 5JMOA 2IU3A 1GZDA 1Q17A 4Q6BA 3AW8A 5FA6A 1RWXA 3HWSA 4BVJA 3VHQA 2FQXA 2HSDA 4YJ2B 5KNDA 4ABTA 1EI9A 1W52X 1KPGA 1ZZEA 1QC5B 4M9CA 3ZWCA 4B40A 1O6CA 2XNDA 4YJHB 5LU8A 3FOZA 4PHHA 4UUQA 1NVKA 1ZCAA 1VXOA 4H1VA 4TT3A 2BUCA 1EP2B 4NV1A 2WF5A 1ECCA 4Y1GA 1YZFA 5GMOA 1X0XA 2X5XA 4QU9A 4OQXA 1TT5A 3ZJTA 1AIPA 1AKMA 3KYDA 3OZAA 4HNHA 3TLMA 4A91A 5LZ2A 1XX6A 4R5HA 4JROA 1Z8FA 1ZOPA 3KV3O 3U7JA 1XELA 1ZRMA 1ODLA 3S2UA 1ECLA 1TF2A 1CXZA 3GR6A 3MS4A 4G89A 4DLAA 1OXUA 1G21A 4GOOD 3I04M 1QB7A 3WMEA 4A92A 2FEWB 3BWBA 3ZDRA 1QV6A 3FNHA 1W36C 3M9LA 4ZHQB 4JP8A 2YW9A 1ADBA 5KAPA 1X70A 3FG9A 3H0KA 3IT2A 1XXHB 3JVDA 2WJAA 3FLEA 2E49A 5CT6A 2AVNA 1KI9A 1M73E 3OIFA 3D4IA 2YIDA 2XMCA 1KMHB 4IDCA 4FE4A 1IB0A 1XWFA 3BILA 1SIUA 5EUBA 1K89A 1GG8A 3KB6A 3M4JA 3ME5A 1CY8A 1SKYE 2I4OA 1RFGE 4ZI5A 3CCBA 3U5TA 3UJNA 2QR5A 2RGCA 1T9AA 1XB2A 1Z83A 3OE5A 4HXYA 4BIMA 2NTJA 4XDGA 2CDNA 4TLCA 2HXSA 2J6CA 2A86A 4IIJA 1CUJA 4AZWA 5IMBA 1O4VA 4PWYA 4OA5A 3DVRX 3HB4X 1BO6A 1IVSA 4O59O 1ZD4A 1IJKA 3DEKA 2FGKA 1BMTA 1JQBA 1TKBA 3DE5X 4ALKA 1KFCB 5EJ8A 4OXKA 3T9BA 3I9V1 4QGSA 4XVCA 1J20A 3EWAA 1GAWA 1NMQA 1TXGA 2EQBA 1N7HA 1X0VA 3DXZA 4XIJA 4II3A 4LWZA 2G6TA 3BKXA 4XIFA 5CJPA 4Z8XA 5A5VA 1YI1A 2Q5LA 3T95A 4JLPA 5KCZA 3E9QA 5CH8A 4WOCA 3VO9A 3UHOA 2HK7A 2PX2A 2VP4A 2R4UA 1XYGA 2E4WA 3KKEA 2P2LA 3LY7A 2F3QA 3C7KA 5AI9A 3RIYA 3ZI0A 4XVHA 1PLLA 2Z1DA 4M60A 4R16A 5B6JA 4ROSA 2C94A 3FRHA 4KDCA 1Z29A 2XUAA 2EW2A 1V5FA 2VF7A 4PG4A 4HDAA 1DG1G 3JRWA 3N5CA 1KMQA 4HRVA 1E3DA 4JT2A 4A82A 1P6UA 2JGFA 4FKBA 4CM1A 3Q1LA 1VJTA 4DRXA 2NU9B 4M89A 1U0OC 4OHBA 4QELA 4TMVA 1D6NA 3E5RA 4QUHA 3NHMA 2Z5VA 1MUUA 3DF9A 1S8OA 3B38A 1P4RA 1XTJA 2YXDA 4GNRA 1A1VA 2VP2A 4FSXA 4F1WA 2JIZD 2G4CA 3L1KA 3T1HB 1LSSA 3EYWA 3QXSA 4IBOA 4MO9A 4TSFA 1M2WA 3G68A 4ZO4A 3ANYB 3B9RA 3F7TA 3FKSD 5CPFA 3S68A 2PZLA 2VWHA 4B71A 3X1ZA 2FA9A 1E3WA 1TF7A 3E7PA 3WK6A 1NIPA 3WB1A 1UKBA 5AT1A 2X9QA 3WO1A 4KSBA 1ZXLA 3GMDA 2NAFA 2WV7A 2X5JO 3NWOA 4DXAA 2ZR0A 1P4SA 3AC0A 4M1YA 1GFZA 2CN1A 4PPNA 4YJFB 5JSZA 3WAJA 4DLPA 1YJBA 2O7QA 2OK8A 5B37A 1FS4A 3V7UA 1JMKC 1OPRA 4QPJC 3RBAA 2C59A 3DOJA 3H2YA 2LRHA 4R7TA 3VV2A 4CTNA 4AG3A 2PPLA 4OQDA 4EMUA 1J9ZA 2QUIA 4EBBA 5EI5A 1FTGA 2C5BA 5AKXA 1GUZA 1NUPA 2B5VA 3JSXA 2PM8A 4RJTA 1H0RA 1CR1A 4GPBA 4A1FA 4P8RA 2IYLD 1C4OA 1CY6A 3W2EA 4ARBA 4BGUA 1RABA 3D4OA 2B8NA 3DDSA 1WQ3A 3MYRA 3MAJA 4MUJA 4Z86A 5L3VA 4DV6B 4AUKA 4QC2A 1HZZA 1I4LD 3DCIA 3HB7A 1DHRA 2G25A 1TK2A 2IITA 3EA4A 2A1IA 5K03A 1EB9A 1KJ8A 1NU6A 3KZOA 5G4LA 1O96A 1RPTA 2LWIA 3FPCA 4C30A 5FUMA 4XJSA 3GGSA 4GDFA 2YVQA 3MW8A 3Q7SA 5ITZA 1QO7A 1A97A 4INAA 1I3KA 5JBQA 1RRFA 3Q98A 4OLFA 2AOTA 4LWQA 1G17A 4PVCA 3GP8A 1CY2A 5C35A 2AZXA 2W7TA 4G4SP 4JXJA 5L3SB 4BFLA 1YS6A 2RGDA 2MTBA 2XT9A 1U1GA 3IQZA 2OGTA 1KH2A 5FPHA 1PYDA 3KT6A 1GZ5A 5CBKA 3E8MA 1TCBA 4D56A 3TZBA 3L7IA 2C4MA 4QZVA 1ZH0A 3ZVNA 2MHCA 3W4JA 1U0SY 1XCPA 5HCIA 3EZNA 1ZGBA 3GZJA 4DSNA 1X1RA 1WF3A 2VYND 4PNPA 1N8SA 2KS6A 3ZYZA 1IRXA 1RM5A 1TRKA 4XRGA 4UVEA 1CNMA 4CDNA 4I3FA 4KC0A 5BWCA 1T1SA 4Y1FA 3RFXA 2RH8A 3A7DA 1XMSA 3PV0A 1E1NA 5ERXA 4EGSA 3HDHA 2CLKB 1JNXX 2XWBF 4CV1A 2YXLA 5JCOA 3FTDA 2LZ0A 2ZUVA 1FIUA 4KI7A 1KDRA 5IK2A 4J2OA 4JP1A 4O4IA 2I2CA 1AMOA 1AG9A 2MWMA 1BCRA 4KV7A 2J07A 3JQAB 4POAA 3OJLA 3H42B 5DRYA 2Z5LA 1WU8A 4DMUB 2VJBA 1AT1A 4IJ5A 1UKYA 3PTZA 4QNRA 5G0VA 4E07A 3AVVA 1W93A 3ZVLA 2V7WA 4HDOB 1XMPA 2Y68A 4AMUA 1BDJA 4BWGA 2BUBA 4M38A 1IIRA 3F96A 4FYMA 4GZ3A 5IXSA 2CLDX 1G42A 3LWBA 3PNKA 4BCDA 2L17A 1M10A 5AQ1A 5LQAA 1P2SA 3SJ7A 3D6VA 4X20B 4C88A 5TMEA 1PEDA