5HRUA

Crystal structure of plasmodium vivax ldh in complex with a dna aptamer called pl1
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
313
structure length
305
Chain Sequence
KPKIVLVGSGMIGGVMATLIVQKNLGDVVMFDVVKNMPQGKALDTSHSNVMAYSNCKVTGSNSYDDLKGADVVIVTAGFTKAPRDDLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNPVDVMVQLLFEHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDEEVEGIFDRTVNTALEIVNLLASPYVAPAAAIIEMAESYLKDIKKVLVCSTLLEGQYGHSNIFGGTPLVIGGTGVEQVIELQLNAEEKTKFDEAVAETKRMKALI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/dna
molecule keywords L-lactate dehydrogenase
publication title Crystal structure of a DNA aptamer bound to PvLDH elucidates novel single-stranded DNA structural elements for folding and recognition
pubmed doi rcsb
source organism Plasmodium vivax
total genus 117
structure length 305
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2016-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5hruA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5hruA02
3JV7A 4HP8A 4ALJA 4L76A 1HRDA 1KVRA 2BFMA 4XR4A 5A5EA 3VZRA 3JYPA 2IYPA 1VPDA 1WDMA 3MOGA 5B37A 4BO2A 4BHTA 1ZMOA 4GAEA 1XU9A 4M87A 1CJCA 2JCVA 4GKBA 2JFHA 3PVZA 3U0BA 4C4OA 4CM9A 3GEGA 3M6IA 3D3WA 3OECA 4J4HA 4LSWA 5G0TA 4TKLA 4NK4A 4UREA 3T4EA 2UVDA 4UUPA 3FBTA 1UXIA 3NJ4A 5JAQA 4UVEA 4YJDA 1VE9A 4LW8A 1NQAO 3WICA 1DPGA 3TZCA 3C8MA 4CM4B 3DZHA 3KHUA 5JAMA 3R0IA 2PD3A 3C1TA 3L6DA 4J91A 3QWFA 3PQEA 2G82A 1N9GB 4I9UA 1E3IA 4B4UA 5JC8A 3LC7O 4RDHA 1C0LA 4XQGA 2HUNA 2I76A 2Y05A 1EVJA 1YJQA 4BGUA 3EW7A 5GY7A 2GN6A 4OSOA 4IIVA 3KYDB 4Q3DA 2FSSA 3W6UA 4CQMA 2O7SA 4CM5A 4K28A 2FZEA 1GD1O 2VNAA 1BVRA 2YHIA 2YZ7A 4ONEA 1NVTA 4MKXA 5JDCC 3UOGA 4CM6A 1VM6A 2NVUA 1G1AA 3ZWMA 2IXAA 3WGZA 3R3JA 4F6CA 1B8PA 5FF9A 5C7IO 1BW9A 1XG5A 2A35A 1DBVO 4AL4A 4CV1A 4NBTA 3GOHA 3CSDA 3VH2A 3X2FA 3BMCB 1GYQA 1E6EA 4XKJA 5KKAA 5TJ9A 1JAYA 5F5LA 4ZQFA 5I7FA 5I9NA 1LUAA 2D2IA 2ZB7A 4TQGA 3AU8A 1A71A 3IJRA 2X8LA 4R9SA 1NQOA 1ZK2A 2D5AA 3KTDA 3L0DA 4PG5A 2ZKLA 3RCBA 4D3DA 1Y8RA 5ICMA 2C20A 3JD2A 4QTZA 3ITDA 2DVMA 4BNKA 1O95A 4CV2A 3TZ6A 5TNXA 4D45A 1FF9A 1UAYA 4B8ZA 3ZZNA 2PWZA 3DZBA 5JSFA 2DAPA 2IZ0A 4NBRA 3I52A 3L9WA 4PIVA 4Z9FA 4PLYA 1NYTA 1B15A 5T67A 4BNIA 5THQA 1M6WA 2HJRA 4I8XA 1FMCA 3D5QA 4O63O 4DUPA 4J1QA 4XGKA 2NUAA 4L74A 2X86A 4B79A 2PD4A 2UUOA 1YQGA 4YJFA 3EY4A 4KZPA 5EESA 1SEVA 3RUAA 5HTOA 3OQ1A 2C5AA 4MVJF 3K8ZA 3PJDA 3QY9A 1TI7A 2H6EA 4MVJD 2AE1A 4JROA 2O3JA 3ZW8A 4JX8A 1P1HA 2OZPA 2QZZA 3VH1A 1U9JA 2XXJA 1HT0A 1O8CA 1I3NA 3QP9A 1X7DA 3RUFA 5EIOA 1BWSA 3UICA 4E4YA 4PCVA 2BRUA 3DTTA 4BO8A 4CLXA 2P4QA 2AEJA 1J49A 4BNMA 1NHWA 3WJAA 1U7HA 5DULA 1V6AA 1E3WA 4C7JA 1CYDA 3JQFA 1R4NB 3OH8A 4Z3KA 5IXSA 5JAZA 1CDOA 3L4BC 3ABIA 4IDCA 2PGLA 3BTOA 5B12A 5G4KA 1JKFA 1MC5A 3H9QA 3MWDB 2P9GA 4E2XA 4YAKA 2Y99A 4AG3A 4YXFA 1JTVA 2BELA 2JJYA 1D4FA 1BXGA 3PHGA 4RDIA 2ZK7A 1HZZA 1TVEA 3QRWA 1QORA 3KYBA 3S55A 1PS0A 4Z0PA 4PRKA 4U8GA 1ONNA 4FSHA 4HFMA 5CDGA 1DHRA 5A04A 4HNHA 4CLDA 4LMPA 3S2EA 1U2DA 1KBZA 1I30A 1QR6A 1TT5A 1D3AA 4GMGA 4DVJA 3NX4A 2WWRA 1P1KA 3ULKA 1LDMA 2EW2A 3NUGA 1GU7A 4P22A 1PL6A 2IEDA 4AJ2A 4BS9A 1FJHA 3A1NA 4KDEA 4NFHA 1XHLA 3FPCA 4J2HA 1LEHA 4N54A 2YDXA 1K5HA 2GUGA 3AUTA 4CR7A 3STHA 5CDTA 2A94A 2C54A 3RKRA 2HRBA 2VWHA 5KJ1A 3OIGA 2Y1FA 4RPGA 4TWRA 1XQ1A 2DKNA 3GVCA 1PS8A 1HKUA 3DHYA 4MP8A 1K89A 4WEQA 2RH4A 3JYNA 3WGTA 3EVTA 2D8AA 5LDGA 3WS7A 1BXKA 3D4PA 3I9NA 3H9GA 1RWBA 1WXDA 1BVUA 2Q2QA 5A9SA 2E37A 1YS4A 2W2KA 1EEHA 3LT1A 5BT9A 2PGDA 3G0OA 2IDZA 4TKMA 1KY4A 2Q2WA 3QHAA 2J3JA 3H9UA 3K96A 3RUIA 3O26A 1C1XB 4XWYA 3LVFO 2ZCVA 3NGXA 2O48X 5BSEA 3S2GA 1LC0A 4PVCA 1ZXBA 4GSLA 2IZ1A 4NFYA 2DFVA 3A28A 4TRRA 1QV7A 4YWJA 5KVCA 1EK5A 1EE9A 1CIVA 1JWBB 4FGWA 3U4IA 1ENYA 2HU2A 4CL3A 1ZK1A 1Z82A 1YGYA 4LRTB 1DXYA 1FK8A 3V8BA 3U4HA 2EJVA 4CMEC 3P2OA 4WNCA 3QLJA 5CHEA 2QRLA 4EJMA 5C7OO 1E6UA 4XRRA 1NQTA 1HDRA 5L53A 2ZQZA 4WLVA 4QXMA 3ANLA 4WNIA 4DA9A 3BHMA 1PGJA 4XJSA 4EUHA 2IZZA 2CF6A 1OBFO 3H3JA 3RBVA 3AI2A 3KV3O 1DO8A 2HMSA 3H5AA 1YO6A 1G0OA 1X14A 3KO8A 3EZLA 1YDWA 2CDAA 3C7AA 1FDVA 1WMAA 3GGOA 3WNVA 4AICA 2V6BA 1P33A 5CAEA 4BNNA 2Q49A 4DLAA 4IXTA 3GMSA 5KIAA 5MGBA 2TMDA 2Y1OA 3QQPA 1I32A 3LK7A 4GVXA 4RQTA 1OMOA 4R68A 2W2KB 4M8SA 2R6JA 5IZCC 2YV2A 4UUMA 3OQ6A 4YT5A 2VRBA 2CDCA 2VTDA 1K6JA 1YQXA 1LC3A 4JK3A 3I6QA 1PWZA 3P19A 4WLNA 4XZ3A 3DWFA 3UAGA 4BV8A 3AY6A 1ISGA 6LDHA 3SEFA 1I5RA 2NVWA 1ZEMA 3DQPA 3OJOA 3ROMA 5C37A 5GZ1A 3L6EA 3WB9A 4FC6A 2V6GA 1ZK0A 7ADHA 1F17A 2YJZA 3HN7A 3RASA 4CMAA 4DPKA 3MOIA 3RQSA 4WEOA 1XU7A 5DCWA 3KLPX 1OC4A 5A3VA 4D43A 3JQAA 2WD7B 1IOLA 2C2XA 5F5NA 3UGKA 5L4LA 3AUAA 2RHCA 5AXDA 4WOKA 4J1NA 2P91A 3PIIA 1E7YA 4Q39A 1KC1A 3U4CA 1SOWA 3IKTA 3RC9A 2I3AA 1P77A 1VKNA 1MXFA 1U5AA 3VDQA 2I9PA 2ZYGA 2QRKA 2WEKA 2DBZA 5TT0A 3IIEA 4RZHA 5G0WA 4GVLA 1NR1A 2GD1O 1YWGO 4R5MA 4BO3A 3GDGA 1Q2XA 1WPQA 4LMRA 3RROA 1PQWA 3WIDA 3SC6A 2NM0A 3WXBA 3VPGA 5DP1A 4M49A 4FGSA 1A72A 4BUCA 1ONPA 4I1IA 3I23A 3UUWA 1LI4A 1PJ3A 4NPCA 1NM5A 4NBWA 5DF1A 1IL0A 3ZWYA 4PZDA 4KWHA 2GNAA 2Q1UA 3GF4A 8ADHA 3ROQA 3ONDA 4J43A 4CLEA 4D7AA 1HE5A 4XQCA 1KS9A 1VRWA 4P4LA 5F21A 4GL4A 3E03A 4IJUA 1LSJA 5DT9A 1T2EA 2DBVO 3AOEA 3IDSA 2PR2A 2CF5A 4A10A 1V3UA 5TRTA 3ADOA 3PLRA 4B3JA 2QW8A 3JQ7B 3U4DA 1DIRA 3QIVA 4QSMA 2VUTA 3I1JA 4ZQEA 4JJFA 4Z0HO 3T7EA 1UUFA 4XJTA 3HDJA 3NDIA 2EP7A 2OUIA 5DCUA 1ISJA 1RJWA 4OKNA 3B6ZA 4KTTE 3I9JA 5IJZA 4NFSA 5T6BA 5GMOA 4I5EA 3V2HA 4J1TA 3GRPA 3IOYA 1YOVA 1JVBA 4PLPA 4RL6A 5JMWA 1HE4A 4KQWA 3UVEA 3WMXA 1A4IA 2I65A 1GZ3A 1I33A 4XGNA 4AVYA 4HKTA 4GWGA 4R1SA 5MDHA 2QG4A 1UR5A 2B5WA 9LDBA 2CMDA 3VKUA 5ADHA 3PZBA 3D4NA 3N7UA 4DYVA 3PTZA 4GH5A 4OO3A 4XIJA 4MO2A 3OQBA 4D41A 4FJ1A 3AFNA 4FIZA 5CP8A 3SXPA 1NAHA 2EWMA 3PHLA 1O9BA 3GG2A 5AQ1A 1MGOA 4J7XA 1OZAA 3VTFA 2D1YA 1X1TA 1E7SA 3F6YA 3OIFA 3W4IA 3WSVA 3FD8A 3QJ5A 1E7QA 3F5QA 4EI2A 1J6UA 4XRGA 2VZ8A 1N7HA 2LDXA 4IDFA 4JBHA 2O4CA 1T2AA 4ALLA 3BTSA 3O03A 4B4VA 5HBRA 3GG9A 2P5YA 2X5OA 3AUSA 2PK3A 3NDRA 3CIFA 1T2FA 2X9VA 3VVBA 2VRCA 1GYPA 4WPGA 3DAGA 4CMKA 1LLQA 4EBFA 4YQYA 4R1NA 4XD2A 5IN4A 3TPCA 3GT0A 3VOSA 3Q1LA 1ZSNA 4IXWA 3SJUA 5F3RA 4ZD6A 1PJSA 2PV7A 5KVSA 2X22A 1LQUA 3K9QO 2QQ5A 2PZLA 2HSDA 4U0KA 3Q2IA 1B2LA 3DOOA 4CM9D 4CM8B 3FNHA 2X0RA 4RPKA 2EKQA 3UW3A 1E92A 3CZRA 3ZU5A 1EDOA 3WNQA 1YOVB 3JCZA 3CZMA 1KC3A 2YY7A 3TQHA 1X13A 5L4NA 5JDIA 1DAPA 2NWQA 5DOZA 3ZN2A 4BNWA 3UCFA 1C1DB 3GZNA 4WUVA 5I8ZA 3QVSA 2EG9A 1KEUA 3R6DA 2OXIA 3EZYA 1Q7GA 4R41A 3KSZO 4E6PA 1SEPA 1SB9A 4CV0A 1L1FA 2GGSA 3AI1A 3BIOA 2FPGA 4XQ9A 2JD1A 4RVDA 3FF4A 4MIOA 4ILKA 5TIIA 2EF1A 1GFSA 2VTEA 1P74A 1I3KA 1Y5RA 1ZO8A 4M89A 4CQMD 5U1PA 4B7XA 4PGFA 3RUCA 4AJPA 4Y6RA 3RUHA 3ZHZA 3GH3A 4EDFA 4NMHA 1A7AA 5GZ3A 1SCUA 2JHGA 4DQXA 4R1TA 2HDHA 3FHLA 4S1VA 1W8DA 3KYCB 1HDXA 1P44A 3V1TC 2OO5A 3UH1A 3ZNQA 1EFKA 2GZ3A 3HUDA 4J49A 5TS3A 1IUKA 4ZQHA 3KETA 1LDBA 1Q0QA 2AG8A 2FR0A 4IJVA 4J7UA 4L0QA 4XX0A 4FFMA 1DIAA 2PKQO 1IULA 4PLTA 4B4WA 4B3HA 4E5KA 1G6KA 3D0OA 2B35A 4HXYA 1DFIA 3GK3A 4YCAA 4DQVA 1N9GA 1VLLA 3EDMA 3IS3A 2Q3EA 3GUYA 2PLAA 4A2CA 1MXHA 4DIBA 5EPOA 3DR3A 3K92A 1XGKA 4YRAA 1BDMA 3H2ZA 2BFPA 4JJIA 5TX7A 3WX0A 3KYDA 2JKVA 2QHXA 1NXQA 1Q7CA 1RM5A 5T64A 1Z45A 1ID1A 1U5CA 4FS3A 3HDYA 3FTNA 4BO9A 3GN2A 3OJ0A 3TZQA 4BGVA 4AJ4A 4A7PA 4DGSA 1YB4A 3GNQA 3H5NA 3ENKA 4EJ6A 1ADGA 2C7GA 2I5PO 3OA2A 2IEBA 2VUUA 1EFLA 4EGFA 1SNYA 1ZMTA 4GKVA 2HRZA 3BMCA 3GFBA 5CEFA 1EBFA 2A4KA 4GGOA 4PZEA 3RFVA 3ZWAA 4QQRA 1DAOA 3KVOA 1R4MA 3I9LA 5BSGA 4BKOA 2O3RA 1ZVMA 5LCXA 2E6UX 2O2YA 1W6UA 1ZBQA 3RC7A 5JXWA 1AHIA 4N5NA 1P1JA 3PGXA 5AOVA 1GYRA 5FI5A 3L9XA 3D1LA 4EUEA 1ZJYA 3ZU4A 4BNVA 4KWIA 3G1TA 2NTNA 3ZWNA 4BQPA 2Y0EA 4J7CA 3FWNA 1E77A 1A5ZA 3ETDA 1CQJA 3TRIA 2ZB3A 3ZHBA 2G1UA 1HLDA 3F4LA 1RM3A 1LA2A 2IE0A 3P7MA 5CDYA 5IFLA 5JE8A 4RVSA 3NV9A 1EUDA 3RD5A 2VHWA 4J2OA 1ORRA 3LF2A 3NYWA 2PKQP 4R54A 2FPPA 4BV9A 4BO5A 5DZSA 3EHEA 3OHSX 1KY5A 2QYTA 4DPMA 3HFGA 2IODA 4BNFA 3RU7A 2I99A 3GDFA 1X0VA 3W1VA 4OSPA 5KTKA 3RBZA 4HY3A 3DMYA 3MJSA 1DLJA 3JQ6A 1VKOA 1XSEA 3LYLA 4GPD1 2GCGA 4J90A 2WYWA 5A5FA 4J0EA 3FSRA 4BNXA 1R4NA 1DSSG 3BMNB 3LC2O 3RUDA 4XYLA 1I3LA 1K0UA 4L4XA 1ULUA 1DIBA 1QYCA 1CWUA 4GI2A 4NG5A 2PY6A 4BGEA 3VTZA 3KM0A 4MDHA 1NPYA 2DLDA 1L7EA 1R4MB 1EZ4A 2X9GA 1NAIA 4PLFA 3HFSA 4R16A 3RI3A 5KVQA 3BMQB 3DBLB 5ENVA 4KOAA 3GA0A 1E1LA 3ORFA 4FC7A 2X58A 4H3VA 1LQTA 4RF4A 3RIHA 3SLGA 4E5YA 1KERA 1BSVA 5T5QA 1YQDA 4NHEA 4MP6A 4Q9NA 3TSCA 2YHUA 3JQ9C 1LLUA 1UDBA 4IGFA 1SAYA 2Y93A 1KYQA 3I6IA 3MJ4A 5KVVA 4W6ZA 4NU6A 1PGQA 1IZ9A 5B4VA 4NIMA 3B20A 1Q1NA 4XCVA 3JD4A 2O7QA 2Y1GA 1TXGA 1LJ8A 3FPLA 1HSOA 4DTIA 5CDUA 4YYZA 3GPIA 2BD0A 2YV3A 4CMIA 2CDBA 3OM9A 3Q3CA 3TL2A 2GO1A 4P4GA 3OETA 3BMOB 3O9ZA 1U3VA 4WJZA 4BMVA 1O5IA 4FCCA 1RPNA 3V1UA 3QE3A 1V35A 4AJKA 3P2YA 1QP8A 1QYDA 2I6TA 4DMLA 1PJLA 4XYGA 4J16A 1ISMA 5JYDA 1VJ0A 3N58A 5ITWA 1BMDA 1C14A 4YDRA 1H6BA 1DC3A 3X2EA 1QYXA 3FTPA 2BGMA 4KQXA 2YQ5A 1T1RA 4FJ0A 4B4OA 1ONOA 1M67A 2VWQA 2X0NA 1ZIDA 1NTOA 5JMPA 2GERA 4OM8A 4ZRNA 4CJXA 1I8TA 2YW9A 3N74A 4CUZA 1C1XA 3GAFA 3WGHA 4JLWA 1QLJA 3H9JA 4UUOA 4YJHB 1C3VA 3RU9A 2V6FA 4CMCA 4E12A 2TMGA 5CPBA 5I9LA 1ADFA 1GDHA 2YUTA 3HB5X 1XIVA 1ZEJA 3WSWA 1Q7BA 4QO8A 3PXXA 2AEMA 5H82A 2ZJ0A 5ENDA 3ZV3A 1CQIA 1OAAA 4GX1A 2GDZA 3JQEA 3PP8A 4DREA 4INAA 1UXJA 2GLXA 2HCTA 3KBOA 1VSVA 1VL6A 4DMMA 1PJQA 4E31A 3S8MA 5JBIA 1UH5A 4DBZA 1I0ZA 1HZJA 4CLRB 1AHHA 1B0AA 1DC5A 1EQ2A 3CPSA 4YVFA 4R4JA 2AQIA 4YQZA 3ZWPA 2OHXA 2EXXA 1IHYA 1NVGA 3GGPA 1X7GA 4FB5A 3NEPX 2VYNA 3AK4A 1NVMB 1V8BA 3IJPA 5FI3A 3TNLA 4GSKA 4ZGWA 5ICSA 1J4AA 5B4TA 4DQUA 3TFOA 4IQ8A 1XKQA 2D59A 3P5SA 2Z95A 1WWKA 3AJRA 3JQAD 2W90A 4CMIB 2R00C 4II2A 3CXRA 3GHYA 1E0DA 3RJ5A 3WQQA 1BDBA 3PHJA 3RWBA 2HLPA 1LDNA 4OH1A 2GZ1A 4W82A 4G2NA 3A14A 3BZUA 1GZ6A 3LF1A 3WDSA 5ILGA 1R66A 1B7GO 1LXCA 1GZ4A 1NNUA 1Y7TA 3VZPA 1UZMA 3E9QA 2IXBA 1XCBA 4PG6A 3JYOA 3DZFA 4GGPA 5L7YA 3AM5A 4Y6SA 1WNTA 3TL3A 5ITVA 2C5EA 2HO5A 4E3ZA 1ZFNA 4RCVA 2AA3A 4DRYA 1QSGA 2HMVA 2NTJA 3KOUA 3HDQA 3PWSA 5HA5A 2EGGA 4XDYA 4RPHA 1VI2A 9LDTA 3WGIA 1Z7BA 4F45A 1GY8A 1VJTA 1DDOA 2B4TO 1U2GA 1TEHA 4XA8A 5TC4A 5CFZA 3OIDA 1T25A 3AY7A 1PQUA 3DHEA 5CEJA 1F14A 2WD7A 4B7UA 3I9KA 3QWBA 3E6AA 2EGHA 1PL7A 4AJEA 2C7VA 4BNGA 1KEVA 4FJ2A 1T2CA 5I9MA 1U3WA 3GGGA 4HFNA 3CUKA 4IMPA 1ZK4A 2FMUA 4IJWA 1GUZA 2XXBA 3ITKA 4RZIA 5AXAA 4JQCA 3TZHA 4F6LA 2Y0DA 3L07A 3GLQA 1DJQA 1O94A 4TMFA 4TVOA 3ZGYA 3G79A 2YQ4A 4ZU3A 3D4OA 5C3MA 4AJOA 5KCZA 1SMKA 4XIYA 2JFGA 3JYLA 5JW6A 3PHHA 3AY3A 3PQFA 4K9DA 5I7VA 3GN1A 2J3HA 1SZJG 3GQVA 1WW8A 4RVFA 1XEAA 3M2PA 3QVTA 4RF2A 2GZ2A 4EJ0A 2H9IA 4O59O 1V3TA 2O4UX 5TF4A 3VAZA 1U7TA 2HJSA 4D46A 3MEQA 2AXQA 1Y8QB 1QYWA 1U8FO 3BHJA 1FXSA 1YBVA 2NQ8A 1NWCA 2VT2A 4W7HA 3RC1A 4P38A 1ARZA 3AI3A 3C7DB 3JQ8B 4D0SA 1G0NA 4A03A 2CFCA 3OF2A 4R69A 1UP7A 3HWRA 2D0IA 3WWZA 3PYMA 1RYDA 4L73A 1ZK3A 5KWEA 4JGBA 1V9LA 1SO8A 3WOHA 3DHNA 4LK3A 4PG7A 4W4TA 2X0IA 1S7CA 3ICPA 2JCXA 1RM4A 5ES3A 4G65A 5T8KC 3O8QB 2DFDA 2HMWA 2JCYA 1WP4A 4R51A 3JQ7A 5A4DA 1MA0A 4BNYA 2X9NA 1I2CA 3DO5A 3LSYA 3AOEC 4MJLA 1B26A 2O3UA 4ZQGA 5CDSA 4OQYA 1E1MA 2CVZA 3PHIA 4QFDA 2CVQA 3BYZA 1HDCA 3DOCA 4OYRA 3G1UA 3HSKA 3CINA 1OC2A 3OP4A 4ZVVA 2O3SA 4NU5A 4D3FA 5BSFA 4FFNA 5L40A 2O3TA 4R01A 2GN9A 1IPFA 3DDNA 1BXZA 3PIDA 4LVCA 1I36A 3WLFA 5CEEA 1HYHA 1MP0A 3ZHYA 4WCFC 2VOJA 4YJGB 5AXBA 1ZCJA 1I3MA 1ISFA 2B36A 1E7RA 2VRCD 3A06A 2DTEA 3HE3A 3L4SO 5C5IA 4MKRA 3IKVA 5G0UA 4Z3DA 2J5QA 1XDWA 4NQZA 3EVNA 4EUFA 1EDZA 4Z0TA 4WLEA 3PWKA 3QVXA 1GR0A 3KEQA 4IQGA 4UUNA 1DC6A 2NSDA 4YA6A 4MKZA 3D64A 5TQVA 5FWNA 3V2GA 3TZKA 4BMNA 1MV8A 5DCYA 2AEFA 1Q0LA 2QRJA 2PA3A 4QUKA 1P0CA 1DJNA 3OEWA 4FR5A 3H8VA 1KVUA 1ENOA 1CEQA 1NP3A 2JFFA 3HHPA 2P5UA 2AQKA 3RFXA 4RLHA 3HNPA 2GASA 1IPEA 4HX5A 4QECA 3DL2A 3I9OA 4FOSA 4U6QA 3WR5A 1VL8A 4OQZA 3OBBA 2NU7A 4ROSA 3IAHA 4OHUA 5CPFA 4N7RA 4IBOA 5FFFA 2Q1TA 5KOIA 4W9NA 3M1LA 5TJHA 3JQGB 1Z7EA 3ZDFA 4JP3A 3ZV5A 3ZNPA 5EL0A 4J9VA 1LX6A 2VHXA 1NBOA 3BA1A 4E13A 2AE2A 4YR9A 4MVJE 1V3VA 4WECA 1ZH8A 3RJ9A 1PR9A 3O38A 1M66A 2H1SA 3K2BA 4E2WA 4HADA 1N8KA 3E5MA 4EYEA 1HYEA 3C24A 3I5MA 3NTRA 4TROA 3C85A 5JCJA 3RVDA 3TOXA 2B4RO 3PK0A 3RFTA 3WG9A 4DYDA 1PTJA 3I3OA 2GN8A 4L8VA 3E5RA 3IP3A 1UDCA 1C0PA 2ZCUA 3ZH2A 3U5TA 1P1RA 1ZKMA 4J4TA 1LSOA 4FFRA 3WYBA 2AMFA 3NT4A 2NV6A 2Q99A 4RPLA 4J6FA 1PX0A 3PGJA 4ZN6A 1UJMA 4NDNE 4JCOA 2VN8A 5IZCA 1PU2A 4E5PA 2JAPA 2DBQA 2P2SA 3FCOA 4CM8A 4CR8A 5K6AC 1PZEA 2CSUA 1J5PA 3H9EO 1QMGA 3GNTA 3FNFA 1GV0A 1LBEA 1R0KA 3PI7A 5FYDA 1SB8A 3ZWOA 4E21A 5CG2A 1MUUA 3QWAA 1C1DA 5G4LA 5LDHA 1PGPA 3JD0A 2UUPA 4N5LA 1KVTA 2OBYA 4G81A 4PLGA 2CD9A 2CNBA 2VCYA 2ZIZA 4Z6KA 3GDOA 3GRKA 3S1LA 1UXGA 3F47A 3A9WA 5ER9A 3OEYA 3OICA 1TT7A 2FR1A 4XYEA 1LSSA 3O4RA 1R6DA 1YBAA 2IRWA 4CV3A 4IDDA 3DZIA 4UVGA 1YB1A 3INTA 4BQRA 3UN1A 4NK5A 4PLWA 3VPHA 3H5RA 5JYEA 4BNHA 1VSUA 4YAEA 3JD1A 2VZ9A 3JSAA 2HKIA 4OXYA 1PJCA 3C1AA 1KVQA 3OFSA 5A03A 1X0XA 5JC1A 1XA0A 3BHIA 1ENZA 3OSUA 5JS6A 2Y66A 2NU6A 1NFQA 4B3IA 2DTDA 2JL1A 4GLOA 2J6IA 4MIEA 2ZTMA 3KYCA 1GCUA 3JQBC 3WBFA 1O6ZA 4RORA 3IC5A 2VHZA 4FPXA 4ID9A 1GEGA 2HQ1A 3KUXA 2HMUA 5I8WA 2VHVA 3DZJA 1AXEA 1E5LA 1H9BA 2NQTA 3MZ0A 3ASVA 2EERA 1VJ1A 3I83A 3WQRA 4HV4A 4RGBA 3LC1O 3WBBA 3R1IA 4BNTA 1RKXA 1U28A 2RBEA 3BXXA 4IZIA 4MVJI 3FN4A 1P1IA 2J8ZA 1MFPA 4NJMB 4CMJA 1NX6A 3PRJA 4YAJA 4CL8A 2BFAA 2NNLD 5HRUA 1JN0A 1ISIA 3Q6IA 4FOOA 4RVGA 5HWSA 1HTBA 1P1FA 2Q50A 1IE3A 1H9AA 1PZFA 4TVBA 2O23A 1FDSA 3PJEA 4GWKA 2VQ3A 1GQQA 5BNIA 1IHXA 4WLUA 4ALIA 1GPDG 3OJLA 1V0JA 3VC7A 5BR7A 4E33A 2YV1A 5EERA 3C3XA 1LNQA 1E6WA 1HF3A 3E9MA 4YACA 5I7EA 2FR8A 3NRCA 3AFMA 2OOSA 1EQUA 4LISA 3GVXA 1F8GA 2NLOA 2X7HA 3F3SA 3TWOA 2NU9A 4KUEA 2UDPA 1QV6A 4M86A 4WGGA 1A7KA 3LLVA 4O0LA 5G0SA 4WCFB 1EBUA 1UP6A 3LU1A 4U0JA 4WASA 4EEXA 3L77A 3ETEA 2JD0A 3D7LA 2VT3A 2Z1NA 1U4SA 3LQFA 3IQDB 3GHHA 1Y81A 2B4QA 1WDLA 3LT4A 5L7WA 2E82A 3DMTA 3QA9A 1NPDA 2EW8A 3GR6A 4IIUA 4DC0A 5JCXA 1CETA 4D79A 3E1KA 3VVCA 4II3A 2GPTA 4PG4A 2EIHA 4Y98A 1T4DA 1VC2A 2V65A 3GUCA 3QWIA 4JJGA 5COBA 3D5TA 1GAEO 3UCXA 4JXKA 3L6OO 2Y67A 2I66A 2Q1WA 3GY0A 4GMFA 3BTUA 1K3TA 4LCJA 1GUYA 2WJPA 4OL9A 4A27A 1B3BA 2ZYDA 2C59A 3FR8A 1HDYA 1LLCA 3G3EA 4MVJG 2O2SA 3U62A 1LSUA 5JNLA 4A5OA 5IG2A 4R1UA 4IDAA 2OBNA 4TZTA 1D7OA 1KETA 1R0LA 4WKGA 1N1EA 4ZQBA 3QVWA 1B8UA 1BGVA 4YT2A 4PLVA 3DOJA 1PJ2A 4JBGA 2VYVA 4WK6A 1O0SA 2H63A 3GNSA 2XF8A 1GQYA 1PIWA 1X7HA 3DXFA 5A06A 3FNGA 4XGIA 4Q3BA 3OA0A 3HG7A 1QXSA 3RAJA 3MTGA 5L7TA 4R5HA 1K2WA 3E9NA 3WFJA 3JYQA 3TFQA 4GX2A 4J4BA 4YRDA 2GYYA 2PFGA 2VNSA 3HQ4O 1U3TA 4D44A 2DQ4A 2FY8A 2GRAA 1R16A 3BMNA 3I4FA 5A1TA 2WYVA 1ZNQO 2DPGA 1PZHA 1X15A 2CUKA 2WD8A 1F8FA 1YRLA 3IUSA 3KXDA 4Y6PA 1ML3A 1GEEA 3MTJA 2BFOA 1JDJA 4UAGA 1GCOA 4A73A 4XR9A 3AWDA 1YBMA 4CQLB 2OL4A 3M1AA 4IQ0A 1EK6A 1WDKA 3K31A 3BMQA 3DBLA 3AOGA 1Z6ZA 2X6TA 4GX0A 3CMMA 4HNGA 2BH9A 1I2BA 2G5CA 3ZNNA 2YYYA 3U49A 3E48A 4BB5A 1XQ6A 1JKJA 3Q2KA 4W7IA 4X54A 4ZJUA 2Q4EA 4PLZA 5IXYA 4OOFA 1ZXLA 4YEDA 2FPIA 1H0KA 1AE1A 3DBRB 4LGVA 3HZZA 2EJWA 1D1TA 1HYGA 1KVSA 4U5QA 3GAZA 2C2YA 4N5MA 1T2DA 3W8EA 2P4HX 3ONEA 4BO7A 3SVTA 1PS9A 4CLOB 4UEJA 2C07A 3ZWVA 3DAPA 3VPFA 5DOVA 1N5DA 1HDGO 4ALMA 5TLSA 4NZ9A 3BMOA 4M54A 3DBHB 2UYYA 3AM4A 3K5PA 1CERA 1BG6A 3RC2A 3V1YA 8LDHA 1XR3A 2X23A 4RF5A 2E49A 1QLHA 4J3FA 3VH4A 4E0BA 2EHDA 3U09A 2VYND 4RV9A 2BGLA 4RLSA 2VWGA 4HWKA 2RCYA 2EKPA 2W2LA 1Z74A 5G0VA 5JO9A 1N7GA 4AJLA 3HDHA 1LRJA 3PDUA 4UVDA 4YJHA 4TRJA 3B70A 2DBRA 4S3MA 5KKCA 1DRWA 2RH8A 3V5NA 3NT5A 3JQFC 1P9LA 1P3DA 4BO6A 3ZU3A 2BF7A 4L4SA 2I3GA 3WGQA 1HXHA 1WAMA 1E1KA 1J0XO 5LC1A 2Z1MA 3MJEA 3E82A 4NR0A 3W6ZA 3CEAA 2YFHA 3F5SA 1XYGA 3QSGA 1A4UA 1H6CA 4NNJA 4OXKA 3Q9UA 4ZHSA 2PTGA 5A9TA 1UAGA 3IUPA 2BMAA 4HBGA 3TOZA 4EZBA 4LSMA 4BKQA 4CLRA 5KJCA 1U3UA 1TA4A 2WMDA 3Q11A 3F46A 1B8VA 2YFQA 1GPJA 3TN7A 4OOEA 3F1KA 4BO0A 2V6MA 2Y68A 4BGIA 4A26A 4BO1A 4QT0A 4OKIA 1YL5A 1SBYA 3KRTA 3VKVA 3EK2A 3KZVA 4MP3A 1LDEA 4BNJA 4DLBA 3VZQA 2ZB4A 4UEOA 4BB6A 2XAAA 1TLTA 1DOHA 2DPHA 1PL8A 2DTXA 4Q3EA 1A27A 1AGNA 1JLLA 1P45A 3D3WB 3H4VA 1F0YA 1Z73A 2FOIA 3LZ6A 1MX3A 5IDXA 1NFRA 3DFUA 4ND4A 1PQPA 4BVAA 1FDUA 2VOEA 1E7WA 4MVJP 3EGOA 3R3SA 3WFIA 2VUSA 1ADCA 5EINA 2ZTUA 1N92A 3VZSA 3ZWCA 4NJOA 4K6CA 5U4QA 4F3YA 5L9AA 1NQ5A 2EKLA 3K6JA 3W8DA 3DBVO 1TB4A 2NTVA 4KDFA 4B7CA 3F9IA 4CMGA 3PZRA 1T1SA 1EE2A 3RBXA 1U1IA 1LDYA 2C0CA 3SLKA 2P9CA 3W4KA 2ZYAA 2RIRA 5K9ZA 5JDCA 2AQ8A 3F1LA 4AJ1A 1YJ8A 1DRUA 2PH3A 3ZV4A 2PNFA 4FFLA 4CQMB 4LCEA 4ND3A 3HADA 5BNTA 2YHIB 5DN9A 5EQFA 2NU8A 4R3NA 2NVUB 4YT4A 3QWHA 3PPIA 4ALKA 2ILTA 3ZW9A 1BW9B 1EVYA 4E5MA 5JY1A 1D1SA 1Y9EA 4E2ZA 3GEDA 3FI9A 4BO4A 3VPSA 4CMBA 1PEDA 1U8XX 1HDZA 4AFNA 2BHLA 2B5VA 3F4BA 3NT2A 4RO0A 2WM3A 4P4NA 4PVDA 3WWYA 3CMCO 1NASA 2HK7A 5EMHA 4L9RA 5TSDA 3PWZA 4DIFA 3UXYA 1W0CA 2B83A 3EC7A 3G17A 3PEFA 1FDWA 1Y8RB 5CG1A 3JQ9A 3UFXA 4DXHA 2R2GA 1H2HA 4M1QA 3KSDO 2D4AA 3G49A 2FN7A 4YAGA 2J5RA 4RF3A 5HS4A 3WGOA 4BNLA 3OJFA 1Y8QA 4LRSB 4QX6A 5IF3A 1PJBA 3JQ8A 3SC4A 2JAHA 2UV8A 1YB5A 3H2SA 4AJHA 1YONA 3FBGA 5COAA 2UAGA 2DC1A 1GV1A 2WDZA 4IMRA 1N2SA 2HK8A 4HUJA 4IY1A 4Q3NA 5DDIP 2PD6A 4IM7A 3UHAA 2B0JA 3WGGA 3SX2A 1DHTA 3VHRA 4CODB 3WIEA 3E8XA 3O8QA 1DB3A 1EVIA 4BOYA 1XELA 1UXKA 3WGYA 3ONFA 3B1FA 1T4BA 2BKAA 4L75A 4YJFB 2WE7A 3NTOA 1OI7A 3IP1A 5K0ZA 4Z9YA 1DFGA 4ZRMA 1EUCA 1KOLA 4LN1A 1GTMA 4TRNA 5IDQA 1SPXA 3S2FA 1NR7A 3GVHA 3WLEA 1HE2A 1H94A 1BTOA 3ON5A 1SC6A 4E2YA 2PZKA 4FBGA 4Y8VA 1M6HA 4F46A 4YJGA 4NH4A 1I2ZA 3WTCA 4OGWA 4R9RA 2X0JA 1GL3A 3L4BA 1E3SA 3H7AA 5JCJD 2HMTA 5DBGA 1E3WB 1UZLA 4EW6A 3ETGA 4RVUA 5IN5A 3AM3A 4KUHA 1I24A 4NBVA 1ENPA 4IINA 4K1LA 4U6SA 4WLOA 5IDWA 2QX7A 1NFFA 4PN3A 2FSVA 5G4KB 2G0TA 1DIHA 4FDAA 4IUYA 1LRLA 1NPTO 1JKIA 2GF2A 2PH5A 1F12A 1GADO 2ZTVA 2PGJA 4D42A 1P0FA 2E48A 1YH3A 2I67A 4KUGA 4MINA 3U3XA 1BXGB 4MIYA 2D3TA 1MC4A 2FWMX 5H81A 1Y6JA 3C7CB 4FFPA 4GBJA 2BI8A 5F1PA 2IYOA 1JVSA 3PJFA 4BNUA 2CY0A 1HWYA 1B3RA 3DZKA 3Q0EA 4FN4A 5F1OA 4MVJA 3JQGA 1TT5B 5DBFA 2VHYA 1CRWG 3DONA 3MWEB 5J23A 3JQCA 3QVOA 4I5FA 2J3IA 4W9NC 1LDGA 3Q9NA 1JQBA 3QW2A 3GZ4A 1T26A 3WYCA 4YPOA 4Y67A 4MOWA 2EEZA 2X1HA 4ZA2A 3CKYA 3EMKA 2R00A 1R12A 3ZV6A 1W4ZA 1A9YA 4KP7A 2F1KA 4RQUA 1WVGA 4ESOA 3KB6A 5AXCA 1PSDA 1UZNA 4ND2A 4BKUA 3VH3A 3FR7A 4E30A 4YT8A 1GUFA 4N18A 1PZGA 4H16A 4K26A 5EJ2A 5AVOA 5AYVA 2G76A 2B37A 1ULSA 1B14A 6ADHA 1ZJZA 1UP4A 4FFOA 4GX5A 4IZHA 1BRMA 1LU9A 4UVIA 1PJ4A 2OP0A 4MVJM 3PJGA 3FNEA 1KEWA 4H7PA 4EITA 5A9SB 1JAXA 4URFA 3RSHA 4FD3A 3I9MA 1OOEA 1H6AA 3BTVA 3NKLA 4Q3CA 3GVPA 3BAZA 1WZEA 4J9UE 2DU8A 3ROKA 3SJ7A 2XOXA 1GQ2A 4E32A 5B1YA 2RAFA 2C29D 4O5OA 1XLTA 2GR9A 5KJEA 2O3QA 4IGEA 2LDBA 3W4JA 3PYXA 3SBOA 4JNKA 3K2EA 1HE3A 3GEMA 1HETA 2Q46A 3GMDA 4D3SA 4CPDA 4AJIA 2WSBA 2X5KO 4PFJA 4W99A 4QO7A 4I5GA 1H5QA 2OORA 2Q45A 2OFPA 4QFCA 3MCVA 4B8WA 1PGNA 5L4SA 3QV1A 4UVHA 3ANNA 5JLAA 5JY6A 4TZKA 3GFGA 3PQDA 2HK9A 3WYEA 4CMEA 2DUUA 2J5KA 1ZSVA 1HL3A 5L95A 1UXHA 1WZIA 2OGUA 4IDEA 4NBUA 4BKRA 2VZ0A 4MPDA 4DBVO 5IDYA 1NWHA 1B16A 3C1OA 2X5JO 3KSUA 1ISHA 3ZWWA 5L51A 1MB4A 3EYWA 4JP2A 1E3EA 4MVJH 2AW5A 3LT0A 4WE3A 2W8ZA 4XEHA 4O6VA 3WMWA 3W8FA 4ND5A 1DRVA 1ZUD1 5B4UA 3DB2A 2BLLA 4J1SA 4PLHA 1HEUA 4YB8A 4NJMA 2J3KA 1DFHA 3DFZA 2QIOA 3INRA 3HJAA 1C0IA 1QKIA 4UULA 2W4QA 4PZCA 2H5LA 3K73O 4IPTA 1MFZA 3OJEA 2JD2A 4IJKA 4K6FA 2WE8A 4I08A 3GC6A 4YRBA 5T8KA 3TF5A 4OJNA 5TGDA 2V7PA 3FRJA 5BQFA 4Y9DA 1A9ZA 1K6IA 1KIFA 2DT5A 1E1NA 4JIGA 1E5QA 1PGOA 1EUZA 1YE3A 3LDHA 2FP4A 1F06A 1ZW1A 3MJCA 4ZICA 1IY8A 3E18A 3H6KA 3UKOA 3V2UA 2FHSA 1QYVA 3T7CA 3H65A 3DEYX 2PKRA 3K30A 4IDBA 4ALNA 5A3JA 5JDIC 3HN2A 1MLDA 3MJVA 4WCFA 2W98A 1E3JA 4WLFA 2O50A 1DEHA 2VYVD 2F00A 1SOVA 3JQAB 3ZNOA 1E3LA 2ZB8A 1H6DA 1M2WA 1ADBA 1I10A 4JN6B 4DLLA 3PFWO 4Q3AA 1X1EA 3FWZA 4DPLA 5L3ZA 5U9CA 1U4OA 1WLYA 1PWXA 1R0SA 5BNFA 1FDTA 5EN4A 4UEKA 3DMTC 1Y5MA 4FW8A 1Z75A 5BSHA 1ZSYA 2NADA 3VDRA 3EAGA 3NJ8A 3IL2A 3PYLA 4TSKA 1CF2O 2Y0CA 4U7WA 3ST7A 4CMHA 2NACA 2Q2VA 4RPJA 3ENNA 3JQDA 1IYZA 3NAQA 3ZHXA 2NVBA 3ZI0A 1K6XA 3TDKA 3GVIA 5H83A 1BHSA 4AJNA 2YDYA 3M2TA 1AN9A 2G17A 2Y1CA 3ADPA 4HFJA 3COSA 1OFGA 2FZWA 5JFOA 5A05A 4CUKA 4A0SA 4I5DA 1YDEA 1HDOA 3GPDG 4KMSA 4DWVA 2ZQYA 3ICCA 2DM6A 2A9FA 2RHRA 1MG0A 2JHFA 3AU9A 1LTHR 5DBIA 5I7SA 1PR3A 5F1KA 2BGKA 2P9EA 2POQX 3UCEA 1M75A 1YKFA 2QZ9A 5KNLA 1R15A 4WCDA 4JBIA 1P31A 4YTEA 5A9RA 3DZGA 3UF0A 3RKUA 3B1KA 3WQSB 4YBZA 3B1JA 1PJTA 4RJTA 3PLNA 2Y1EA 4I9HA 1VL0A 3WJ7A 1EMDA 3DC2A 2GSDA 4XDZA 3ZWBA 1C0KA 4KTVE 2A92A 5K6AA 3ASUA 3NTQA 4XYBA 3VPXA 1YVEI 1QRRA 3ZWXA 5DNAA 1I01A 2ZTLA 1HSZA 4CM7A 5IAAA 2GN4A 5TT1A 2AQHA 2EP5A 5KJFA 2ZJ1A 7MDHA 2Q4BA 1DC4A 1DLIA 1WMBA 3KLMX 3RUEA 5FEUA 3IMFA 4NI5A 1LLDA 1M76A 4E5NA 4CQLA 2PZJA 1H2BA 1JW9B 4GQAA 3I4CA 1IZ0A 5ER6A 2XPCA 1RYEA 2Y1DA 4CLHA 4L4RA 2OP1A 3LLSA 1N1GA 1XWFA 4O1MA 3PFFA 3KEOA 2W2LD 3INGA 2X4GA 2C82A 2PZMA 5KJ6A 2Q1SA 2QYSA 3EUWA 4XB1A 5GZ6A 3DBRA 4IS3A 5G2OA 1EVZA 2EV9A 3PDJA 4IDGA 3CE6A 4IS2A 5EQDA 4Z9XA 4CLOA 4YAIA 3ANMA 4H15A 4PLCA 4CR6A 3JQBA 4I9NA 1Y9AA 3CTMA 4XB2A 3MJTA 4R3WA 2P68A 4HFRA 4PG8A 3NDJA 2VWPA 4AJJA 1DIGA 1KEPA 3D3EA 4P8RA 4PRLA 3T4XA 3DBHA 4CUJA 1QG6A 3ZU2A 5JO0A 4CM3A 3OMLA 4FQ8A 2E4AA 5JAIA 5COQA 1D8AA 2FRDA 5HM8A 1W73A 5DP2A 3ZCXA 4XYMA 1UDAA 4DL9A 4DC1A 3JTMA 4BIIA 2DUWA 4QEDA 1AXGA 2ET6A 1IB6A 3AW9A 4TRMA 4CM4A 4ITUA 3DAFA 4M55A 4OXNA 5HS6A 1LRKA 4G5HA 1R37A 4EEZA 5ILOA 5IZ4A 3S2IA 1JWAB 1YL7A 5THKA 4OAQA 3JD3A 4GLLA 2OMEA 3U9LA 3TJRA 2Z5LA 3AUUA 2AHRA 1JU9A 4J0FA 4OMUA 4BMSA 2CZCA 2D5CA 3A4VA 1Y1PA 4XQEA 4BL5A 1MG5A 4D0RA 3NGLA 1ZZEA 1RM0A 2HAEA 3H3FA 3HB4X 1NHGA 4LVUA 1E7MA 5A02A 1T24A 1O89A 1YXMA 4WOJA 5JPIA 1AUPA 2SCUA 4ND1A 3GZNB 5T57A 3WTBA 1L7DA 5C7LO 5L45A 4RVHA 3LT2A 3CH6A 4BNZA 4C7KA 4DIOA 2BI7A 2B69A 2WTBA 2WYUA 4BKPA 4CM1A 1JA9A 1HLPA 1Q0HA 2AG5A 4OIMA 1H93A 1S6YA 3DTYA 3ROPA 2ZATA 1YL6A 2CVOA
chains in the Genus database with same CATH superfamily
3JV7A 4MJ3A 5HTKA 1GPWB 4HP8A 3TIVA 1TW3A 4ZZ3A 1UJ6A 3EMVA 2D0PB 3HKDB 4S2UA 5A5EA 5BMVA 2AFHE 4LYAA 1UBJS 2ZUDA 4TXHA 5GVRA 3JYPA 5J2UB 3MOGA 2YWCA 2QD2A 1SK9A 4N3CA 4Q9DA 3U26A 3ZUGA 1ZMOA 4FZVA 1TEXA 4TMZA 4LJ8A 2RKWA 4EO9A 3U5ZB 1BHQ1 3ZZMA 2PZEA 4DZTA 1CNFA 1T9AA 4GKBA 4BVEA 5AVSA 2O59A 2WWYA 5JQGF 1YZGA 3U0BA 5T3YA 1WA5A 2IUSA 2PDAA 3LHDA 4NOLA 2ZUTA 1GTSA 4LSWA 2AKAB 3C5HA 3AIMA 1H69A 1VLZA 3ZY6A 4DWOA 2B4YA 1ZD2P 4ND7A 5AR1A 3T4EA 2IP4A 3DP7A 4H60A 2FZCA 1QIHA 1SUEA 4LYHA 3RSZA 4EKIA 1NSYA 1UXIA 4BN4A 1N8NA 3JASA 3HXMA 1RYNA 3DZHA 3KHUA 2ZANA 3QWFA 1U3FA 3OUUA 4B4UA 1S5PA 4POAA 1VE7A 1AD2A 4JLAA 3IIMA 5JC8A 4KO8A 4M6WB 2HUNA 3OZEA 1KGDA 1EVJA 2HA4A 2DULA 3L7IA 3UPUA 2RHDA 1AKEA 1NGSA 2V74B 4G5XA 1VBNA 4JEMA 4U2DA 4ZCPA 1BE1A 1SIWA 2D2VA 1FCJA 1NSTA 3FMPB 4OSOA 4JWTA 4IIVA 4WFJA 2VBFA 2XQFA 3UBMA 1N6NA 3ZE7A 4BFCA 5ICCA 1T29A 1Y1TA 5CNMA 5IPFA 2ZPUA 1WABA 2OCPA 1J2TA 4K28A 2FZEA 1IM8A 2VNAA 2LV8A 2YZ7A 2V7BA 4R9VA 1NVTA 4MKXA 4MW0A 4JI2B 1W4LA 1KKUA 2J0VA 3O4GA 1G1AA 3OX2A 3HA7A 4EPRA 3M7IA 3R3JA 4DB4A 3VOTA 1H2YA 4DABA 1E4OA 4KWCA 1XG5A 3ADBA 1LCIA 2FWJA 4NBTA 4QOIA 1P6XA 1XDSA 2JK0A 4KC0A 1SUSA 2D1TA 1CQXA 1E6EA 4PS0A 4XKJA 5KKAA 1A9SA 1WOYA 5TJ9A 5CVJA 4B76A 2J6BA 5F5LA 2V0NA 4HN9A 5J9FA 3DW3X 4YP9A 3GLUA 3LY8A 5I9NA 1N78A 4OXIA 2BMFA 4PSVA 4AKEA 1YI0A 5HQ3A 1N0WA 3A25A 1TOAA 4R9SA 3LD9A 1Z56C 5HKOA 1JT2A 2P4SA 2R79A 4H6VA 4N82A 3RCBA 3L0DA 2C2MA 2BUBA 2VJAA 4H59A 3IEXA 1SVMA 5ICMA 4PR3A 1SG0A 3EGDA 4OAOA 2DVMA 1YDGA 4LUCA 2SKEA 4XH9B 3L7LA 5DJ5A 3T7AA 5BSKA 3Q7RA 4D45A 1UAYA 4RIEA 3HGMA 4EG3A 3SXUA 1KJJA 3WISA 3T3OA 2UXDB 3DMNA 1GGMA 1O8BA 2BBWA 3DXZA 3DZBA 3HZHA 4MS4A 3SZGA 4XD7A 2I3ZA 4PYNA 2HF8A 4IHAA 2JAXA 2VKTA 3L9WA 3MAJA 5T67A 1E2KA 2Z8YA 5THQA 1C9JA 1CQJB 1RKBA 2ADMA 1NQWA 2HJRA 3PQ2A 4I8XA 3D5QA 4L6AA 3RS8A 1XNQB 3MWFA 4HS4A 3ZCQA 2JLQA 3H1TA 4URUR 4FX5A 2NUAA 1CB7A 4HLUC 3A32A 3OEHA 5DE3A 4C7MA 2ZG6A 4D4GA 4MDFA 3Q15C 2C1ZA 4ZYYA 4RK0A 4B79A 3Q72A 2ZS7A 1EUDB 2UUOA 3AHFA 3VNRA 4YJFA 1DBPA 2NG1A 1I4EB 4QXAA 4AMUA 2BBSA 3EQ6A 1OX4A 5HTOA 5JS2A 2C5AA 3UGQA 4D8VA 2DHQA 2TMYA 4H0NA 4QULA 4CQJA 3PJDA 3QY9A 1TI7A 1NN3A 4MVJD 1P80A 5FQNA 4DZRA 4DV7B 3T1HB 1C4OA 3KXIA 4DKJA 4ZV4A 2OZPA 4PW0A 4AP6A 4C1NA 5L8VA 3PUWA 4ZYXA 3QELA 2CNWA 2ORED 1Q77A 4XX1A 3ZX5A 4E4YA 3G1WA 1UJNA 2D54A 3OJXA 4JXJA 3UNXA 1HEIA 5KREA 2R66A 3UPTA 2FJUA 3A2LA 4HGPA 3KVYA 4PO9A 3T1YB 4JYZA 3EZNA 4BNMA 2GN0A 5LL6P 5E1MA 3L7OA 3WJAA 1X80A 1UXOA 2ZE7A 3U81A 1P29A 2Z8XA 1CYDA 3CEPB 4HB4A 3H2JA 1YJCA 5IXSA 5C53B 1X1QA 1SJ9A 2OY0A 2WU3A 1CDOA 4RS4A 1G20B 4HSEA 3L8GA 3WAJA 1N6RA 4C0HA 3U4QB 1DXHA 1SQSA 4I3FA 4YALA 1BMQA 4DMRA 3HKCA 5DHUA 1AKTA 1G20E 3H9QA 2QN8A 3MWDB 4Y1EA 2A78A 5CT5A 5DW0A 1A76A 2YH2A 4YAKA 2Y99A 4AG3A 4YXFA 4XW2A 2FSVC 4LOIA 1BXGA 2BV3A 1I3OA 2OCDA 2ZK7A 4C5BA 5ALYA 3S55A 3QEMA 3UJDA 4Z0PA 4PRKA 3SSMA 4JV5B 3FDZA 5IF9A 5CDGA 3A9TA 4HNHA 5JEDA 1XWIA 4EG6A 2BGRA 3FKQA 5ELLA 1G55A 4CL2A 1KBZA 5CNJA 2GILA 1QR6A 3GT4A 2NSLA 1O57A 3O3MB 3NX4A 5IX8A 1O4WA 4FGLA 3UEOA 2EW2A 2C96A 2P1DA 1C3JA 3NUGA 2YIJA 1SU7A 2IEDA 4AJ2A 4BS9A 2B2NA 3L1IA 1XHLA 1NYRA 3AQ4A 4F1WA 1LEHA 2E6KA 4N54A 4YRKA 3EB9A 4MYSA 1KK1A 3QPBA 1WD5A 4DA0A 1DC8A 3RKRA 1L8QA 2H08A 2QVBA 1V4NA 2VWHA 3IVMA 1PEKE 3OIGA 2TMKA 5JVDA 3QLVA 4U8HA 3C4JA 1T36A 4JP8A 4ZCIA 1BYIA 1JEOA 4LE1A 5ERXA 3U31A 5I8PA 1PS8A 1HKUA 1CDEA 3OZXA 3RHZA 4MGEA 1HYQA 4MP8A 2VP4A 4MR7B 4H6XA 4WEQA 4EHIA 5B2EA 3EVTA 2QLNA 4ILEA 1V1MA 2D8AA 5TEWA 4YRJA 3SY8A 2ZTSA 3EPKA 2XMQA 2JAOA 5AVVA 1BN7A 1Y34E 3D4PA 3G8BA 4Q03A 5I7RA 2HO4A 2EFEB 3OUTA 3VZDA 1QFJA 3BEDA 3IKJA 1TF5A 3W5SA 2E37A 5A9SA 5H59A 1YS4A 4RTPA 1ZH0A 1NBAA 3LT1A 3R20A 3WO1A 4AY3A 2IDZA 2SECE 1HNXB 4PV7A 4TKMA 4QNMA 3HCWA 4KQHA 1IHOA 3PXUA 4RKYA 4C6SA 2HJGA 2X3UA 3RUIA 1DCMA 1KJQA 3KKNA 3STWA 2QY9A 3CXUA 5KCMA 3A3KA 4ZT3A 1TA9A 5LU9A 3U4AA 4V2IA 5C5EA 2CNOA 3C8ZA 3NGXA 1SCAA 2OSVA 3PNBA 1PNVA 1XLTC 5AVKA 6PFKA 2VP0A 3KPVA 1ZXBA 5I7WA 4GE3A 2ZVPX 2UUAB 4O8ZA 2D5LA 3WYAA 4YRMA 3ZXXA 2ASVA 3JR7A 2WAAA 4YWJA 4LQ4A 3WL5A 2XNDD 4Z51A 4AF7A 2GAJA 4KXMA 5ICEA 3ZIUA 1CQIB 5GINE 4M9UA 1SVKA 1ZDMA 1ODIA 1ENYA 2HU2A 3VGJA 4LHSA 3TLZA 4B3RB 2DPXA 2NO1A 3ZHRA 3QX3A 3CR7A 4LRTB 1OREA 2FA9A 1N2CA 5K20A 1HX7A 1I13A 4ZK2A 4WNCA 3OF5A 2OKCA 3KAQA 1KDZA 2JFQA 3C39A 5DGIA 3JAWA 3RSFA 4XRRA 1RZVA 1TUIA 1TM2A 4ZU1X 1TUBA 5H3HA 1WPRA 4LGYA 5LQAA 4WLVA 2P6PA 2OILA 2Z09A 3LY5A 4FCWA 4YCLA 2D1SA 2ERYA 5EMNA 4FYHA 4ZZ2A 3ANLA 2RMKA 2WV9A 3EFOA 2HA5A 4YAUA 2IPXA 4XJSA 1GNQA 1RQLA 4BVBA 2IZZA 3CNLA 3O74A 3H3JA 3K09A 3BRWA 2VEOA 3QOWA 3LW7A 3TMAA 4F8JA 1F5SA 1F60A 2PMBA 3RANA 1MHPA 2WJAA 3IR7A 2PCLA 3V00A 4NMXB 3MTDA 3EZLA 1YDWA 3WJ2A 4ZOBA 1K86A 1VE5A 3E70C 1MW8X 3WNVA 3G89A 4G26A 1E1QD 3FTEA 1T9DA 1WF3A 3A6HA 5LQSA 2Q49A 2E0IA 1G41A 1WXWA 4UU8A 4FGUA 3GMSA 5MGBA 4DNXA 1R88A 1I32A 4KN9S 4GVXA 9GPBA 1K98A 1OMOA 5E9AA 3DO8A 1BFKA 3P52A 1ISSA 1M5RA 3TQOA 4Z4IA 4IYJA 3VU3A 4WBNF 4UUMA 4Z4CA 4MGZR 3L93A 1K6JA 1YQXA 4FT2A 2FX2A 2PLFA 3VO9A 1JEAA 3TTVA 1O7JA 1EZZA 2VDKB 1L7NA 3O82A 3QMMA 4K03A 3SEFA 2I33A 3OJOA 4UZFA 3ROMA 5GZ1A 5HP4A 1D09A 2G40A 4FC6A 2C03A 2ENUA 4LA4A 5EUBA 5DCLA 4KLNA 3FTDA 4KQIA 1N6LA 4EA6A 1KJNA 4Y1RB 3QHQA 4QPNA 4E94A 4WEOA 1XU7A 1LJUA 1IQRA 5DCWA 1OC4A 5A3VA 3QSYA 1P4JA 2HWYA 1M0TA 1IOLA 1Y7PA 1E8MA 3HCRA 4P34A 4YO8A 5F5NA 3UGKA 5AXDA 4WOKA 2P91A 4YASA 2EYUA 3NJRA 1KC1A 3AERB 4YMWA 1OJLA 5DX1A 3Q3JB 4HSGA 2G04A 2FW7A 2OHGA 2O20A 3FNRA 3RC9A 2XJ4A 1U5AA 3H8WA 2AZTA 3VR2A 2HADA 2RHBA 3S2ZA 1PLLA 3UAOA 4AI6A 2DX7A 1BCRB 1GGEA 1M0SA 2CWWA 2F9FA 5TT0A 2YQZA 3NUQA 4IZOA 1NR1A 5B1HA 4GKJB 3GROA 3E5HA 2ZSAA 3LNTA 3KV1A 1Q2XA 2JGDB 1VOTA 4CKYA 1JG6A 2JHAA 4CIYA 1QZXA 2R8PA 5BXYA 5J4YA 2QVLA 3N59A 4IGIA 4FGSA 2RI6A 4KHPB 1A72A 1ONPA 3R9WA 1A5SB 3D7MA 4F0JA 3EGXA 1B42A 3IE2A 3CNOA 1IQ0A 1V1RA 2OZEA 3UWDA 4A92A 4B6PA 3ZD7A 2O8BA 1IL0A 2XSZD 1WBJB 4G5RA 3G0HA 4GZLA 4WA7A 3ZWYA 4BWFB 3THOA 4BU0A 3Q3VA 1GNTA 3GF4A 3VYRB 1GNRA 4K8OA 4NTZA 4RA9A 4YJ3B 4B48A 3ONDA 4RKFA 2Z8ZA 5F21A 4GL4A 4X3CA 4ZANA 3CEHA 1OJ7A 1UMBA 3S44A 3WWPA 2DHDA 5CVCA 4BC1A 3Q4GA 5LZ9A 2AZMA 1WF6A 2RHGB 1T1GA 2PX8A 3OFVA 4GD3Q 2WOOA 4TX1A 2M6RA 2OBFA 1FMLA 2DBVO 4EY3A 1E2HA 3QGMA 1UBEA 4A10A 4HPXB 2YY6A 3LQ4A 4EHBA 2YTZA 2QW8A 3U4DA 1DIRA 2R8OA 1T8PA 2VUTA 1G8GA 1X3LA 3H4IA 3WYNA 4D0NA 5IKXA 1M0EA 4JJFA 2FP3A 3B2EA 3PDCA 2JBHA 4E51A 1M33A 1R7RA 3NBYC 1JLMA 4AX8A 3ASYA 2DWQA 5IH7A 2VQEB 4AM8A 2B8NA 5FNZA 1UMDA 2B92A 3G8AA 4I19A 5IHPA 1JR3A 2I54A 4R1LA 4OJTA 4J0QA 4KTTE 4BNDB 4KE7A 3T9EA 3FOWA 3IOEA 1QPBA 4OM7A 2LCFA 3OY7A 1RT9A 1X1CA 3B85A 3EIWA 3I9JA 5EHQA 5LBUA 1FXWA 3KP1A 3ZZ1A 2VIIA 5AM2A 1X38A 4J6EA 4MARA 4J1TA 5E0KB 3WY9A 3GRPA 3H1FA 1TU4A 3IOYA 1A9TA 2VSFA 4MV3A 3RGGA 2JLCA 5DFAA 3WVNA 4RL6A 4BTVA 1VJCA 3DTNA 5F51A 1VMAA 3L1JA 3T9CA 3TLXA 2XCTB 2O1EA 2R6R1 3HSYA 3CNQS 1RI3A 1GZ3A 1I33A 3ZDXB 3CVOA 5IBQA 4AVYA 5EJ5A 3DV0A 2P9JA 2IP1A 4ZDJA 2OQIA 1QP7A 1KH2A 2RI1A 1C2TA 2P3OA 4DNOA 1E9VA 1N2JA 1EWQA 5BV0A 2HH9A 4K0KB 3KLNA 3ZCVA 3KUCA 1P2DA 2AJBA 4Z2YA 4M8IA 2JJMA 2W93A 3LKZA 4G1VA 2QIPA 3F96A 4BVJA 4DYVA 2IH4A 1NW5A 3EXEA 5ARBA 3AVVA 4LYEA 1JG4A 1QWOA 3QOYA 4DSUA 4FJ1A 1WPGA 1PCXA 5CP8A 1TU0A 3SXPA 3VDXA 2JGEA 2B4AA 2QTWB 2PRSA 4P7FA 3RJMA 1EEXB 4PZAA 3VJMA 5JROA 6ABPA 5KNBA 3NTXA 4Q01A 2IS1A 8MHTA 1QX3A 2OYSA 1E7SA 2GAIA 3A6EA 3AHEA 3OIFA 3K0BA 1JHOA 2ZU6A 3FD8A 4EI2A 1J6UA 3V2IA 1SUIA 2VZ8A 3R76A 1N7HA 1WJGA 3QUTA 1AXRA 2OV6A 4A6PA 3QKTA 1YZKA 4GYWA 2RH5A 2YXPX 3KWFA 4F7DA 1FP4B 1Q0SA 4MVYA 3X1YA 5FA8A 2P5YA 1RYMA 3SX4A 3AUSA 5IDVA 3RT7A 1CR1A 3S1AA 1AC5A 3PXBA 3HXTA 1K7EB 4TZ0A 3C74A 4MWZA 1FTYA 1J8DA 2YC2C 3FMFA 2CNNA 2QE7A 3OOSA 2P2ZA 1ZKDA 2XNJA 3IQIX 4LX8A 2C31A 4HS9A 1XTSA 3TPCA 2IP2A 4O3MA 4IXWA 4JITA 2IUEA 2YOHA 3LCVB 4N12A 3VAAA 3VPDA 2JA2A 1P60A 4WFQA 1LQUA 3K9QO 5LFAA 4J29A 3UG6A 1US8B 2HSDA 1APBA 5CIWA 5AHWA 4LTDA 4DRXB 2VPQA 5C4IA 2IYXA 3PR3A 4X1YB 3Q2IA 4C89A 3URKA 1XA3A 4R1QA 1B2LA 1YRBA 3RVNA 3WLNA 1H4VB 1YSCA 1UFVA 2ACKA 3CZRA 4NE7A 1TMKA 1HPLA 1T8UA 2PSFA 3WNQA 4CKCB 4RK4A 3CZMA 3R8CA 1X13A 4PYQA 1P2GA 5JDIA 2NWQA 1U9ZA 2ZWAA 4Q4CA 4WUVA 1BN6A 3R6DA 4UMVA 5AJZA 2H4ZA 2HFJA 3A6ZA 4UE2A 3K6RA 3M4NA 3NETA 1KF0A 3MYRA 1SEPA 2XIJA 1L1FA 1WVMA 3I45A 5AI9A 1OU4A 1MOQA 1VL2A 1OBCA 4C30A 3W2IA 1LK5A 1NLUA 5EJMA 4C07A 4RBNA 4P53A 4XQ9A 4RVDA 3W3AD 1EM8A 4MAMA 4QAQA 3D2AA 3SQMA 1P74A 1WG8A 3FM9A 4KMMA 3DTVB 1MVNA 4M89A 4CQMD 1KP2A 2ZREA 2NUBA 4HRAA 2FK7A 3AR4A 4PGFA 5ARDA 4Y6RA 3RUHA 3N2KA 3MBKA 2NIPA 3QFRA 3ZHZA 4L3OA 3WI7A 1GOTA 2E89A 1K8QA 3TPFA 3LE8A 4R1TA 2NU6B 5JCOC 3C3AA 4PFSA 1HDEA 1HDXA 2ZE6A 3RK0A 3PLAE 2VT6A 3NHBA 1N6HA 1R6AA 4BJ3A 2J9FA 2C57A 1NV8A 1QNLA 3I39X 3UH1A 3ZNQA 3VPBA 4J49A 3TZEA 2DP4E 3V8NA 4N3GA 1G2OA 1XAGA 2Z04A 4NDZA 1WP9A 3CUWA 2OR3A 2AG8A 1JLHA 1MB9A 1RMQA 2FR0A 3G68A 3GGCA 3N76A 4NOMA 2ODAA 4J7UA 2PCJA 4LVNA 4US2R 2VJMA 2ZUFA 1ZD3A 5C2JB 2J0QA 1DIAA 4LWZA 4DLPA 1OPXA 1IULA 4PLTA 3VYTB 2N42A 1EWKA 4E5KA 4LC1A 2MDTA 2AI2A 3DE1X 1I1NA 2PX0A 4ZKDA 3GK3A 4NH0A 2BGJA 1X92A 2O8DB 1C8VB 4YQFA 4DQVA 2R62A 4X3PA 3EDMA 3LCCA 3CLUC 3IQGX 5MF6A 3IEVA 1O95D 1XF1A 2DECA 4Q1BA 4XDGA 3VPCA 1QP4A 2XNSA 4IV0A 4A2CA 1MXHA 3SF0A 4RSRA 2AT1A 1FTGA 3H2ZA 2BFPA 3M34A 3WX0A 2JKVA 4RVNA 1FB5A 2I4OA 1B73A 4LNHA 2H7XA 4ZAFA 4U7HA 2K2WA 1ID1A 3ESDA 2XWJI 2PMCA 5CGZA 4BO9A 5LU8A 5ALGA 1XNRB 2PFSA 2ZDHA 3LQQA 1W4BA 2PNJA 4Z8YA 1AV6A 2CHFA 4DGSA 3WOVA 5MHTA 1YAJA 4N8SA 3NCHA 3VO8A 2QMUA 3RVKA 1ADGA 1NVVR 2C7GA 3PR1A 3QPCA 1RMYA 4KQEA 4S24A 3U7QA 1H5NA 1ZMTA 4HDNB 1GVHA 3BMCA 721PA 1ZMXA 3RNLA 3EWAA 2QMYA 1E98A 4QBGB 4PZEA 2I2BA 2EFDB 2ZI7A 1K4MA 4QQRA 2OT3B 3HWX1 1DAOA 2GLTA 3BN3A 3UK7A 5HQTA 2RI0A 2I7CA 2CZGA 4DMCA 1RHMA 2XE8A 3LOQA 3W06A 2O3RA 2EOAA 2ZEJA 3VKWA 3FVQA 4QG7A 5LCXA 3EIFA 3T3PB 4PC6A 1YHNA 2FOLA 1X39A 4L5YA 3B89A 3RARA 1XA4A 1I7NA 3BDIA 3HACA 4PSUA 3EZXA 1K9SA 2DXIA 3ER8A 1ILEA 5I5EA 3FDJA 4YS6A 1LFDB 3PGXA 4G5GA 1YGPA 2A67A 2R96A 1GYRA 4HJXA 5AOVA 2OXRA 4BC0A 4JSTA 5EE5B 3D1LA 3ZU4A 1OZGA 3G1TA 2PV0A 3ZWNA 1FVFA 1NG1A 1VPTA 4EEKA 1VIDA 1KJYA 4KQ1A 2XGSA 4JI0B 1HK7A 4NNOA 1CFZA 3BQ9A 3IQFA 1FRVA 2V58A 1Z06A 2AN1A 2Y0PA 1XOIA 2C5SA 4DIMA 1LA2A 4HH3C 3UXHA 1Q5PA 2VXBA 1MD9A 3F6CA 3HCOA 2IXFA 3NC1C 4K8RB 3SM3A 2VK2A 5JE8A 2AOWA 2I03A 1MGPA 2YYSA 4OX9Y 1E32A 3U7FB 3RD5A 1QHHB 3D59A 3K8QA 3GLTA 3OOEA 1DBIA 2R2AA 2ACEA 3GJSA 1U0SY 3NYWA 4K9LA 4D5GA 4ENQA 5AW0A 2FPPA 2CJWB 5LZ4A 1RACA 1JJAA 3A9RA 3VI3B 2IHNA 3KQQA 2GNOA 2IK8A 1XDDA 5J1SB 1AQJA 3D54D 3G23A 5DZSA 3E7XA 5IUJC 2IODA 3NEJA 2NYAA 3R7WB 2HEIA 3PQ3A 3GDFA 1CJUC 5F12A 3RU7A 3C4QA 4YMVA 3AR3A 3N2EA 1OW3B 2HA7A 3N8DA 4ZI2A 4EB3A 4BEVA 5JZVA 1N2GA 4JI3B 1YUMA 1RBMA 3NGMA 4BJHB 1G63A 4N7MA 4D9KA 2WYWA 3E7PA 1TRHA 3MMPA 3SHFA 4LYGA 4LZWA 5A5FA 3HYSA 3TLGB 5DX8A 4ZOLA 2IFTA 1DSSG 1IIRA 2GK6A 2Z5GA 3LC2O 1KI6A 4KFSA 3RUDA 4UM9B 4XYLA 1I3LA 3KAKA 2WM2A 3WRVA 1QYCA 4MVXA 1ABBA 1XCGB 3HVIA 4KSYA 4LRUA 2QTMA 4P54A 4YJ2A 3BIJA 4EVQA 2F48A 1ZIPA 4D96A 1IY9A 4MDHA 3OTOB 3NTUA 3SQOA 1P0IA 4ZYTA 1GKUB 1EZ4A 3HNRA 4ZMSA 2JJ1A 3ABSB 2J4DA 3L0OA 3MWLA 4R16A 4Y1FA 1ZH6A 1XRMA 4YJKA 2RJOA 4Q7EA 1Q83A 5KBYA 1NKTA 2O2EA 5KVQA 3U6KA 2ZM5A 5ENVA 3KHSA 4KOAA 1B6SA 3DFMA 3FETA 4V0NA 2X58A 4H3VA 1LQTA 2BDUA 4OFZA 4YAWA 1KERA 1BSVA 4NHEA 4MP6A 4Q9NA 3Q8MA 3KSMA 1DKMA 5BQ3A 1SQFA 1ZH4A 1ISRA 3ACCA 4LBZA 3DYVA 1DX9A 3JQ9C 5KYXB 1YZTA 3HLKA 4F72A 4IGFA 5EKUA 2XJ9A 1QWSA 5JFGA 3OF3A 1CJTC 1KYQA 2FKNA 3I6IA 3P20A 2IZ7A 4P2GA 3EEIA 5KVVA 4NAUA 2OWEA 3AVPA 4EX7A 3PTAA 1CYEA 4EY4A 1NUQA 3KB8A 3MCTA 1E94E 2E7ZA 3ZKWB 1E18A 2O7QA 5EJ8A 1ZICA 1ZONA 1TXGA 1LJ8A 1FRFS 3VQTA 5CDUA 4NCXA 1JXMA 3EG5A 3QKUA 2DJ5A 2N9UA 2NSHA 3E3AA 1FYVA 4WXMA 2X0KA 3MTAA 2XB4A 2E5FA 3HY6A 3OLYA 1KQNA 3O7WA 3S8YA 3PEYA 3SFVA 4IICA 1W2GA 1RPNA 4DAOA 4F1JA 3V1UA 4K81B 1CP3A 1QB7A 3QE3A 5BVHA 2H57A 3A3NA 1E62A 1THMA 1ZJ4A 1LPPA 2XLBA 5LVAA 2I6TA 3HP1A 4HZUA 4KRGA 3PRYA 5CA1B 2QVYX 4J16A 1ISMA 5G1PA 4A0RA 1F7VA 2PMEA 1PRYA 3TW8A 4ECAA 1C14A 3EQ7A 4R7ZA 3VVMA 5FCDA 5BN3B 3I5XA 1SXQA 1T2NA 2GZHA 3I9V6 3FTPA 4KQXA 2YQ5A 1GTRA 1RTTA 3B53X 1M67A 5K4AA 3K05A 2VWQA 1HBJA 4QM7A 1ZIDA 2ZPTX 3L5KA 5FOVA 2PEYA 3SHWA 1N1DA 2YW9A 5LIRA 2JI8A 1EU1A 3OTIA 3WGHA 4TMYA 3ZTTA 1KYWA 2IUTA 4LZPA 4NARA 4M1SA 2AX3A 4UUOA 1C3VA 5M2QA 1DXQA 2V6FA 2JBAA 1IJFA 1L7XA 2ZYIA 3UJ9A 4C4XA 1AUQA 3MNFA 2XXAB 1KA9H 1JF8A 3KTAB 4DB2A 3HB5X 3WSWA 1DUSA 3R6LA 2GVNA 2YOFA 3PXXA 4I6JA 2OXTA 2C8VA 3LXMA 2ZJ0A 4PC2A 2VTBA 3ROZA 1P2VA 1G8KA 2QXUA 1PR4A 1OAAA 2NTYC 3P27A 3ESZA 1TW2A 2GS9A 2MT9A 2XRYA 4OA5A 4DNFA 2Z9DA 1MO5A 3ZJUA 1TMGE 1UXJA 2GBGA 3Q7TA 3ZQKA 3BVPA 5DIFA 1OB5A 2WUDA 1BE0A 4DBZA 1DC5A 1UL1X 4I6EA 4UCFA 3Q3EA 4YVFA 4R4JA 4MI3A 3BILA 3SZRA 3NYIA 3OE5A 3K15A 1RCUA 5HFAA 3ZJ5A 4F9TA 5HZHA 3C3JA 3DPUA 3THWA 1X7GA 1OVMA 2ES4A 2P1ZA 2VYNA 4IFIA 1VJDA 3ES9A 1TO2E 1N4DA 1VP3A 3IJPA 4X1KA 2ERXA 3RVRA 1LVUA 1GSAA 1II8A 1JHPA 1P73A 2C9MA 3GMTA 5ICSA 4BQFA 2AOXA 4KPUB 4MRNA 2GPYA 3CRQA 2Z95A 3H1BA 1T5BA 1KY2A 4L5CA 2X40A 1WMSA 2W90A 3C7TA 3WC4A 4D82A 1OH7A 2R00C 4II2A 5TQ2A 3CXRA 3ZQ4A 2VZLA 4JR0A 1XCJA 1K7XB 4EF4A 4TMWA 3NCTA 2HZ7A 3THYB 4U3JA 5FOWA 1SFRA 2QD1A 5E0OA 1F38A 2GXQA 2EX4A 2RK4A 1FTWA 1ZBDA 3MSCA 4TQUS 1ZCBA 3TXAA 4CKWA 3BZUA 1C8LA 1GZ6A 3MELA 1B7GO 2ZI5A 1LXCA 1NNUA 3MSXA 5K4GA 2AN3A 1QAMA 2C4VA 1ORTA 3TL3A 3TZCA 2P6RA 2ZSHA 2CHEA 1T3TA 2C5EA 3TM4A 4E3ZA 1R0XA 1N5OX 2B61A 2ETVA 1JAHA 1QSGA 3CUSA 3D7RA 2HMVA 3RS2A 1Z2PX 1RDFA 2NTJA 2X8WA 2FX5A 3L82B 3PWSA 3WB0A 4IKEA 1DJMA 5HA5A 2IIBA 1OYOA 4XDYA 1H22A 5A6VA 1W34A 2GTHA 4M3NA 1L5MA 4MAFA 4KIJA 4NS4A 3TQFA 1XVAA 2BEUB 3U9SA 1Z7BA 4I50B 4C4TA 3NIFB 4OQFA 2BF4A 5FPTA 4CL0A 4F45A 5CFPA 4F6RB 5HIIA 1VJTA 2VATA 5CFMA 4ZVTA 5BPFA 1DDOA 4K7JA 4C06A 1GHTA 1U0FA 1RQXA 5BPHA 1CUBA 4TTQA 3SU8A 3AETA 3OIDA 2GN2A 3QMVA 3R09A 5D3MA 2A7XA 4B7UA 2WD7A 3NP7A 1G2IA 1XVIA 3A2MA 5IBRA 3UKDA 4C0LA 1T8TA 3G8DA 4EENA 1YA4A 1JQLB 1PL7A 4AJEA 5GP1A 4MV8A 4NRDA 4BNGA 3PCXA 3I6YA 1D4AA 4FJ2A 3GGGA 4H9GA 3K9CA 3CGGA 5I9MA 2Q4OA 4IJWA 5AXAA 2XXBA 5A2QA 3ITKA 2FMIA 3REQB 2NZYA 4JQCA 3Q40A 4F6LA 1KI9A 2Y0DA 3FPFA 2Z6VA 3X1KA 1MAAA 4QPPA 5E9QA 4H18A 1TCUA 5BY2A 2H0QA 2MYNA 2YVKA 4JJ4A 1Q20A 1ECGA 3D4OA 4JSRA 3D2CA 5C3MA 3HI4A 1LV7A 3PEWA 1RWWA 4Q34A 3A4TA 2JFGA 4HVLA 1D5WA 1ONBA 3AY3A 4PTYA 2VTVA 5PNTA 3GN1A 1LF5A 1W8IA 4Q19A 3GQVA 4FNMA 1ECBA 2GI4A 3WV4A 2QL6A 1YR9A 4A15A 3IEKA 4GBMA 1W76A 2IGBA 4HXFB 4RF2A 3W3ZB 1IEWA 3R0VA 3EAQA 2QN6A 4TXLA 3PD7A 3UFXB 5I6DA 4FFWA 1TF7A 5P21A 3U4QA 2ODNA 4KZKA 3UMBA 1QYWA 1U8FO 4XPIB 4KPYA 2LUOA 2VT2A 3RC1A 3NRJA 2OCBA 2IF2A 3W6PA 1LBSA 4JCCA 4HDRA 3UW1A 2RGWA 2A0XA 2CFCA 1N2OA 4R69A 1YBHA 2F1OA 2JLBA 4IUCS 3HWSA 1SIOA 4X5OA 1I7QB 5KYUA 4C0QC 1FFXB 1SO8A 2C97A 3KBBA 2ID4A 1JFTA 4JC5A 1CZKA 4BBAA 1HV8A 4MS3A 2X9QA 4W4TA 2WHYA 1JHRA 2PQ6A 5CLJA 5HIKA 3ND5A 4GW3A 3EVGA 1DADA 2VJCA 4LJ5A 4ES6A 2BFCA 4MR8A 1I2MA 2JCYA 2PXAA 3CVYA 4R51A 3PPYA 4X92A 5M29A 3JQ7A 5A4DA 1MA0A 4KNVA 5DM1A 4DJFC 2PUFA 2CCKA 4ZQGA 1Z34A 3PHIA 2JH3A 3EG9A 2CVQA 1D6JA 3OZWA 4OYRA 5G3ZA 5A7GA 1J1ZA 3G1UA 3V46A 4EW2A 3KKZA 4J0KA 3DL0A 4KQ2A 3LA8A 4E14A 4ZVVA 1B6RA 4NU5A 4QVIA 1SC3A 1TF2A 2Z6QA 3I8OA 5L40A 4OMCA 1J5XA 2O3TA 5FBLB 3CS3A 1IPFA 4BY9E 1I36A 5CEEA 2VUIB 5I4IA 2WT4A 2VOJA 2VJDA 1ZUIA 4A7PA 1ISFA 1PF7E 3T5GA 2VRCD 1CD5A 4F56A 1PK8A 1Y1SA 3COPA 4V0SA 1ODSA 2J5QA 4L9WA 5D87A 2NZXA 4NQZA 2QNBA 3CX7A 4NENB 3KU4A 5G1NA 4EUFA 3PWKA 4AP5A 2WIKA 5GGYA 3QVXA 2GF0A 1GR0A 2AR0A 1ESCA 3HRKA 2QLMA 1V8OA 2XE7A 4MKZA 3N3AC 4U2KA 5TQVA 4RMGA 1ZRNA 3EIQA 4JR2A 2I80A 4FHEA 1L4LA 3E7FA 4H1VA 3GNLA 1W30A 1YZHA 2RGXA 3TZKA 5K6RA 4MICA 5GIOE 2AEFA 2F17A 3PWTA 4G67A 3WL7A 2PA3A 1H8EA 2VXCA 2VYQA 4ZZIA 5SZJA 3OEWA 2QORA 1GNSA 1KVUA 2XNHA 1ENOA 1CEQA 5HUHA 1K7SN 5SZHB 2AQKA 2LRHA 1ZMRA 3NHKA 1OUMA 3HNPA 1IPEA 3S7TA 4BCDA 5CVTA 4GBGA 4N65A 3LX4A 4UD2A 2O8NA 1T6NA 3PEEA 4OQZA 5IVPA 3FPKA 1K6MA 4LHXA 5CPFA 2RGNA 3IESA 2KW5A 2EBFX 2PX2A 5H3CA 5B1SA 1WRBA 2MMGA 4GI1A 4JJ8A 5FYQA 2W6ID 1R1DA 2HQOA 3OOYA 3ZV5A 2QRMA 3VR5H 1TD9A 3S7ZA 1ZD4A 4E13A 4YR9A 5KTPA 1QCZA 2BFBA 1ZH8A 3KKEA 4Z3OA 2H1SA 3D4LA 1BZYA 5CLQA 2ZAOA 4FB4A 3ECAA 3V7FA 4EYEA 3I5MA 1D1PA 3M4ZA 4TROA 4RJ2A 2OFFA 1Z4JA 4DYDA 4R84A 2MR6A 4MXDA 1PTJA 4L8VA 1H8HA 1PR1A 2FG6C 1USVA 2UVPA 2XHEA 3L7DA 3Q7PA 2A2ZA 1F4PA 4KOEC 5LKAA 1AKUA 3R8XA 4RACA 1ZKMA 1TYAE 4DR4B 2XYHA 4J4TA 3ZJTA 5FUYA 2RGAA 4GOMD 4KRFA 2X77A 3H2IA 4G5QA 2PRJA 4L7QA 3WYBA 2QV7A 3M33A 5LWHA 4UJ5A 2QD3A 4RPLA 4TTRA 3PGJA 4FMCB 3W8RA 2FJ0A 3CRVA 1UPXA 1KMCA 4LSZA 1KOFA 5KZMB 1E1RD 3VJRA 4L4UA 1UPAA 1ZVKA 2XUJA 3FCOA 4BVKA 3Q0TA 1AK2A 1OHHA 4CKXA 2AMJA 5DHFA 3KZCA 4BFYA 5IRCD 3GNTA 3FNFA 3WGNA 3O1HB 1U99A 1YKSA 1M7HA 1HDIA 4KFCA 3PI7A 1J8VA 3KDSE 5FYDA 1KSFX 3C5WP 3OFNA 4ZCSA 4COKA 5KYWA 2PE5A 1G8SA 2AJDA 5G4LA 3QWAA 5E8RA 1TK2A 2QUJA 4M7WA 4P4TA 2D5BA 1GPMA 1Y37A 3HABA 3IH5A 4G81A 4EMSA 4Z6KA 1AA6A 2QRPA 3B13B 4GC5A 1UXGA 1GLNA 1R9NA 3NHFA 3STXA 5EY5B 2BHRA 1I7LA 1SUAA 3M6FA 1KGSA 3MPOA 2FR1A 4MV7A 2W6JD 4OBBA 5T6MA 1LSSA 4BX8A 3E05A 3RSCA 3ILYA 4O25A 4DW8A 5FX2A 4OP3A 4UVGA 3AJEA 1YB1A 5E6RB 2JS7A 5EIEA 4FDUA 3EH2A 4NCIA 1A9XA 2HV9A 4ZVLA 4V1CI 4C3OB 1L4BA 3H5RA 4G1MB 3UM9A 2HCRA 2JEYA 4LEIA 4R2HA 2ZBRA 4YAEA 3AR2A 2VZ9A 4TL8A 1XRNA 2O0MA 3A7EA 3B3GA 4TUYF 2QQGA 3B2NA 1WEKA 5SY4A 1X0XA 3OBIA 5CX1A 5JS6A 1ENZA 1OROA 4FTWA 2NO0A 4LJ6A 4A2QA 2J6IA 3RVOA 4N6NA 4P3YA 4M8LA 3BOSA 3TSYA 3JQBC 4I4TA 4Q4JA 3WBFA 4IIXA 5CVVA 2E3JA 2HQRA 4U7FA 3NAGA 2VHZA 4AY4A 3DGFC 4FPXA 1GEGA 2CXHA 4US1R 5D2CA 1HNNA 821PA 1QCDA 4R31A 1EXDA 2I29A 4YP0A 3MZ0A 1H9BA 3IUEA 2CXXA 3RHFA 2QYOA 1GAJA 1XXHA 3ASVA 3HYRA 3KQPA 3ZE6A 2ZSDA 5JH7B 2FFBA 2B1IA 1M1YA 2FG5A 3L8YA 4KXFB 3WQRA 3A1WA 3IMCA 2V5UA 5B3JA 4BNTA 1FEZA 1RKXA 1VKJA 5BWBA 1E66A 2BJHA 2YMMA 4L3WA 4MVJI 2OCGA 1KR5A 5CT4A 2J8ZA 1EVQA 5E2BA 3AUKA 1GL9B 3AEYA 4FFSA 4ZDWA 4DEYA 1NX6A 3PRJA 4OQLA 4CL8A 2NNLD 1O97D 6REQA 4ZC8A 1KTIA 3LCRA 4JU9A 3SD7A 5E6UB 1RS0A 4RVGA 5BNZA 1Q1AA 5FHRA 1H9AA 1Q0RA 1OH5A 1UM9B 4NYMR 4UZEA 3U37A 4GWKA 1E8DA 4TLCA 5BNIA 4WBXC 4UKDA 1WPXA 4G5YA 1BE8A 4X44A 5FLKA 5T4EA 4BZXA 1V0JA 2WUEA 3QU7A 5B6PA 5BR7A 1VYUA 2XB8A 2YV1A 3E4DA 3L4EA 3MGAA 4XLTA 4KPEC 1PEAA 4OJMX 5A0FA 3ZY3A 1RBYA 1P7CA 1HF3A 3F0TA 3P4UA 2WG0A 3AFMA 1JDVA 2HHAA 4R40A 4RIIA 3KUUA 3TTYA 2MCFA 5HKLA 3FSJX 2NLOA 3DVLA 3F3SA 4KSCA 3T9BA 2BGWA 4M22A 2C58A 3F78A 1QH1B 2DWOA 4HWSA 4M86A 1HFEL 1O2DA 1SD2A 2M6SA 1YFKA 4O0LA 4ER6A 1QTIA 3IYLW 3GXBA 3ETEA 3N0RA 3TQSA 1T1JA 2YNMD 2QD4A 4H1TA 2PMFA 2YMQA 3AB7A 4IF6A 4CKEA 4G24A 1KMNA 1ZIYA 1D5CA 1QCCA 1I5OA 1TVKB 3LBAA 1XUOA 5B6IA 2ATVA 4FKZA 5HE8A 3IP8A 3Q9SA 3LT4A 2GYWA 1PDVA 2QQFA 4K9NA 4LYYA 4QUBA 5HDBB 3PUJA 1PR5A 2EW8A 2WP0A 3N70A 2WB2A 4DC0A 1U5BA 3CO0S 1BH2A 1V2GA 3OAAD 5DWDA 2R1TB 4D79A 1OWLA 2J9GA 2GPTA 2LNDA 3RS5A 2EBUA 5EP4A 1RAHA 3H97A 3V3TA 1ND5A 4B6RA 1F1BA 5COBA 5AI5A 4C6TB 1GAEO 2PX6A 4CTKA 2QUZA 1Q0PA 2R65A 3ZBQA 4JC4A 2ANBA 1X7WA 5B55A 4EGAA 2I66A 1TO1E 2BGUA 3FZQA 4GMFA 4WKOA 3WKEA 3S1SA 3BTUA 1SA0A 4GDMA 3TOSA 2FN9A 1GZVA 1SN7A 1N6OA 3LIPA 2ZYDA 2OFOA 1MIHA 3H17A 1Y1KE 1Z07A 4H7EA 3FR8A 4LWQA 1CY7A 4P82A 5K3DA 2ICAA 4BRUA 4XVR