5HS4A

Plasmdoium vivax lactate dehydrogenase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
313
structure length
301
Chain Sequence
KPKIVLVGSGMIGGVMATLIVQKNLGDVVMFDVVKNMPQGKALDTSHSNVMAYSNCKVTGSNSYDDLKGADVVIVTAGFRDDLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNPVDVMVQLLFEHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDEEVEGIFDRTVNTALEIVNLLASPYVAPAAAIIEMAESYLKDIKKVLVCSTLLEGQYGHSNIFGGTPLVIGGTGVEQVIELQLNAEEKTKFDEAVAETKRMKALI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
publication title Crystal structure of a DNA aptamer bound to PvLDH elucidates novel single-stranded DNA structural elements for folding and recognition
pubmed doi rcsb
source organism Plasmodium vivax
total genus 117
structure length 301
sequence length 313
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2016-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5hs4A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5hs4A02
4LCJA 4PZCA 2Y1DA 4DPMA 2UVDA 1PZGA 4XYGA 4EJ6A 5IJZA 3O26A 2X6TA 4CQLB 1UP7A 1GV1A 2PZMA 4IJUA 4PG4A 3C24A 3QQPA 3FD8A 1E5LA 1PJSA 2ZTLA 4HP8A 1VJ1A 1NPDA 2C07A 2Q2VA 2QQ5A 3JYQA 4YAEA 3ZGYA 4CLDA 5J23A 1YQDA 4BB6A 2IEDA 4M89A 1EMDA 1A4UA 2CVQA 1Y7TA 2CDCA 1YS4A 4CMKA 3WFIA 4J0EA 1H6BA 4BNKA 1XR3A 1GUYA 3WJ7A 3IS3A 1DAPA 1NBOA 3IJRA 3OQBA 1S7CA 1MXFA 3QRWA 3HB4X 2I5PO 5CEFA 4LVUA 4TRJA 4QTZA 2AE1A 1GAEO 3WYCA 1PQUA 2P5YA 3ONEA 1PGNA 1GEGA 2I99A 3BTUA 3FR7A 3R0IA 4D42A 1EDOA 4IPTA 1IE3A 2ILTA 1H2HA 2DBZA 4XGKA 1LDBA 1CIVA 4UVHA 2YDYA 3CSDA 4FN4A 3VDRA 4ZJUA 4Z0PA 1LEHA 2J3KA 3DMTC 5TC4A 4RVGA 1HEUA 3DDNA 3WBBA 3DZIA 4RDHA 4Q9NA 3DTYA 1DB3A 1NNUA 4B7CA 3LZ6A 5TS3A 1P1IA 1P33A 2GPTA 3ZWNA 1YBAA 4BGIA 2Y1GA 4ZQHA 4XYMA 2C82A 5TSDA 4R4JA 4FGWA 2OUIA 3KXDA 4CMHA 3F46A 3C85A 1K6XA 2BI7A 4OSOA 2AE2A 4ALJA 2ZYAA 3OJEA 2OXIA 1OI7A 3U4HA 2O48X 1I36A 4YAJA 4W4TA 1OMOA 1EEHA 1ZK3A 2HJRA 4XYEA 1R0LA 4J1NA 2QYTA 5IDQA 6ADHA 1YDEA 1N9GB 3CTMA 2AMFA 4ITUA 3FRJA 1YRLA 4J0FA 2YFHA 4BNYA 2DPHA 5B4UA 3QIVA 5I9NA 3I1JA 4IS2A 4NHEA 2WEKA 1NYTA 4NMHA 5HA5A 2R6JA 5LDGA 3F1KA 3EVNA 1LQUA 5ILGA 2RAFA 1WLYA 2XXJA 3K9QO 5GMOA 3H4VA 4KWHA 4BO8A 4RPGA 1Y1PA 3PLRA 5G0SA 4WCFA 2R00A 2CF6A 4BNZA 1Y9AA 1Y6JA 3I9JA 1XG5A 1JTVA 3WSWA 4E0BA 1PL7A 3DZHA 3EK2A 1E92A 4FIZA 3HE3A 3TPCA 1E6EA 2BGLA 1WMBA 4XEHA 4QFCA 1ENPA 5JLAA 2IZ0A 3H2ZA 5G0TA 2AEJA 3AI3A 4RL6A 2AHRA 1GEEA 2X9GA 2BFPA 1XA0A 1LRLA 3P7MA 3B70A 4QQRA 3H9UA 1T1SA 4OO3A 3RUCA 4CM1A 2CUKA 1OOEA 4Y8VA 1QKIA 1B14A 2O3UA 2X22A 4GWGA 4U6SA 5JCJD 5K9ZA 3GVIA 1BRMA 1DLIA 1IOLA 4NQZA 2HRZA 4AJPA 5I7VA 5F1OA 2A9FA 2NACA 3GHYA 5GZ6A 5TNXA 5JAQA 4E5YA 5CDTA 3SLGA 1JVSA 5AXAA 2PKQP 3VPSA 2NADA 3CIFA 2B0JA 3K30A 2P9GA 3HHPA 3G3EA 2PY6A 4JIGA 3GT0A 3L4SO 1ZO8A 3LC2O 1SB8A 4PRLA 4ZQFA 5B4TA 4HNHA 4DYDA 3TFOA 4B8ZA 2W98A 1HYEA 4BNHA 4CLHA 2RH8A 3INTA 3CXRA 3DEYX 4J43A 3GC6A 3RUEA 4NG5A 3W6ZA 4CLOB 1EE2A 1FDTA 2W8ZA 3GEMA 4IINA 4PLZA 5KVVA 5KVQA 1DIHA 4FW8A 1WZIA 3AFMA 4BGEA 2O3JA 4OJNA 2P4HX 1JU9A 1KS9A 2WSBA 5T8KC 4P22A 3ULKA 4RO0A 1ZMOA 4IDEA 3ROKA 2GNAA 5HS4A 4MIOA 4NBUA 2HMVA 3GFBA 3FNFA 4Q3CA 5I9MA 1R4MA 3IP1A 4JJGA 4D0SA 2PZLA 1K2WA 3FBTA 4D41A 4IDBA 2EP7A 4J6FA 4Z0HO 3OEYA 1QP8A 4NU6A 2GO1A 1EBUA 3V2GA 3DHEA 4YQZA 3FF4A 1WXDA 4BIIA 4PLVA 3V1YA 1KC3A 5I8ZA 4EEXA 3GVCA 3M6IA 1ZCJA 3N58A 3SXPA 4Y98A 1ZJYA 1YL7A 4UEKA 2WMDA 1HDRA 5JXWA 1KVUA 4PG5A 1B8PA 4E3ZA 4UVEA 3TZCA 1YB5A 2C0CA 4QXMA 4BUCA 3AM3A 5A06A 2O2YA 1IHYA 1HE2A 1MP0A 3EAGA 3H3FA 2W2LA 4CMAA 3QWHA 5B12A 4EEZA 4DRYA 1Z7EA 4E5KA 3I9LA 4J7UA 1MX3A 1JDJA 1VM6A 3RFTA 3DBHA 2FZEA 2BI8A 3IP3A 3PZRA 4ONEA 1RPNA 2D4AA 1GQYA 2CVOA 3K2EA 2NVUB 4PLCA 3HDYA 3WJAA 4ZQEA 4CV2A 4GX5A 1ULUA 4Q3AA 1AXEA 4FBGA 4P4GA 1PJLA 2OBNA 3N7UA 3WIEA 4GL4A 4BNNA 4I9NA 4R1UA 2FP4A 5ENDA 3PVZA 1YJ8A 4GX0A 2J3HA 3MJCA 4DWVA 2A35A 1DIAA 4JBIA 4NDNE 4E32A 4RLHA 4O1MA 2C5AA 1JKIA 3ZN2A 5JY1A 3VVCA 2VWQA 3GQVA 2VQ3A 2P68A 3TDKA 5AVOA 3JQCA 3MWDB 2TMGA 3C8MA 4DTIA 2B4TO 4RPKA 2VTDA 5JAIA 5IAAA 3BMNB 3GRPA 3GAFA 4UUNA 5L7TA 4AJKA 1S6YA 4KUEA 4AJEA 4AJHA 2EGHA 3NJ8A 2B4QA 5KOIA 1HDGO 1MXHA 3FHLA 4D3FA 4E5NA 1SMKA 3ICPA 4PLTA 4AJLA 2ZYDA 3S2IA 3L6DA 2CDAA 2G5CA 4XQ9A 1MLDA 2I76A 4DXHA 4L4SA 1X7HA 1YL5A 2VYNA 3DWFA 4XRGA 2HMTA 3EGOA 4NZ9A 2Q50A 4D0RA 5JAZA 5KJ1A 4XX0A 3ORFA 4BB5A 1Z73A 2WDZA 3PFFA 4BQRA 1Z74A 2NVWA 1N1GA 2VWPA 4UEJA 3U09A 3ONFA 1PQWA 1CQIA 3UCEA 3LLVA 2FPIA 4BKRA 3PP8A 4KQWA 2BFMA 2D59A 5JDCC 4PRKA 4PLHA 1SBYA 5DBFA 4E5MA 2JJYA 4U0KA 4IQ8A 3WG9A 2GZ2A 4Q3BA 4BKPA 3ASUA 1YGYA 4NK4A 1O0SA 4QSMA 2PH5A 3F47A 5BNTA 4BO9A 3DOOA 3UH1A 1HWYA 3W8FA 2NUAA 1HDZA 2IXAA 2VOEA 4FOSA 2HK8A 3T7CA 3EVTA 3IQDB 3LT1A 2BRUA 2PD3A 3DBRA 4YT5A 4B79A 1TA4A 3D3WA 2AEFA 3M2PA 3I9NA 4MVJH 5JE8A 2HQ1A 2GLXA 4TWRA 3ZWOA 2X8LA 4IY1A 4TVOA 4CLEA 1E3WA 1FJHA 2DBQA 2O3RA 1DIBA 1LDGA 3PHIA 3S55A 3VPXA 4CMGA 3NGXA 3RD5A 4DC0A 3WGZA 3GNQA 4E31A 1Z7BA 2VHYA 2YV1A 1KYQA 5T64A 1KVTA 3EZLA 2NNLD 3PWZA 3VH3A 3VDQA 1IZ0A 2EHDA 3S2GA 4WEOA 3Q9NA 4XGNA 2FSSA 3LF2A 5IG2A 3RKUA 3RUAA 4FJ0A 3C1TA 3K31A 4CL8A 1T26A 3MJEA 2YHIB 4DMLA 1ISGA 3PQEA 5AXBA 2AQIA 5HBRA 4ZQGA 4N5LA 5EERA 3EDMA 2BFOA 2PK3A 5B4VA 3OA0A 1UJMA 5CDYA 3FSRA 4JCOA 4OXYA 5HWSA 1A5ZA 3ZV4A 5DBIA 1E1MA 3PIDA 4ESOA 2OL4A 4XIJA 4KQXA 4BNFA 2XF8A 1VSUA 2P91A 3QW2A 2JD1A 2YY7A 2B5WA 4DIBA 1KEVA 4Y6SA 5IDWA 1AGNA 1LX6A 5KJCA 3E6AA 4AJ2A 1CQJA 2BMAA 4K26A 4LW8A 1NPYA 3EMKA 4L76A 4A27A 2JHFA 4HWKA 3B6ZA 3HZZA 3QE3A 4MOWA 4HFNA 4CLRB 2IYOA 4FFMA 2PKRA 1VL6A 1FDVA 2YUTA 4S3MA 4XZ3A 5A9TA 4CMEA 1UZMA 2NQTA 1VPDA 5TT1A 3HUDA 2DPGA 2UAGA 1E3IA 3WFJA 3WIDA 1Y5MA 4GI2A 4OAQA 2PGLA 3NT4A 4DIOA 1Y8RA 4Z3KA 1SOWA 1NPTO 2VRBA 3FTPA 9LDTA 2E4AA 1XQ1A 3AUUA 3ITKA 5DCWA 1WDKA 4AJNA 4K6FA 2ZATA 1N9GA 1PZHA 2LDBA 1I3NA 2NV6A 1T2AA 2NQ8A 1PGPA 1V0JA 4PLFA 4YRDA 3PPIA 3B20A 4G81A 3PGXA 3WDSA 4BS9A 3DONA 3DR3A 3NTQA 3GDOA 4FDAA 4J90A 3RASA 4XYLA 3ZWWA 1DO8A 2X9NA 4RVHA 1A7AA 1EBFA 2X0JA 2ZYGA 4LISA 5ER9A 3A4VA 4WUVA 4BHTA 2G82A 1D8AA 3EHEA 3ONDA 4CUZA 1LDNA 2A4KA 4BL5A 1NASA 4HNGA 4BMNA 4O6VA 4RGBA 1XGKA 3WQQA 4E13A 3O03A 2E37A 2W2LD 2Q49A 4J91A 2ZTMA 3PQDA 5F5NA 1KVRA 3KSZO 2Z1NA 3UVEA 3IAHA 1XSEA 3IUPA 5COBA 4MINA 4PLPA 3JQBA 1ARZA 5EL0A 3NUGA 4N54A 2W4QA 4MVJA 1R0KA 5JFOA 5EESA 3PJEA 2GN4A 1Z75A 1HRDA 2CDBA 3PRJA 4NFHA 1YO6A 1H2BA 3BYZA 4E2WA 3ZWVA 3DC2A 1EK5A 3MJSA 4PZDA 4ND5A 4F46A 4UVGA 2ZQZA 4D3SA 1HXHA 4L9RA 5JC8A 4PG8A 1HDCA 2J3JA 4E21A 5FFFA 4A73A 3DO5A 3DBLB 5JMPA 4FC7A 2VNAA 2Z95A 3QVOA 1ISIA 2DM6A 3RUFA 1AHHA 3O8QA 2V65A 3PJFA 3PJGA 4W99A 2AQKA 4BNGA 1E7QA 2Q1SA 4KUHA 3WBFA 2DFVA 3R3SA 1C1XB 2PD4A 3L0DA 5JCJA 3P19A 1PZFA 4TMFA 2O3SA 2GYYA 4FCCA 3JD4A 3H5NA 4DL9A 1ZSYA 2YDXA 4TSKA 3GNTA 3ZNPA 2GN9A 3E18A 4NBRA 3F4BA 1LJ8A 4YACA 3MWEB 4KP7A 7MDHA 4WKGA 4B7XA 1N1EA 1Y8QA 5A9SB 4YQYA 3OSUA 4LSWA 4RVSA 1GCUA 1H9BA 4CLOA 4W9NC 5IDXA 2J5QA 2CZCA 3GGPA 1GDHA 1LDMA 2Y66A 1YOVB 3AWDA 3PHLA 1OC4A 1SEPA 1TI7A 3GFGA 4P38A 2VYND 4TKLA 3WTCA 1GTMA 5U1PA 4AJ4A 1E0DA 2QZ9A 4BV9A 2HLPA 4MVJE 2B5VA 1F06A 4IQGA 4IJVA 2Q4EA 3QP9A 2YV2A 5KTKA 3GMDA 1JW9B 3PTZA 4PLGA 4W6ZA 1U7HA 2QHXA 2XPCA 4YJGA 2PFGA 4MIYA 3BMCB 4I8XA 4CMIB 2VWHA 3KYBA 3L9WA 4DPLA 3C7DB 4WLVA 3DMTA 2EF1A 3ENNA 2E49A 4OL9A 4CQMA 2DBVO 2WJPA 2V7PA 1LSJA 4AJ1A 1PZEA 1SPXA 3FNEA 4U5QA 3SJ7A 1ZW1A 2VT2A 4EDFA 4GSLA 1Q0HA 2OP0A 1ISFA 1P1HA 5CHEA 1F0YA 4BOYA 2YV3A 3QWIA 1XHLA 1X7DA 1C1DA 3D5TA 5CG2A 4R3WA 2JCXA 1X15A 3S2FA 4CM7A 4GMFA 3DZBA 4YT4A 3OMLA 1XELA 1O95A 4IUYA 3RAJA 3RUIA 1EVJA 4D46A 4DIFA 3VKVA 5A3VA 5I7EA 5EPOA 1P9LA 3FWNA 3H9JA 2FR0A 2VZ8A 4TQGA 4WLOA 5THQA 3WGQA 2ZKLA 2PA3A 4IXWA 3SJUA 4E2ZA 2O3QA 1NVMB 4YXFA 4JXKA 3K6JA 3KSUA 1NAHA 3UN1A 3OH8A 4LK3A 1OAAA 5U9CA 1HLDA 3EC7A 4DQVA 4Y67A 3H7AA 2JAHA 4NIMA 1K89A 1DSSG 3DAPA 3ETGA 5CPFA 3G0OA 1AUPA 3K96A 2UUOA 3UCXA 4JK3A 5ES3A 4TZTA 2V6MA 4YJFA 2BF7A 2Y1EA 4MVJI 5L3ZA 2RHCA 5BSEA 4ND2A 3OJFA 1NQAO 1M76A 3DHNA 2IYPA 3NKLA 2HAEA 5AOVA 4B7UA 4MKZA 2LDXA 1BTOA 1HE5A 3BMNA 1E7WA 3QVSA 3I9MA 1NFFA 2Q2WA 1HYGA 1WDLA 3PGJA 4JLWA 2QYSA 5KJEA 1R15A 3OF2A 3N74A 4FS3A 2VT3A 5H82A 4IDGA 1DEHA 3WQRA 5I7FA 3AUSA 4HV4A 2H9IA 2B37A 1SAYA 1P1JA 2CF5A 1SB9A 4XQGA 1I0ZA 4ZN6A 3CPSA 5TGDA 1I32A 3BTSA 3WTBA 4O0LA 2D8AA 1DFGA 2DTEA 3GZNA 3GUYA 1U8XX 1KOLA 3VVBA 3F3SA 1EUDA 3WMXA 3LYLA 1P3DA 1UDCA 3SEFA 5I7SA 4XB2A 3PWSA 1I3LA 1O89A 3U4IA 2P9CA 1U3WA 4YB8A 4XD2A 2WE7A 3E5MA 4OMUA 5DOVA 3C3XA 3ITDA 5HRUA 4JN6B 4QFDA 4ZHSA 4AJJA 4BNMA 2TMDA 3ANNA 1KVQA 2Y93A 4QX6A 3WB9A 3JD3A 3JYNA 1YQGA 4FJ1A 1EVIA 1P44A 2ZIZA 3R3JA 1Q7BA 3GPDG 5T67A 1KERA 4Z9XA 5JYEA 3IMFA 4GGPA 2CFCA 1YL6A 2WD7B 1C0PA 1I3KA 1ZK1A 1L7DA 3DAFA 3IJPA 3HSKA 4RF4A 1IYZA 4KDFA 3ZU2A 1FF9A 4RJTA 1N8KA 2ZB4A 1PGQA 4WOKA 4RVFA 2GR9A 3WYBA 4GPD1 1C0KA 1HYHA 1KIFA 1YB1A 3BA1A 3MTJA 3TSCA 5JCXA 3TQHA 4PFJA 1PL6A 2EKQA 2VHVA 4FFOA 1VJ0A 1TVEA 2HU2A 5CPBA 1EFKA 2WYWA 4PVDA 1LXCA 4U0JA 1FDWA 1U2GA 1UXGA 4MVJD 3RU9A 2Y99A 2D5CA 2VZ9A 1NWCA 3ICCA 1E5QA 3DZJA 3DXFA 1PJ3A 3E8XA 1PQPA 1KEUA 1BXKA 1D4FA 3BMQA 2NU7A 1NFRA 5DP2A 1PS0A 4BNTA 3C7AA 4YDRA 1B3BA 2QIOA 4WECA 4IJKA 4OXNA 3NDRA 4J4HA 3A28A 2X7HA 1PJCA 3HQ4O 3TNLA 1NVGA 4CPDA 2VWGA 4M8SA 4NU5A 1V6AA 4YJHA 4MP6A 1P31A 2DVMA 5EN4A 1EQ2A 1I01A 5HS6A 4YT8A 3G79A 2V6GA 3WQSB 3A1NA 3KEOA 1NFQA 3WMWA 2CMDA 1EDZA 4IZHA 4WASA 2AQHA 3NT5A 4QUKA 1ZK2A 1BMDA 4YCAA 2UYYA 3WX0A 1HSZA 5BSFA 1JWAB 4B3JA 2YW9A 1X1TA 3CMCO 3I4FA 2W2KA 3KSDO 4RV9A 5IXSA 2H6EA 2PV7A 1ZZEA 4RF2A 1WW8A 4RPHA 1XU7A 3X2EA 2PGDA 1K6IA 4LRTB 1EFLA 3Q11A 5TX7A 4NR0A 1K0UA 3JQ8B 3RUHA 1U3VA 4OIMA 3AM5A 4R54A 4II2A 1B2LA 2O4CA 3TZKA 4OKNA 4EUFA 5JSFA 4JQCA 3IC5A 3RWBA 5GY7A 4R5HA 1GV0A 1ZXLA 3LU1A 3ZWBA 5ICSA 3D4OA 5A02A 2CY0A 3D4PA 3O38A 1Z82A 3U62A 5AXCA 3PWKA 1A27A 1BW9A 1Y5RA 1OFGA 2BKAA 5T5QA 4YAIA 1YBMA 3BIOA 1ZXBA 3VZSA 4FFNA 1R37A 1I2ZA 4C4OA 1M2WA 4PCVA 4CQMD 4RZHA 1N5DA 1MA0A 2BGMA 1SO8A 4S1VA 4NJOA 2C2YA 3VTZA 1K3TA 5EINA 5CFZA 3KV3O 3AJRA 1YXMA 4F45A 1ULSA 4YPOA 2Q46A 4R5MA 1QYWA 2X5JO 3UUWA 4XIYA 2FPPA 1NVTA 1YH3A 2YFQA 1A9ZA 3KYDA 3VKUA 5KKAA 1N2SA 4TROA 3D5QA 1EZ4A 1WMAA 5T57A 1U8FO 3Q2IA 1U5CA 5JDCA 4ZRMA 5KJFA 4YWJA 2GN8A 4EBFA 1QLJA 3GF4A 5L45A 3RFXA 2H5LA 1LQTA 3H5AA 5G0WA 4XQCA 2J5RA 2QRJA 3JQFC 2AG5A 1NQOA 1NTOA 4L0QA 1CWUA 4HFJA 5F1KA 1JLLA 3GVHA 2EEZA 1MFZA 3KYCA 2OZPA 2JCYA 3GR6A 3F4LA 3WNVA 1C3VA 1HL3A 1DDOA 3ZWYA 4BNXA 4YAKA 4CJXA 4Y9DA 1QG6A 1YBVA 2FMUA 3D3EA 2IZ1A 4IMRA 1M75A 3AUTA 5IZCC 3ZW8A 4CV1A 3KB6A 1BXZA 1J49A 3I9KA 1JAXA 3CZRA 2G1UA 1DJQA 1T1RA 1LDEA 1E1NA 1B8UA 2HMWA 3JQAB 4GKBA 1E7MA 4K28A 5ICMA 2VOJA 3PYXA 4U6QA 4XR9A 2CD9A 5EQFA 4PG7A 4D44A 2Q1TA 1DIRA 4MIEA 5DNAA 3ZI0A 3LT2A 1BXGA 1C1XA 4GWKA 2JD0A 3R6DA 4GVLA 3JQ9C 4J7XA 3AY7A 4JNKA 1QYVA 1NWHA 1W8DA 3AU9A 3CH6A 5G4KA 4XDZA 2FZWA 3VH4A 5CG1A 4Z3DA 3ZV5A 1I30A 4PN3A 1NHWA 1QYXA 5A9SA 5FI5A 3Q9UA 1H94A 4HXYA 4H7PA 4OQYA 2VRCD 5DT9A 4EI2A 2O4UX 5TIIA 3BTVA 4J1SA 3OIGA 4JX8A 1YOVA 2UDPA 1ENZA 1LNQA 3EZYA 1EVZA 4MKRA 1ADCA 1YDWA 3H3JA 4IIVA 4WEQA 1QXSA 2GZ3A 4CM8B 2PH3A 2O50A 4Z0TA 5I9LA 1GADO 1LTHR 1ZK0A 4WNCA 4AL4A 1H0KA 4FGSA 2Q2QA 4GH5A 4I5DA 3CINA 3UHAA 2PLAA 1BDMA 3CEAA 2RHRA 1CEQA 1QSGA 3QA9A 1QLHA 3AOGA 5LCXA 2PWZA 2EIHA 2C29D 4K6CA 2BLLA 3HN7A 3BMCA 4HY3A 4IXTA 4OQZA 4CM4B 4CMIA 2ZB7A 1HF3A 1I3MA 5G0VA 5AYVA 5ENVA 3H6KA 3KVOA 3W8EA 1V3TA 3KM0A 3JTMA 1NAIA 1IPFA 5GZ3A 3PQFA 5CEEA 1YONA 1VRWA 4GAEA 2XOXA 4QECA 1KEWA 3DTTA 4EGFA 4GBJA 3I5MA 3Q0EA 4GLLA 1W6UA 4Y6PA 4YBZA 1WNTA 3CZMA 1LDYA 1ZVMA 5AXDA 5H83A 7ADHA 2DFDA 3I52A 4I08A 1PU2A 2EWMA 3PHHA 1E6UA 1IL0A 1LSOA 1U9JA 2P9EA 4OOFA 5COAA 3WGTA 1CDOA 4RQUA 4RQTA 3OA2A 4NK5A 3OICA 3IDSA 5I8WA 3GOHA 1VKOA 5G0UA 4NPCA 3S8MA 5C5IA 4TZKA 1B8VA 2I6TA 4HFRA 4J1TA 4DGSA 4A10A 1AXGA 1JKFA 3JQ6A 4FR5A 4HKTA 3MOGA 1UZNA 1CERA 4FJ2A 1XKQA 2GERA 2ZCVA 5JPIA 1V35A 1I8TA 3UCFA 4RPLA 2Q1UA 2Y1CA 3DOCA 4CQLA 5LDHA 3BHMA 4I1IA 4J49A 1DPGA 3DBVO 3HFGA 4MO2A 1A7KA 1TT7A 3RVDA 3NAQA 4GLOA 4R1TA 1T4DA 4ZU3A 3UF0A 2BELA 4INAA 1H6AA 3D7LA 2GF2A 1NR1A 3UOGA 3E9MA 3JQ7B 2E6UX 1J4AA 4HFMA 3E1KA 1X1EA 3A9WA 3DQPA 2JAPA 1KEPA 4W7IA 5FWNA 4UREA 3RBZA 1U7TA 3KLMX 3HDJA 5FYDA 3GHHA 3VPFA 1FMCA 2A92A 3Q2KA 5JY6A 1HT0A 3GVPA 4YA6A 2HMUA 2C20A 2EW2A 1PGJA 4ALLA 1ZBQA 2DT5A 3GAZA 1GD1O 4D79A 2Y0DA 5KIAA 2A94A 3WGGA 3CKYA 3PDUA 3PHJA 3GG9A 3PHGA 3OM9A 3QVXA 4TRMA 3I23A 1ID1A 4XYBA 2JL1A 4W82A 4WGGA 4NI5A 4NBVA 2Q3EA 1E7RA 2DAPA 3IUSA 3CMMA 3K5PA 4Q3DA 3ANLA 4IJWA 4PGFA 5CAEA 3ASVA 4I5GA 1CRWG 4R1SA 1A9YA 1GZ6A 3STHA 3F9IA 3ZW9A 1XDWA 1G0OA 1WP4A 4W9NA 4CLXA 4BKQA 1NQTA 1EUCA 3RSHA 1OC2A 2J6IA 4E2XA 1WVGA 1UP4A 3RBXA 4L8VA 4O63O 3GN1A 5EMHA 2NU6A 3OIFA 2AEMA 1D3AA 2D1YA 3GEDA 2AXQA 2HKIA 4UUOA 2JCVA 8ADHA 2WD8A 3INGA 2VZ0A 1TT5B 4B4UA 4UVIA 4DVJA 3E9QA 5C7IO 3GDFA 4LN1A 1QORA 5DCUA 4WLUA 1NQ5A 3JQEA 1X13A 3JQGB 1I10A 1QR6A 2YHUA 3AUAA 5JNLA 1ZEMA 4WLFA 1OBFO 1RM5A 2EG9A 2DLDA 2X4GA 3SBOA 1QV6A 1O9BA 4O59O 3W4KA 2P5UA 3GUCA 3B1KA 3TN7A 2I9PA 1A72A 3COSA 2VYVA 1QYDA 4I5FA 1X7GA 3M1AA 1DFHA 3RCBA 3PYLA 1RM0A 1SEVA 5H81A 1G1AA 2O2SA 4JROA 4NBTA 1DC5A 2WWRA 1ZKMA 1GL3A 1IPEA 1SOVA 3MTGA 2B83A 4OXKA 1C0IA 1R4MB 4NH4A 3S1LA 4ILKA 2PR2A 1XLTA 1E1KA 1MFPA 1P0FA 3LQFA 3OP4A 3H5RA 5DF1A 1BVUA 3TL3A 4ZICA 3JSAA 3GH3A 1CF2O 2FHSA 1VC2A 3DB2A 4I9UA 3GGGA 1N7HA 2DTDA 4J2OA 1K5HA 4D7AA 2DTXA 3OBBA 1LI4A 1E7YA 3KETA 3IL2A 5G4LA 1P77A 1WZEA 1BVRA 1P1KA 4WOJA 1ENYA 2FSVA 4E4YA 4H3VA 5BSGA 3ZNQA 3MJTA 5CDUA 3QWFA 3ZU5A 1O8CA 3GDGA 3P2YA 3JD1A 3M2TA 3OFSA 3OQ1A 3WGYA 4B8WA 2EJVA 3DBHB 1Q7CA 2Y0CA 1XQ6A 2POQX 2PZJA 2C59A 2PNFA 1HSOA 3ZWXA 5L95A 2J3IA 5THKA 3KTDA 1UUFA 3VOSA 4JJIA 1ZFNA 2FR1A 3UKOA 5A5EA 5ITWA 4GKVA 1DIGA 3F6YA 3QVTA 3RC9A 1F8FA 1Q0QA 2HMSA 4FPXA 5L7YA 1HE4A 2XXBA 1XCBA 3HFSA 4CUKA 4MP8A 5TQVA 3FWZA 5EQDA 3GY0A 1GFSA 2YQ5A 2YYYA 3BZUA 3IIEA 3QJ5A 1HE3A 5JYDA 5CEJA 1I33A 4M49A 2V6BA 1BSVA 3W8DA 1EQUA 4KOAA 1GZ3A 4KTVE 5BR7A 5A9RA 3O9ZA 3E48A 3G1UA 4GX2A 4CMBA 1EVYA 3LLSA 3DZGA 3JYLA 3K92A 3PI7A 4PZEA 1KY5A 2IODA 3E03A 2O3TA 4I9HA 3RC7A 1X0VA 4UULA 3TWOA 1ZUD1 2VHZA 1ONNA 1YB4A 4M1QA 2GN6A 1F14A 1KY4A 3C1OA 4MKXA 4RVUA 4TRRA 5KWEA 3H8VA 4WCDA 3RBVA 1E3EA 3TOZA 1CJCA 4LSMA 1W73A 4XWYA 1DRWA 1DHTA 2VHWA 2IXBA 3KBOA 2Y0EA 1W4ZA 3DZKA 3AOEC 1T2FA 3PFWO 5EJ2A 3V8BA 2ZJ0A 4CM6A 3AY3A 1E77A 3LC1O 4OOEA 3D4NA 4JP3A 4Q3NA 1M6HA 2JFFA 1SC6A 5K0ZA 2NVUA 1M67A 1ADBA 1ISJA 2DC1A 4N18A 4RF3A 3JQAA 1KBZA 5HM8A 1VKNA 4DLAA 5C37A 4L73A 5DOZA 3I4CA 5GZ1A 2G17A 3R1IA 1PTJA 2EGGA 4LCEA 1N7GA 3NTOA 5MDHA 2OGUA 4XR4A 3D0OA 3ETEA 2IEBA 1GUFA 1V3VA 5LC1A 1I2CA 2FN7A 1I2BA 1SCUA 3TZ6A 4PVCA 2VNSA 4WLEA 2NM0A 4J9VA 2QZZA 5COQA 5JDIC 5HTOA 1E3SA 2J8ZA 2WE8A 3ZV6A 2VN8A 4DQUA 3GVXA 2ZCUA 4KWIA 3D3WB 1B15A 2NTVA 4OGWA 1R6DA 5DCYA 4BNUA 4AVYA 4MJLA 1JAYA 2GCGA 3L4BC 2HCTA 3U4DA 3LT4A 1E3WB 1MC4A 4CM8A 3LF1A 4M55A 3V5NA 3ON5A 3NX4A 4A5OA 1EUZA 3PEFA 3GLQA 2OHXA 1ZSNA 3ZWPA 2RIRA 4TRNA 5BSHA 2VRCA 2CNBA 3WOHA 1A71A 3VPHA 1AHIA 1GY8A 5BT9A 4BO0A 1EE9A 2E82A 2RH4A 1Z6ZA 1VSVA 4MVJG 3ROQA 3DFZA 4CM4A 4BO4A 4B4WA 3B1FA 2O23A 1KETA 2Z5LA 5CP8A 1UXIA 5JAMA 1YKFA 1UDAA 2QG4A 5IXYA 1LSUA 4XA8A 3T7EA 4HADA 4ND3A 3MJ4A 3U5TA 1J6UA 3WWYA 1E3JA 4UAGA 1ZH8A 3DHYA 4MP3A 4IZIA 3VH2A 2JFHA 1HETA 3WGOA 1DOHA 1U3UA 4KUGA 1VE9A 1UXJA 5TT0A 2BD0A 2I66A 3H2SA 3TOXA 6LDHA 4RVDA 1DC3A 1FDUA 5L51A 3HADA 1GU7A 3JYPA 1L7EA 3AU8A 4J9UE 1E6WA 1R0SA 3SLKA 2FWMX 4BV8A 1SNYA 1MUUA 3RJ5A 1ISHA 1PJ4A 3HDQA 4G5HA 1R12A 4J7CA 4CR7A 3TF5A 4F6LA 5A04A 3L6EA 4OKIA 5T8KA 3F5QA 2JHGA 1VL0A 2QRKA 3WWZA 5KJ6A 4K1LA 3GZ4A 3ENKA 1ZSVA 3VZQA 1O94A 4L74A 3UGKA 1HDXA 1DC4A 2VYVD 4YRBA 5L4NA 1JQBA 3W4JA 1I5RA 3OEWA 3HG7A 2JFGA 3C7CB 4FQ8A 4CMCA 2ZK7A 5B1YA 3ROPA 4B4VA 5JO0A 3MOIA 1IULA 4AJIA 4BQPA 1BG6A 1ZMTA 3GRKA 3L77A 3PIIA 1Y8RB 1RWBA 2I3AA 1MG0A 2JKVA 3H9EO 2IDZA 3IKTA 2D5AA 1BHSA 4BGVA 3H9QA 2GZ1A 4L4XA 4FOOA 2J5KA 5BNIA 1Q7GA 4EJ0A 1MG5A 1P45A 1H9AA 1M66A 1RYEA 3BHIA 3JQFA 4IGFA 5IF3A 3L6OO 4IBOA 3KUXA 3LK7A 4XJSA 4OM8A 3ZDFA 3TZQA 3JQ7A 2R2GA 2VCYA 1FK8A 2Q99A 2YHIA 3E9NA 5K6AC 3AW9A 1Q1NA 3DMYA 1IUKA 1YE3A 2X5OA 4PG6A 4QO8A 5IZCA 1BWSA 4NFYA 4XRRA 2GASA 2AA3A 2F00A 3Q1LA 5FI3A 3H9GA 1Q0LA 4LRSB 4DLLA 1VL8A 4LMPA 3UAGA 1C14A 3TFQA 2VTEA 1T2DA 4MVJF 5IFLA 3KZVA 4YRAA 4R51A 4A26A 3U3XA 4R1NA 4MVJM 1CYDA 5F5LA 3NT2A 1PS8A 1DXYA 2ZJ1A 3W1VA 4O5OA 4C7KA 3JQ9A 4UUMA 3VPGA 1HZZA 2PTGA 4HBGA 3ADOA 4G2NA 4XJTA 1F17A 2WYUA 4BNJA 4FC6A 2D2IA 3D1LA 2HSDA 4CLRA 5L40A 3FTNA 1VLLA 4CMJA 1LLUA 2BGKA 3NYWA 1LUAA 5IZ4A 1VI2A 2Y1OA 3HN2A 4WPGA 1LRKA 2ZB8A 4RCVA 1WWKA 3FCOA 2WYVA 1T2EA 1UXHA 3ADPA 4ALMA 4IS3A 3WYEA 4BNLA 4Q3EA 3WLEA 3LVFO 1XYGA 4HUJA 5T6BA 1MGOA 2B4RO 4W7HA 1ZJZA 1JN0A 5KVCA 4E5PA 2EXXA 4FFLA 2GRAA 4CM9D 2I3GA 2EERA 3H65A 1R4NB 4RZIA 4CM5A 1B0AA 4ZA2A 3FR8A 3O8QB 2C7VA 1TT5A 3HDHA 2FY8A 4R01A 1U3TA 1DRVA 3KHUA 4Y6RA 5U4QA 3WR5A 1P1FA 1HLPA 4DBVO 1GPJA 1T24A 2NVBA 2X9VA 3G1TA 4DC1A 4EUHA 3JQGA 3BAZA 1NX6A 4K9DA 1LBEA 4RPJA 4F3YA 2ZTVA 3SC4A 1ZIDA 1Y8QB 2OMEA 1PWXA 3OHSX 3ZHZA 2H63A 2PGJA 4L75A 5A3JA 4XDYA 4XB1A 3AFNA 2H1SA 1IY8A 4RDIA 5L53A 2X5KO 2FRDA 4EW6A 1PJ2A 4KZPA 1RYDA 3RQSA 4BO2A 3EUWA 3HWRA 4IDAA 4BNWA 5JBIA 3WNQA 1JA9A 4BO6A 5DDIP 1LSSA 3T4EA 2FOIA 1ONOA 3LC7O 3JCZA 1UAYA 1LC3A 3NDJA 1FDSA 5FEUA 1GPDG 3VC7A 4AICA 3JQAD 3HJAA 3I6QA 2D0IA 3PYMA 4DPKA 1LLQA 2DUUA 1HKUA 3MJVA 3VZPA 4YJGB 5DN9A 1U5AA 2C2XA 1P1RA 2QW8A 4CQMB 1MC5A 1PJQA 2X0RA 4NJMB 4NNJA 4OYRA 4YR9A 4BO5A 4AJOA 1D1SA 3NTRA 3DBLA 4BKOA 4WCFC 2R00C 3QWAA 4J4BA 1U4SA 4Z9FA 4FB5A 3WICA 2AQ8A 1XIVA 1Y81A 2IZZA 4XQEA 2DQ4A 4N7RA 3QWBA 3VAZA 1C1DB 5JW6A 4I5EA 3ANMA 3JYOA 4PLWA 3BMOB 3DL2A 4FD3A 3AI2A 2HDHA 3UICA 2ZTUA 1GQQA 1PS9A 2QRLA 2B36A 3WLFA 2Q1WA 4R69A 1IB6A 3SC6A 3FNHA 3VHRA 1QYCA 4QO7A 1WPQA 5B37A 1ML3A 2UUPA 4RORA 2B69A 4N5NA 4B3HA 1YVEI 5L4SA 2GGSA 2WM3A 5IDYA 1QV7A 3RROA 4BGUA 1H5QA 5FF9A 1UR5A 1H6DA 2B35A 4BO1A 1V9LA 2Z1MA 2YQ4A 3M1LA 4IDFA 1AN9A 5C7OO 1DRUA 4YJFB 4B3IA 3AI1A 3TRIA 1D7OA 1U2DA 4GVXA 5C3MA 4ZGWA 2NTNA 1UXKA 3PK0A 4D45A 4JGBA 2VHXA 1XU9A 3G17A 4J1QA 3FI9A 1D1TA 4WNIA 2GSDA 2PD6A 1PGOA 3QVWA 2BH9A 4R9SA 2Y05A 1VJTA 1GZ4A 3GA0A 3NDIA 4E6PA 5L7WA 1W0CA 1B26A 1DFIA 3JD2A 3KLPX 5IN4A 2X0NA 1ENOA 1GUZA 1FXSA 2E48A 3UW3A 3MCVA 5ILOA 2OP1A 2P4QA 1DLJA 3IOYA 1AE1A 3B1JA 4FFRA 5DZSA 3LDHA 3AY6A 1CETA 1LLDA 1K6JA 3GZNB 4R3NA 4A2CA 4LGVA 2X0IA 4XKJA 3ZWMA 3NGLA 5A03A 5JC1A 5A05A 4FFPA 1UH5A 2EJWA 5TRTA 1KVSA 3Q6IA 1P74A 1RM4A 4IMPA 3A14A 4YTEA 5KVSA 2Q4BA 2EP5A 2OORA 1DHRA 4ALIA 2HJSA 4GMGA 4JJFA 3QY9A 3OJLA 3ZHYA 3QSGA 2NTJA 4EITA 3GEGA 1KC1A 4IDCA 4P4NA 4DREA 3G49A 4E2YA 4YT2A 2DUWA 5A4DA 4ZD6A 2HK7A 3W6UA 3T4XA 2XAAA 1T4BA 3GMSA 3QHAA 3RFVA 5G2OA 4OHUA 3ZU3A 3FPCA 1UP6A 1JVBA 1YJQA 2AG8A 2SCUA 4TVBA 1T25A 1PWZA 3U49A 4E33A 4TKMA 1J0XO 1RJWA 2HRBA 4R68A 1ONPA 2VUUA 3RC1A 5A1TA 4DMMA 1EK6A 3BXXA 3UXYA 2CVZA 2RBEA 3FPLA 4OH1A 2W90A 4ALKA 1ISMA 4RF5A 1B7GO 1H93A 1ADGA 1C0LA 4CV0A 1QRRA 1PX0A 1RKXA 4X54A 3RI3A 3ZNOA 2C5EA 3F1LA 3ZHBA 3P5SA 4WCFB 4QT0A 1O6ZA 2O7SA 2PZKA 4IGEA 1TXGA 3A06A 4U7WA 3V1TC 2NU9A 3BMQB 3DZFA 3X2FA 4P8RA 1V8BA 2NWQA 4JBGA 5L4LA 1SZJG 1DC6A 3INRA 4BO7A 4R9RA 4G65A 4PLYA 4F6CA 2X58A 4NBWA 1Q2XA 3DOJA 2IE0A 4YJHB 1NP3A 3GPIA 5DULA 1ZK4A 4BMVA 1JWBB 5IN5A 2JD2A 1XWFA 4FSHA 3E82A 4EYEA 8LDHA 4BMSA 2X23A 3U9LA 3GG2A 1UZLA 4RLSA 1UAGA 2WD7A 2Y68A 4DA9A 3QLJA 1O5IA 3JQDA 2W2KB 3PLNA 4CL3A 1HTBA 1M6WA 2F1KA 4XGIA 1F12A 4WJZA 3WXBA 4II3A 1X0XA 4DBZA 1DAOA 3P2OA 4ZVVA 5CDGA 2NLOA 1IHXA 1HDYA 2DKNA 1QMGA 4L4RA 3MZ0A 3V2UA 1E1LA 1LA2A 1V3UA 3ZCXA 1GYQA 4UVDA 3TZHA 3ZWCA 5DP1A 3NEPX 4H15A 2NSDA 5EIOA 2RCYA 5ADHA 4P4LA 1U4OA 3KRTA 1BW9B 1ZNQO 1TB4A 4JP2A 3JV7A 2QX7A 3ZV3A 4A7PA 1LLCA 1UDBA 2YZ7A 3EY4A 3RJ9A 1G0NA 4CODB 3D64A 1J5PA 3PXXA 4KDEA 3U4CA 4UUPA 4J2HA 3AOEA 5F1PA 3E5RA 4ND1A 2NU8A 4U8GA 2UV8A 3LSYA 3I3OA 2V6FA 1T2CA 4ZQBA 4N5MA 1E3LA 1YWGO 1R16A 4ROSA 4AG3A 1OZAA 3AM4A 1BDBA 1PR9A 2EV9A 4ND4A 3UFXA 4DLBA 3KYDB 5TF4A 5JS6A 3DFUA 3O4RA 4R41A 4GGOA 1YQXA 5MGBA 3WGIA 3V1UA 3OETA 2G76A 1NM5A 3CUKA 3ABIA 3S2EA 4BKUA 2YJZA 2HUNA 4YVFA 4A0SA 1GCOA 4AFNA 1PR3A 3EW7A 1A4IA 1GR0A 5BNFA 3LT0A 3FNGA 4DYVA 4D3DA 1U1IA 4J3FA 1L1FA 2Y67A 5JDIA 1NR7A 1X14A 3TJRA 3KYCB 3JQ8A 3W4IA 2WTBA 1ADFA 3DAGA 1XEAA 2EKLA 4E30A 1U28A 2G0TA 4BO3A 3VTFA 1F8GA 5TJHA 4LMRA 3ZZNA 3L4BA 3ZU4A 3TL2A 4J4TA 4KTTE 3HNPA 3RC2A 4YEDA 2OO5A 1NXQA 3L07A 1HDOA 2GDZA 1PJBA 4R16A 1R4NA 3OJ0A 1ORRA 3KEQA 4BNVA 5L9AA 3GK3A 3ST7A 1B16A 2HO5A 4JBHA 4KMSA 1N92A 1BXGB 4PIVA 4Q39A 4E12A 2C54A 4GX1A 4Z6KA 4YYZA 2BFAA 5KCZA 3ROMA 5KKCA 3ZNNA 4UEOA 4MPDA 5G4KB 3RIHA 4EJMA 4WLNA 1P0CA 1MB4A 4URFA 1JKJA 1G6KA 2BHLA 4ZRNA 2DBRA 3SX2A 4CM3A 4CM9A 2EKPA 5CDSA 3K8ZA 2DU8A 4CMEC 1H6CA 2P2SA 3WS7A 3C1AA 4CUJA 2CSUA 1NHGA 3HB5X 4EUEA 4WK6A 3AK4A 3QV1A 4CR8A 4GQAA 3V2HA 2GUGA 1MV8A 3BHJA 1DJNA 3CE6A 2ZB3A 3BTOA 3PJDA 3WGHA 2PKQO 2ZQYA 4EZBA 4IM7A 3I6IA 3NJ4A 9LDBA 1B3RA 3OJOA 4DQXA 2D3TA 4BVAA 1PSDA 3Q3CA 1GYRA 4YJDA 2C7GA 1LU9A 2X1HA 4DUPA 2AW5A 3NRCA 3KOUA 4ID9A 4H16A 4M86A 2FR8A 1ZEJA 3SVTA 4M87A 2Q45A 3OECA 3RUDA 3VH1A 1HZJA 3WSVA 5AQ1A 2HK9A 4IQ0A 4XCVA 2X86A 4HX5A 1WAMA 3VZRA 3NV9A 3PDJA 3RKRA 4BNIA 2GD1O 1Y9EA 3FN4A 4NJMA 5F21A 4LVCA 3L9XA 2EW8A 1PL8A 4OSPA 4MDHA 5TJ9A 1GQ2A 5ITVA 1IZ9A 1GYPA 1WDMA 3K73O 4CV3A 1R66A 4ALNA 2Y1FA 1LRJA 1TEHA 2O7QA 3EYWA 3GGOA 1RM3A 5C7LO 2ET6A 1BGVA 2OOSA 1LC0A 4A03A 5ER6A 4YAGA 3BMOA 3JQBC 3RU7A 5A5FA 4M54A 3KO8A 5BQFA 4J16A 3I83A 5JMWA 2FPGA 4QEDA 3PZBA 3ZWAA 3OIDA 3FBGA 4C7JA 1DBVO 3IKVA 3OQ6A 1E7SA 2VUTA 1PEDA 5JO9A 1Z45A 1TLTA 4IIUA 3DBRB 3JD0A 1PIWA 3ZH2A 5K6AA 3GNSA 3ZHXA 4WE3A 2OBYA 3I9OA 2IRWA 5F3RA 4B4OA 3ETDA 4CR6A 3U0BA 3GN2A 4GSKA 4MVJP 1PJTA 2I65A 3MEQA 2VUSA 3F5SA 2OFPA 2I67A 4D43A 4IDDA 5DBGA 1I24A 4NFSA 4Z9YA 5TLSA 5KNLA 3K2BA
chains in the Genus database with same CATH superfamily
3TSZA 2EZ4A 4LCJA 4RHEA 1G66A 3OY7A 2AZDA 2CLDX 3DE6X 3X0DA 4WCVA 3K1AB 2RE8A 3PNMA 4HAXA 4YCLA 4WHMA 5FNZA 1EP2B 4MAMA 2PZMA 1DV1A 1Q3HA 1Y8CA 1NBEA 1RRGA 3C24A 3QQPA 1E5LA 4IWNA 2ZTLA 4RZ3A 1VJ1A 4AJHA 2Q2VA 3C6BA 3W8NA 4F72A 5D3QA 5J23A 4DMHA 4WUTA 3W6NA 5JVDB 3W5IA 1EMDA 1U2RA 2FZVA 5EUBA 4C0QC 1Y7TA 4LZOA 5MHTA 1YS4A 1JBKA 4KSYA 4J0EA 3QX3A 1H6BA 3GJTA 3IS3A 1OYOA 1ZYUA 3OAAD 1NBOA 3IJRA 4MZXA 4NTZA 5BWOA 3VVMA 3M9LA 3L8CA 3WLRA 1Z5UA 1AQNA 1S7CA 1ULBA 3P5BA 3BX1A 3SQLA 3IEIA 3EE6A 1MXFA 2I5PO 3P45A 5LZ5A 5K99A 2G9UA 4RFSB 4TRJA 4QTZA 3GARA 1E61A 4JLPA 3A1FA 4MUXA 5ITZA 3O8OA 3QKSB 3BTUA 3ER6A 3R0IA 2H51A 4D42A 1PR0A 1VLJA 2P62A 1IE3A 4YUWA 5DW3A 1FDRA 5BP7A 5IHXA 2PN1A 1BEUB 2ILTA 2PCJA 1H2HA 1LDBA 1CIVA 1KE1A 2VJLA 1J2RA 1RQLA 4P2BA 3M6FA 5DI3A 1S8FA 2CZGA 3AQ4A 3CEPB 2P1RA 2GNPA 2WVJA 4FN4A 1RHRA 3VDRA 4ZJUA 3S81A 2UYHA 2J3KA 3O93A 4RVGA 2O0LA 5TARA 1Y3DE 3DZIA 4RDHA 3DTYA 4B7CA 4B74A 4YJ3B 4PHCA 4YUYA 3U3OA 4AP9A 1L3CA 5TS3A 1P33A 2PO5A 1C7ZA 1YBAA 1SUDA 2AJTA 2Y1GA 3EIOA 4XYMA 1Y5NA 5JATA 3JQQA 4R4JA 1P5ZB 1J2TA 1Q11A 3IT1A 2OUIA 1AKTA 1OGYA 3CUUA 1EUCB 3F46A 4QELA 4Z5XA 1WVIA 3C85A 4ARVA 3V97A 2AE2A 1VFPA 3BERA 3AEKA 3VQTA 3W7VA 5AUOB 2H59A 4QRDA 4W5OA 3SFTA 4HDAA 4PNZA 1VG0B 3U4HA 4D25A 3PFHA 1I36A 4GRAA 4HQNA 2RHHA 1I0IA 4ZWNA 4ZCPA 5CLFA 3P71T 4OU4A 3ORYA 1G21B 2JLQA 1IVYA 5HE9A 3A6ZA 2AKAB 1GU1A 3BSYA 4MR8A 4ARZA 4DCJA 3ER9A 2PAAA 3KT6A 2QYTA 5C5DA 1L5YA 1YDEA 2RAUA 3L05A 1Q15A 2WLTA 1H0RA 2DFTA 2O6LA 5FP0A 2OYRA 1L8LA 1YRLA 3L6RA 2YFHA 4BNYA 4EUSA 4B0PA 2PE5A 1YB6A 1JIQA 1M2OA 3QIVA 4IUBS 2YWCA 3Q7EA 4NHEA 4MWCA 3IV7A 2QRUA 1X42A 3ET4A 4ZYWA 4ZZIA 3QV2A 2GLUA 1GXSA 2D7CA 3H5IA 1U6KA 4R9NA 5LDGA 1KQNA 4BJ3A 4Z51A 4A16A 2FN4A 3FVWA 1LQUA 2HBRA 1EFCA 3K9QO 1XC7A 5GMOA 3RSLA 3H4VA 4KWHA 3MRSA 3WYFA 3PLRA 2Z6AA 2IDMA 3AHFA 4TWBA 4WCFA 5BN3B 4NPAA 1P39A 3ZBQA 1FP1D 2WJWA 1KSGA 1EVKA 1THTA 5KOJA 3NHRA 5KTNA 4E0BA 1PL7A 1BFDA 3DZHA 2ID7A 2TMKA 4G97A 3EK2A 2C8VA 1OH7A 2WJ4A 2AI2A 4OI4A 4IG9A 4AN4A 4DCPA 3NH6A 1E63A 3MJFA 4RD0A 2AL7A 2BGLA 1P0QA 4CN9A 4DZTA 3H2ZA 2VHTA 1A8QA 2O2EA 4BVFA 2HFKA 1CUXA 4UD6A 2BFPA 4GOXA 2Q5IA 1EUQA 4QQRA 3OE4A 1E1DA 3H9UA 5KX5A 4HDRB 3RUCA 3U3KA 1EA7A 3M6VA 3HR4A 3TW8A 1QKIA 5DTMA 3AF6A 4FYYA 2H18A 1OCEA 3M1YA 4ZT5A 4U6SA 3N2IA 2XXAA 1MO6A 1EB9A 5JRDS 1U6JA 2JVJA 2I6SA 3WA6A 4ZVUA 1IOLA 2WKWA 1U8TA 4LDRA 1DJPA 3MW8A 5AVZA 1F1JA 1DT5A 4Y2PA 2CB0A 3HWSA 4ZO6A 4A5SA 3SKVA 4NU0A 2BV3A 3TXAA 4E5YA 5BWMA 4LJ6A 1NSTA 4QQKA 4YCJA 5FA8A 4S24A 3N28A 4CDNA 3C6KA 2YQZA 1P8AA 3ETHA 3OPYI 4L9SA 3H1EA 3JVVA 1XNJA 4QPZA 3CIFA 3PDIA 2P9GA 3M4ZA 5EVCA 2BT4A 2BR5A 3BD9A 3PEWA 4AQ7A 1ZO8A 2JI7A 3D7RA 3R7AA 5L3SA 3K0CA 5DJ5A 4HNHA 4EBBA 3WAGA 4DJFC 3U37A 2W98A 3C14C 4FEYA 2WWXA 1DJLA 1ZH6A 2PX2A 3DEYX 2FJUA 3LKVA 3R3HA 3RUEA 4DJJA 1PR2A 4CLOB 2W8ZA 4K3UA 2EQBA 2FSHA 2JGDA 4MITA 3JALB 4P2GA 3TOSA 4PLZA 4FQ7A 5KVVA 3IHTA 1J42A 1DIHA 4FW8A 5BW8A 1GAXA 2O8CB 2EZ8A 1QGYA 7REQA 4MQBA 2O8FB 3OMWA 3LFUA 2P4HX 1JU9A 2HZ7A 2WSBA 2YS6A 3IBTA 4G25A 5A4KA 4E70A 3E3AA 4JL6A 4DWJA 5K3OA 1OB5A 4BAGA 1FVOA 2P90A 2HMVA 3GFBA 5I9MA 3RUPA 3SEQA 3NHKA 3RS8A 2GBFA 5GJCA 1RJFA 4A8TA 1JQ3A 1U2QA 1WEKA 1PK8A 3BCRA 2WK1A 3CHYA 3CXUA 1FU8A 2AMYA 2DUJA 3D54D 3H2YA 4D41A 2IEZA 4E11A 2GO1A 1CQZA 5IK2D 4AWBA 3FF4A 4OHWA 3PHBE 1GFWA 5I7AA 1WXDA 4E03A 3M6LA 1O6GA 4GUDA 1KC3A 3TPFA 3V1YA 4EEXA 2YOGA 2PRJA 4L7VA 3OPQA 2R6DA 4Q7EA 3CLUC 5JRJA 1RPJA 4YREA 1XKXA 2VH1A 3FGPA 3SZMA 3TQSA 2NSYA 2OAEA 4I1UA 3TSAA 4WWHA 4OI2A 2A3RA 1W49A 1UAAA 4AWAA 5JTUA 2WY2D 4MXDA 1AXRA 1ZD9A 3CY6A 2A9JA 4NU8X 1SELA 5ALLA 2C99A 1WJGA 2QRZA 3CO0S 2WA2A 2BKXA 3HYRA 3HPRA 1A8SA 4RZ2A 2O2YA 4V1CA 1IHYA 3VU9A 2QAJA 4JAVC 3WL8A 2NXWA 2AW3A 3M3HA 1DX4A 4TN5A 3L4JA 4EEZA 5K2MA 1UKBA 1GUAA 1X77A 3H11A 2XQJA 1KTVA 3HNOA 3P52A 1WOYA 4IP0A 4J7UA 2CBZA 4QUBA 4UKDA 1VM6A 5ECDA 4C03A 3ADDA 1YFZA 1D07A 1H2AS 3UJ7A 2WPDD 4JZKA 3NVAA 3K2EA 2M1XA 4F84A 4MQUA 5JPCA 2KBEA 4CV2A 3E5HA 4B3GA 4BBZA 4HL6A 2QE7D 2XUDA 2GN2A 1ACLA 3WKDA 4P4GA 1PJLA 4OJKA 4MK4A 1IQRA 5GM1A 4ZT4A 3VH2A 2JVIA 3I8OA 3O4IA 3OIVA 3GROA 5IT9A 1ZGBA 2BFEB 4JJZA 5ENDA 1M7GA 2QPOA 2XD9A 2VSYA 3OJCA 5F23A 3AIIA 1YJ8A 1TCVA 4YJ2A 1QVWA 1P2GA 1KH2A 2JIBA 2XHZA 3GJSA 4MUBA 2FW1A 2HPVA 2XUAA 3Q3JB 5AKKA 3BFXA 4JLJA 4RLHA 1XZHA 4F21A 3RIMA 2FV8A 2C5AA 2X76A 4IIXA 4XXHA 3ZN2A 5BSWA 1L7XA 3Q5EA 4L5JA 3VVCA 3GQVA 2VQ3A 4K05A 4KCGA 5AVOA 3BA6A 1XVUA 5I7WA 4DTIA 2J48A 4REQA 4XD7D 2W58A 4R0NA 5JAIA 3O1IC 3R41A 3SF8A 1VL2A 3B2NA 3KQKA 2O8BA 3BH6A 3BMNB 2X0EA 4CKBB 1PEYA 3B82A 1A0OA 1S6YA 1QFJA 2P2LA 1C9MA 4IXDA 4QTUB 2IXGA 4J0QA 4TTVA 2ZLBA 4JJEA 1OYYA 3A2KA 3ICQB 3Q6NA 4KVFA 4TQAA 3R7FA 4D3FA 3AVPA 4Q9HA 2XDYA 4XVQA 4XDGA 4AJLA 1J25A 1WR8A 1YKGA 3L6DA 3EXHC 1MLDA 3WLSA 4DXHA 3OY2A 3JAWA 4BEVA 3EVBA 4I7EA 4INPA 5A6SA 5SY9A 3PXEA 1JFTA 1AQLA 1FJ2A 3CKMA 4FOPA 2RBGA 2C31A 1NLFA 1NF3A 4FHZA 4XRGA 1ZHOA 4I3FA 4M4SA 1TIBA 1PUJA 3EGOA 4U7FA 4KQ1A 2DCUA 4YIKA 3U7RA 5K2OA 1C3OA 4HBZA 1EUDB 5H70A 3SYMA 4MV7A 3P2EA 4XX0A 1RLMA 1ILEA 1XTBA 2IKQA 1OASA 3B51X 1NC1A 3BIJA 3M5DA 3PFFA 3ZXUB 1JR2A 1QQ7A 1V5GA 1XLUA 2RHTA 3ZKWB 2P9BA 1PQWA 1CQIA 1PT7A 1DKNA 3UCEA 1A9RA 5FWYA 3GOQA 1P4SA 1G3RA 2Z4SA 3U1BA 3PP8A 2W2NA 4D0LB 4PRKA 2HEGA 1SBYA 2YWRA 4QATA 3FX2A 3GBVA 2GZ2A 3ML1A 4AKTA 1E94E 1E4YA 4PY2A 1MF7A 1XQYA 3E5NA 4NK4A 2R6ZA 1M8JA 1RZ3A 3TZLA 1L5LA 1XQWA 2ZRGA 1W5SA 2QD3A 3N2GA 1XDBA 1EJ2A 2ZR8A 4ZDWA 1LS1A 1U2PA 3AR4A 2ZJZA 1MB0A 1A2QA 2IUYA 4OBWA 5KYUB 2C2WA 1OV6A 2HMAA 1RAIA 4YT5A 4B79A 4DF3A 3D3WA 3ND9A 4C4XA 3I37X 2YNMA 3KB8A 4WBNF 4TWRA 1RHQA 2X8LA 3UV7A 4L50A 2A5YB 1YI8A 3Q7TA 2DBQA 3EIWA 1DIBA 2ZEJA 3MUEA 4GM4A 3WGZA 2YJNA 1AS3A 1ISPA 4M9UA 5A5VA 2XCSB 4E31A 4W5QA 3OZRA 2LIVA 2VHYA 4AM8A 4DUGD 3GJ5A 5CFOA 2VYQA 3MWKA 3QFHA 4UBKA 1KVTA 3C4VA 4GRIA 4I6GA 4WBNB 4S1PA 1OAOA 4D3YA 4K9RA 1JKMA 4BASA 3VH3A 3O8BA 3VDQA 3GPLA 3S2GA 2PLWA 1NOIA 5EE5B 2WSLA 4WEOA 2VLIA 3Q9NA 2C94A 4XGNA 3LF2A 4YAUA 3H9CA 2F1OA 2ZS8A 4K9KA 5AW3A 4GZ6A 3C1TA 1DAEA 2PKYX 1M72A 1T26A 3OU2A 1J00A 1ETUA 2B2NA 4Y2JA 4CL8A 3MJEA 2R7NA 3BG5A 1P4AA 1X9HA 3REGA 1DKMA 4Q9IA 2JDIA 5HBRA 1Y9DA 5CIWA 5AXBA 3GEPA 2R1TB 1MB3A 2QX4A 1JR4A 4S2UA 4HTFA 2OGTA 3AB8A 5EERA 5FBZA 2FPUA 3IVMA 5GV8A 4N5HX 2FX2A 1B0ZA 1P18A 4YNBA 5CDYA 3FSRA 3M6WA 4JCOA 1O03A 5ALDA 3ROXA 3ZV4A 4K9SA 3PIDA 1UT6A 2OL4A 3AT1A 1K9VF 4XIJA 4BNFA 4ZZ1A 1Z63A 5FUQA 1YMVA 3TX2A 2JD1A 7YASA 4HEA6 3OAAA 2Z5GA 2B5WA 1KEVA 2G80A 2PG3A 1SUIA 5ALVA 1ZD3A 2BKUA 4P5EA 1PD0A 3I42A 1AGNA 4I50F 4WT7A 1IHDA 3JVUA 2FG6C 3R7DA 2ZYHA 4CDRA 1BXRA 2RGXA 1JJIA 3WBKA 4IHKA 2YIDA 4F5DA 4L76A 1AQUA 3IRVA 3RU3A 4HWKA 1S89A 1IN7A 1OZGA 2J9FB 2PZAA 2JLBA 1ZGZA 1ZM2A 1ST2A 3CLSD 3RRJA 1VL6A 1H2FA 4XZ3A 4JUAA 3L7OA 3IEKA 5CHYA 1QNLA 1Y1SA 4I50B 2P3QA 3L0BA 3WGNA 5HHTA 3RRMA 2UAGA 5ES4B 4PSDA 3T4UA 1ZBDA 3NNSA 4O4LF 2LBPA 3NT4A 4PCUA 2BEVB 2WINI 1Q77A 1SOWA 2H4ZA 2VRBA 3AINA 3B3GA 2E4AA 3P9KA 1XQ1A 4G56A 3TTTA 2N1BA 3ITKA 2H1HA 3LDAA 1N0VC 5DLPA 1GRCA 1G8KA 2FFBA 2RK6A 9ATCA 4HN9A 4CKEB 3UHJA 2V45A 3UMBA 1BGWA 1PGPA 4XSVA 2OAP1 3B20A 3PPIA 4JS0A 4OLAA 5BN5B 2FXIA 2P27A 5IKEA 4O4LB 4UBMA 4BS9A 2R5NA 2BOVA 3R6WA 4O1IA 5E95A 3FDJA 3LIPA 3WOVA 4D98A 4J90A 4XYLA 2YN0A 1E5VA 3FB1A 3WRYC 2VL7A 1YQWA 1OY1A 2IX9A 2Q6OA 2ZYGA 2ZROA 4LISA 3TAUA 4AIIA 4R2MA 3A4VA 2XH8A 2G82A 2OG1A 3AKCA 4PSVA 3IO3A 3MTIA 2WWGA 2BGTA 2JRCA 4BL5A 1NASA 4J1TC 1KYIA 4BMNA 1RBMA 4RGBA 4ETNA 4B3FX 3I8SA 4V0RA 2BF4A 1XGKA 2HPAA 1CZLA 3LZCA 4MMZB 1JRLA 3WRVA 1II8B 2Q9BA 5K20A 2P2ZA 4QPDA 1E1RA 3HSYA 2ORYA 5AVXA 1E8MA 5F5NA 2VQFB 3KSZO 2GD2A 3AUYA 3IAHA 3ZE1B 2N46A 1FNDA 1XSEA 3IUPA 5AJHA 4MRPA 3P96A 1IZ7A 2ISCA 1BZYA 2VP9A 2ZRIA 3GD5A 4PLPA 1ARZA 1IVNA 1PQYA 4JI1B 5CA1A 5M04A 3NUGA 5F3WB 3IE0A 1FUKA 2P9JA 4MVJA 1R0KA 3KQMA 2V4UA 5IANA 3OMXA 2RB5A 5F3DA 5ETJA 2I87A 2GN4A 1Z75A 3PQ8A 1C2YA 1HRDA 3RRNA 5JZMA 2F4VB 4CEJB 3G8AA 4NULA 4OMCA 4Y7CA 3RJMA 3QTBA 5DBEX 3PE3A 5I4KA 3NAGA 4B48A 5LMUB 1E1YA 2CW5A 1Z13A 4H7IA 4LHZA 4C2BA 4BJ5A 1RI3A 4R2XA 4DG9A 5KNBH 2G6TA 5D87A 1DQPA 1Z2EA 1Z6XA 1MDBA 3AJDA 3OEEA 4LQDA 1VYUA 2DF8A 4P53A 4QTXA 3HKEA 3WL3A 4A73A 1ETHA 4ILEA 5AICA 1E6LA 3CEJA 2PFSA 1W0JA 5DM1A 5JMPA 4ZK2A 2FTKE 5J4LA 4P3PA 3PJFA 5C1IA 2GPNA 4QXPA 4IOKA 4CU5A 4KUHA 1F2TA 1GP2A 1C1XB 2PD4A 2HPZA 3CF4G 3FCAA 3KTAB 3QX9A 3R3SA 5DIFA 3P19A 4XSHA 2O3SA 3AR7A 3WYNA 2XE6A 2ZAGA 3ABOB 4DL9A 4KFRA 3NETA 4H27A 4TSKA 8AT1A 2QLLA 2R85A 1LJ8A 4RZXA 4YACA 3NKVA 7MDHA 4XB6B 4WKGA 4LF6B 4UD2A 1QP0A 1MAAA 1DAMA 1H9BA 5KNDA 4I4CA 1FDIA 2YVAA 2AJCA 4ZCRA 2J5QA 1G59A 1HM5A 1H4TA 2UYCA 3IIMA 5JNRA 4M1EA 3E22B 2Y1LA 4D99A 4EA8A 4B6JA 4NBKA 4EF6A 3NEYA 1TI7A 1XDGA 3GFGA 3SNHA 4D9NA 2F8LA 1SA0A 2VYND 4TKLA 1PUIA 4WZAA 1L4KA 5CH8A 4QYMA 1W4LA 5U1PA 4AJ4A 4G1UC 1E0DA 1W2HA 5DYGA 4MVJE 1CU1A 1F06A 1PE0A 1SOMA 5K0JA 1AF4A 3ZGNA 3AL2A 2YV2A 1H1DA 1AZLA 3EVFA 3FROA 3QYJA 1SXJB 1L4BA 1WP9A 4TLDA 5DXAA 4LF8B 2A9PA 4BWVA 1JW9B 4TUYB 1Z08A 2IU0A 3K20A 3R40A 2W6IA 2CLMB 3IAM1 2QHXA 3HJTA 1U9ZA 4WW0A 5EHQA 4YJGA 4YPFA 4A82A 4QDUA 2PAFA 1V1MA 2QVCA 3FF1A 4CMIB 3HYTA 3L9WA 3PKJA 4EMSA 5LQNA 2FLWA 1IC6A 2PU5A 1WXFA 4CQMA 3W9BA 1AMNA 4G0WA 4ZYXA 3LWDA 4FHFA 4K46A 5FPPA 3FNEA 3MS4A 3SJ7A 3V1MA 2H31A 4M53A 3E9CA 3WL5A 1KNXA 4M0MA 3NYQA 1R8QA 5KX5B 2C2HA 5A4MS 4YRZA 4KOEC 3JPYA 4GSLA 3RYFA 5LIPA 5EXPA 2OP0A 2V7QD 1DQNA 4U00A 2RH9B 1P1HA 4V39A 2GN1A 1WMSA 3ESZA 4LBVA 2HIAA 1GL7A 4E22A 4MQFB 1P1CA 3IQIX 1ORTA 2CXQA 1W1UA 4U2EA 5CLHA 4DDMA 2BVNA 4OEHA 4LRUA 4EKGA 1MIOA 3DZBA 4L4UA 4N49A 4Q19A 3AP1A 1CUSA 1YHNA 2D1TA 4KPUB 4QYIA 4JQOA 4PIPA 4ZEXA 3RAJA 3WDKA 2HSWA 3KHSA 5ECYA 5EPOA 2O5VA 2ZUSA 3WS7A 4C2UA 2VZ8A 4G8DA 4TQGA 2N0SA 1SUBA 4FYKA 4WLOA 3WGQA 2PA3A 1P4JA 1NVMB 2O3QA 2OZEA 1UBUS 2PANA 3LX8A 4XWKA 3L02A 3SM3A 4JJ8A 1K4YA 5EIBC 1LBIA 4MYHA 2BTQB 2P2GA 3SEZA 1OAAA 1ADYA 3HEBA 4JENA 3ELDA 3QJYA 4HI0E 3H7AA 2JAHA 3KJHA 1VLVA 3FYHA 2QWXA 3ETGA 4GZLA 4UMVA 1TPZA 4WI1A 4WZAE 4N0EA 1COZA 4B33A 3BRCA 5BWLA 5IKPA 4OUDB 3GGSA 1Z3CA 4M0DA 2FPMA 5ED4A 2VPYA 5ES3A 1FSZA 1XTSA 3C6ZA 2WU0A 3V8RA 1G5RA 5CX1B 5ESRA 5L3ZA 4DSZA 1WUIS 1STOA 3V3KA 2DWCA 2ZBDA 3CJQA 3EGVA 2QE7A 3ETCA 4ND2A 4TOIA 1E89A 2AWNA 3OJFA 4YUXA 5BSEA 4ZOBA 3QPVA 1HOTA 5HYVA 1NQAO 2D1SA 1M76A 3DHNA 4DIEA 1GUDA 3TL6A 2CVPA 4B7UA 3U4MA 4MULA 4UU8A 2LDXA 4Y9RA 4YECA 1AKEA 3LWNA 1SOAA 4PHHA 1ZRNA 4BQIA 1WA5A 2C3MA 1Z83A 3QVVA 3R9XA 3ZK7A 1NFFA 4ZK6A 3RGWS 2ZUDA 1KF0A 3DULA 3B13B 3F8WA 4RBNA 4EPRA 4XLLA 4P31A 4JLWA 3PGJA 3OZGA 3ELWA 3BJRA 1N5MA 1NF2A 1P7PA 4QICA 1PW7A 2CV2A 4PS0A 5KU7A 3GQBA 2PIAA 3H3XA 2C8KA 2JHCA 2IU4A 4IEFB 5EGSA 3VHLB 3UGJA 4IDGA 4WKCA 1DEHA 3E0QA 3IVXA 3TVTA 3T94A 2ZPUA 1L7VC 2G5GX 3AUSA 2EBUA 3EIUA 1T3TA 2B37A 3HXPA 4FK8A 4MYUA 3V4FA 1O4WA 1RTTA 1TK3A 4O0LA 1TM7E 3DL4A 3SDSA 3T9DA 3M5CA 2DTEA 5FO0A 1ZNZA 4XQ0A 3D4LA 2LD4A 3VVBA 5BUCA 2YVQA 2CJPA 3B1VA 3NIWA 4O4IA 4Z54A 4KAAA 2GO7A 3I2KA 5DU2A 1UDCA 3ZLBA 2KS6A 4QWWA 3SEFA 1VA4A 3PWSA 5AW0A 1MT0A 1O89A 1U2ZA 1VG1A 1NJ8A 4YB8A 1XJQA 4B3RB 4NENA 3F49S 4ESHA 3U3RA 4WBNA 1Y33E 5HX7A 4ND8B 3GLHA 1IVSA 2I55A 3KYJB 4ASUD 4GXNA 3GB9A 4UTPA 2IPOA 2J7KA 2PJUA 2WLSA 4GXRA 1JDUA 2TMDA 3ANNA 3JD3A 3QUBA 1JEQA 3JYNA 1EVIA 1P44A 4Y2XA 3M82A 5K1ZA 4JP1A 3R3JA 3TEJA 1XL0A 1Q7BA 1PNVA 3HN6A 1CUGA 3GPDG 1ZNWA 1YU9A 1V43A 2HF8A 4P0TA 4Z9XA 3S7ZA 1YL6A 2PX3A 2ZRJA 4KITB 3DVAA 3VR2D 2C1EA 5A4AA 1ZK1A 2GTIA 4CDMA 3HSKA 1Z38A 4EVIA 1Z0JA 2PLFA 4RF4A 1RLOA 4KDFA 3P2IA 2RJOA 4ZAXA 3Q8XB 4RJTA 3PEVA 3G9UA 3GFPA 1N8KA 4FFWA 5FOVA 4PR0A 4EHIA 3TSCA 5AUPB 4K9QA 3TQCA 4B1FA 7GPBA 4E5SA 3DLCA 1VJ0A 4RIHA 4EHDA 1TVEA 3RYHB 3IOCA 3I8XA 1EFKA 1MTZA 4GP9A 4Q03A 5CPBA 1HV8A 1YDHA 4MHOA 3PFIA 1JAZA 4RULA 1SIUA 2LUOA 3A6GA 1UXGA 1R0CA 2D8MA 1DP4A 2Y1KA 4BLRA 1XBTA 4BQSA 2Y99A 3UMSA 1XA3A 1AQJA 4JYZA 2VYCA 3NCTA 3ICCA 1NLMA 2JGIA 1H4SA 3R3VA 3D3NA 4ZJPA 1D4FA 4TTRA 3IURA 5JJIA 3MHTA 3ZQ6A 5H4GA 1RHMA 3IAXA 4TM7A 1JHZA 2EJTA 3B6MA 2CJWB 3AIMA 2IUEA 3C7AA 2HT1A 4X91A 1B3BA 4YDRA 1H23A 1FS4A 2QIOA 2NU8B 3K53A 4IJKA 3N5CA 4OXNA 3NDRA 1KO7A 3GLHE 2JJ2D 1RPTA 3H8JA 3L7AA 3PA6A 2X7HA 1PJCA 1OTHA 2ZSKA 3CNNA 4I1YA 3SOZA 3ZR4B 4C1BA 2IDJA 2OILA 1X92A 4KH1A 5A7HA 3SXUA 1BMTA 3GLSA 4YJHA 5K01A 1P31A 3FMIA 1D5WA 4B5LA 1EQ2A 5G1NA 5BV0A 1VP9A 2P69A 3S5UA 5IT0A 3BT7A 1BCRA 3WQSB 5HZGA 2Z8YA 3KEOA 2YRWA 3WK8A 4Q7KA 5FXMA 4B4DA 2CMDA 5THXA 1EDZA 4HVTA 2VJCA 3ELYA 3JAKA 4IZHA 3T3DA 3MBOA 2AOVA 2FMXA 1PFVA 5C8YF 4HO1X 1ZK2A 4LJ4A 1UL1X 4YCAA 5IBRA 3UO8B 1F51E 1JWAB 4MQ4A 4IV8A 2XOEA 4YQFA 2AK2A 2HX1A 2YW9A 1X1TA 3I4FA 2W2KA 3KSDO 4UTXA 2D0DA 2XNHA 3U4AA 3N05A 4QJ5A 3DUFA 1WW8A 4BWYA 1XU7A 2F3PA 1WL8A 2PGDA 1UADA 3A58B 4ZV7A 1SCDA 1XRJA 3AR9A 5TX7A 5JANA 4IH1A 1E9BA 2Q6LA 3AM5A 4LDQA 3B7GA 5DYWA 4EUFA 1ZD2P 3STWA 4QLOA 4JQCA 3ILXA 3IC5A 4LJ5A 4ABTA 1KPHA 1ONBA 1GV0A 3LU1A 3QTTA 2QRVB 4G4JA 2WAYA 2D1RA 4KKVA 1UBNA 3U62A 1FRVA 2QTAA 5AXCA 5WRFA 3RS0A 1BW9A 3A1VA 1KE2A 3E23A 1JG3A 5ADVA 2CEAA 4DJEC 2R7AA 4MR7A 3EBOA 1DCKA 3R5TA 2VR1A 3P9NA 5T5QA 3BIOA 4V38A 2VTKA 1D6NA 4LJYA 3VZSA 4BX3A 3EXHA 3HUTA 3O4FA 2HD4A 3DV0B 4YMLA 4UZEA 3NPAA 2L42A 3L0CA 4TV9A 4PCVA 5DNCA 5CVEA 1T91A 1N5DA 2AH5A 2GD0A 1T9GR 4KBGA 4TVKA 4Q4AB 2PO7A 5IT5A 4S1VA 4NJOA 5CFZA 1K3TA 5KYYA 3I61A 4HGPA 2ZSFA 4GPEA 4BMYA 3AJRA 1YXMA 1D6JA 4YPOA 2RGNC 2B4KA 4R5MA 1QYWA 4RPCA 3ZCVA 1KZ7B 4CL2A 1BH2A 2QN6A 4JC8A 4XIYA 8ATCA 1YH3A 3HVRA 4DCMA 1A9ZA 2IYYA 2VDWA 2VSFA 3UJHA 5T57A 6Q21A 3Q2IA 4O2RA 4RD3A 4R1PA 3AHDA 2GZSA 4RA9B 2GN8A 1L5OA 4HRXA 4H31A 2ZI9A 3H5AA 1C3JA 2QRPA 5AJZA 3MFYA 1NVDA 2QRJA 1Y98A 3B3AA 1OA1A 1S2MA 2HA2A 4L0QA 4HFJA 4Q7JB 4DNXA 5F1KA 2PX0A 3VRHA 1T13A 4HDOB 5BN4B 1EWRA 1KQPA 3I6YA 4NOLA 1O9HA 3F4LA 1C3VA 1WZNA 3ZWYA 1F20A 2E21A 3BSFA 4EVSA 1T9GS 3EA0A 4XGQA 1IJBA 3MG9A 4LZPA 2IZ1A 2GBLC 1AOXA 1PWHA 3AUTA 4XVHA 4N0QA 2HJVA 4ZI7F 3ZZ1A 4BJ6A 3ES9A 4V0OA 5I3CA 4RK7A 3L01A 3T41A 4KFSA 2QYOA 2G1UA 5AW9A 1Y4DE 4PBSA 3N7TA 2VBFA 3CVYA 2VLBA 1LDEA 4K88A 4P54A 1KR2A 1PNQA 4ZCQA 1AHNA 2ODEA 3HZHA 3MT0A 1JLRA 2VOJA 1W87A 3PYXA 4ITVA 2YHBA 2LCQA 1W1IA 3WGKA 4D44A 1RABA 4ZI7B 4LF9B 4HQLA 3C48A 1DG3A 1W9MA 3EISA 2JD0A 4QUJA 1MV5A 1LBTA 4J7XA 1K8QA 4UHEA 4JNKA 3TAHA 4MPJA 1E9EA 3AU9A 2QRNA 4FZ5A 2FZWA 5CG1A 2B20A 3HCEA 1XTQA 4X45A 1I30A 1LV7A 1JEYB 1H3EA 1QYXA 5B58C 4FW9A 1EAYA 4HXYA 2IOFA 3GGCA 2DPMA 4TQ9A 5L6MB 2VRCD 3LY7A 1XKLA 3NIFB 3CX6A 5TIIA 3BTVA 4J1SA 3KQPA 5F64A 4RJKA 3ER8A 1YOVA 4G07A 2G9VA 1QMPA 2RCNA 4W7SA 1ODJA 3TZBA 5LVAA 3LYAA 4UDXX 2IYFA 4W5WA 3T1NA 3H3JA 1NXOA 1Y9ZA 2K7ZA 4WEQA 1K7YA 4I55B 2OAQ1 3FWHA 4YK7A 5D6OA 1GTJ1 1LTHR 1O96B 2GTHA 1ZK0A 5CGQB 3SG0A 2G71A 4AL4A 2C5HA 2Q2QA 4LWZA 3TCKA 1PEAA 2R4TA 1Q12A 1WDWB 4HT3B 2OCIA 4TL8A 1L7BA 1NRWA 2XYGA 1CEQA 3K8YA 2QM0A 5HP4A 3IQHX 1BFKA 1QLHA 2OVBA 3QA9A 2PWZA 4LYAA 3DKVA 1A3CA 1Z39A 1J7JA 5B30A 2BLLA 1M8GA 2K5UA 4PC2A 4X7BA 4Y2HA 3LKBA 4U3JA 2VT6A 4Y1EA 4EQ6A 4BEBA 4O4HA 2H7XA 3IBGA 1N2CB 621PA 3IELA 1GRQA 3D6HA 4LXTA 3KM0A 2OGWA 1T43A 3RANA 1NAIA 1SD5A 1ZI6A 3BULA 4PEVA 5CJ2A 4RQAA 1BE6A 1UM9A 5FAKA 1CFZA 1D03A 4O29A 5D6NA 4MPTA 3V4PB 4F4UA 3WNBA 2B8NA 4Z49A 4J3JA 4EABA 3BJEA 3HCBA 5HIJA 4G24A 3KQVA 1SVKA 4FYXA 3DTTA 4EGFA 4GBJA 1PSWA 4HLUC 4BFZA 3PPWA 3I5MA 4X9XA 2FW0A 3D8HA 1U8ZA 3OTHA 2RI6A 4LZNA 4BLTA 3ZYZA 4ETWA 1N5IA 3ZUGA 2ZR0A 5H83A 3L84A 1Q6ZA 1Y6RA 2R8RA 2VJKA 3GFVA 4MH0R 3I52A 4I08A 1X1BA 3MPUA 4RX1A 4H7EA 4YRCA 4D9GA 1NN0A 4MLDA 3A6EA 1U9JA 4KSCA 1F4LA 4OOFA 1FIUA 4PNPA 4I1OA 3OBIA 3PL5A 2OCGA 1YZYA 2X0DA 2XCRB 3CR7A 3C3WA 3TGWA 3D2CA 4OXXA 3WB0A 3WRYA 3JWEA 4PYRA 3PEUA 4C4TA 4AY2A 3S0JA 3KAQA 3GOHA 5I8WA 2REXB 4GVPA 1GPLA 4CF6A 2WQ6A 1ABFA 1N0WA 3CH5A 2ONCA 3CF2A 5C5IA 2W2QA 1WUJS 1RZRA 2UUBB 2I6TA 2O57A 4J1TA 1F5NA 2GWHA 1HT3A 1AXGA 2QP3A 2YHAA 1QE5A 4FR5A 4ER0A 3MOGA 1UZNA 3PDHA 4FJ2A 2GERA 5JPIA 4ZEMA 1N7JA 4PAQA 1CS4C 4U4AA 3TJMA 4FVTA 1QZZA 1A2BA 3NHUA 3WK6A 1I5EA 4RPLA 1NXVA 4MB6A 1BOOA 3UB2A 2HQBA 2P2YA 3JTEA 4JT2A 2HPHA 3D7MA 3N9IA 3BHMA 4V0MA 5D84A 4NBNA 4XIGS 4QPNA 2LCFA 2OWDA 4PZ9A 3UTCA 2A0UA 1TT7A 2OFWA 1FRQA 2GPSA 3FY4A 5HIKA 3NAQA 4Y9UA 1MX9A 1V3QE 1EHIA 4GLOA 2YWEA 4V3BA 1G5PA 4RWZA 4ETIA 3DAOA 4YONB 1QHXA 4IYRA 4V02A 3LUHA 5FPYA 3UF0A 3WHLA 3EQ6A 2O0KA 3OFJA 3FPAA 3KZOA 1Q1BA 2FH5B 2GZDA 4HFMA 3KFLA 3PWTA 3U7IA 4ZO7A 3F6RA 4ZANA 1KPIA 5CB6A 4DT1B 3A9WA 5C46F 2L18A 2QTTA 1F8XA 3OLXA 4NYJR 5FWNA 4ARIA 3OTWA 3COWA 4P5DA 2WAAA 4X20A 2DHRA 4ZODA 5FYDA 2CJFA 4DA7A 1HT1E 2A9VA 2ATCA 5JY6A 1BVYF 1RD4A 1PZNA 4YA6A 4MV5A 5SZJA 3UG6A 4B80A 2EW2A 3VVLA 1PGJA 3CQ9A 521PA 4DHEA 5AIBA 3ZKWA 4O25A 2PVCA 2DKFA 3GAZA 3WNVA 2Y0DA 4EW2A 4RY0A 4MS3A 1KI1A 2A94A 2WHYA 1TIKA 3EXIA 3UK2A 4Z2AA 2DFKB 2GCOB 4GW3A 3KQNA 2GAFA 2Z6VA 1QAMA 4PXAA 5E1DA 1QPBA 1YFKA 2ANBA 2FDRA 3E3OA 3QVXA 1KYWA 2H00A 4XYBA 2JL1A 1J2YA 4HF7A 4B2LA 5JALA 3V4RA 4NI5A 4NBVA 1FNSA 1DQRA 2VC2B 5EI5A 1E7RA 1NU6A 2DAPA 3ASYA 3IUSA 3FOWA 4Q3DA 3ANLA 3GFQA 4B0OA 4OQLA 3PL1A 2MSKA 4OP3A 3ASVA 4I5GA 5AM1A 1L5HA 5CAEA 3ZY5A 1XDWA 3TE7A 1ZLYA 1Q7RA 3WKCA 1OROA 1NQTA 1FVXA 2QD2A 3T7SA 2IPAB 1DTEA 4E7OA 1WHTB 1Q2UA 4FLEA 4RV4A 1SCBA 4OHYA 2G25A 3DWEX 1W8IA 3T12A 5DE3A 4HXEB 4O63O 4V0ME 5EJMA 1PNOA 4AK9A 1WXQA 1D3AA 1P4HA 3GEDA 4DR5B 2AXQA 1WV1A 3RAEC 1UODA 4YV2A 4FE3A 1CTQA 2ZWVA 1PV1A 2J59A 4LMBA 1X9GA 2CCJA 2OHJA 1JHYA 3KXPA 3A9CA 5CXSA 4YH1A 3C5WP 4L8LA 4PZAA 4UVIA 5EMNA 4MYSA 4ZCSA 3QVMA 3ECSA 1RKVA 3MIZA 4QUAA 3VNQA 1H85A 1NYQA 1U11A 2FRXA 3VPCA 4XTRA 2C2BA 3CA8A 1XTPA 2VUHB 3TAXA 2QMQA 1EK0A 3JQGB 2J33A 4QPPA 4UHBA 3AUAA 2KWIA 2ZT8A 4WXHA 5JNLA 3I2YX 1AZWA 4MV4A 1OBFO 3KOXA 3TUJC 3VR2A 1KZ1A 4O59O 1MQSA 3ZYCA 2P5UA 3W7BA 3PNVA 3A9RA 4J03A 2Z6UA 2KI5A 2PKXA 4LGYA 1A72A 3S2YA 1KQOA 4KE9A 3STVA 2PCLA 4S0XA 4HVCA 2G70A 1HTTA 4MR9A 5CCXA 1YZGA 3H1GA 1CHNA 2FWBA 2C4WA 3DBIA 3O4GA 1X70A 2Q5HA 4QRIA 2O2SA 4G1BA 4PCAA 1BEZA 1LFAA 1YE8A 4G86A 3FTFA 2V1XA 4K0RA 3FNBA 1CRZA 5JNWA 1DC5A 1N3LA 1NVWQ 1P91A 1WB4A 1XZBA 1JLKA 2VHJA 3H97A 1CX9B 3HXLA 4RC9A 2ZR7A 4UEQA 4NH4A 5DTRA 5ICCA 1LJUA 3M7IA 3I28A 3IKTA 1TJNA 4DA4A 3H4TA 2GVNA 2BHRA 1QANA 1Z25A 2CXPA 5I45A 5KYGA 3H5RA 5DF1A 4EHJA 1VYVA 1TYDE 3C5VA 3JQPA 1WSWA 3JSAA 5EHNA 4ZICA 2CFRA 3I5YA 5BV2P 3THWA 1G7RA 1R9MA 2IHUA 4U7TB 5B2FA 3Q7SA 2XZDA 4AG5A 3QBDA 3EDOA 3O2QB 1UM8A 5B6JA 1CS0A 4D7AA 4MRMA 1A88A 2ZWAA 1W5TA 3GRAA 1T0HB 3N8NA 1YC5A 2UZAA 3CIOA 3GU3A 5G4LA 4CKZA 3JVIA 3D3JA 1P77A 2INGX 4YALA 3KR2A 4I46A 4ZVPA 4DR1B 2G04A 3V9PA 1NUTA 2QS9A 1JYFA 1N6HA 2P78A 2ZP1A 4WXYB 2IU6A 1O2DA 4BFXA 3ZNQA 4E4YA 4EA6A 2XQFA 5EJ4A 2CLHB 3ZU5A 4URUR 3BZWA 3GDGA 4KYVA 4URZR 2WAMA 3MN1A 3RO7A 1KQGA 2AXPA 1PYOA 4K40A 2JEYA 4UTVA 2WVAA 3H6HA 1Z28A 2NOAA 3NORA 5KTTA 2Y0CA 2B3DA 3FTDA 5IBQA 4AS3A 1XQ6A 1VP3A 4OBXA 2PNFA 4TYNA 4DZZA 5EWJB 5THKA 2OMKA 3KTDA 4IFTA 3IB3A 3L7IA 3OPNA 4JJIA 3WL4A 3AKYA 2G5TA 3D7NA 4GKVA 4GMXA 4IHAA 1CVRA 2QLBA 2H2FA 5KTPA 2FP4B 2JFWA 2HNBA 4KQ9A 2HMSA 2PBLA 3WNDA 1OWOA 4TVSA 6AT1A 3ZE8A 2HUPA 3HFSA 5TQ0A 2ZWMA 3CVOA 1FNMA 1ZVJA 3D02A 1GFSA 4R1QA 2I6UA 1DQSA 3RIEA 3IIEA 4RD4A 5BSUA 2CGEA 1EHYA 5B53A 4C78A 1I33A 2J32A 2QUBA 4M49A 5EYPA 1FFXB 2EFYA 2ZI7A 4KOAA 4LOLA 2HI0A 3PD0A 3KR9A 4KTVE 2EJCA 4R2IA 5BY2A 2ZPAA 2A1IA 3PXAA 4TXJA 3F6BX