5JWOA

Crystal structure of foldswitch-stabilized kaib in complex with the n-terminal ci domain of kaic from thermosynechococcus elongatus
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
231
structure length
217
Chain Sequence
VKKIPTMIEGFDDISHGGLPQGATTLVSGTSGTGKTLFAVQFLYNGITIFNEPGIFVTFEESPQDIIKNALSFGWNLQSLIDQGKLFILDASPDPDGQEVAGDFDLSALIERIQYAIRKYKATRVSIDSVTAVFQQYDAASVVRREIFRLAFRLAQLGVTTIMTTEEFVSDNVVILRNVLEGERRRRTVEILKLRGTTHMKGEYPFTINNGINIFDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Circadian clock protein kinase KaiC
publication title Structural basis of the day-night transition in a bacterial circadian clock.
pubmed doi rcsb
source organism Thermosynechococcus elongatus
total genus 70
structure length 217
sequence length 231
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5jwoA00
1XNJA 3TR5A 5F2EA 3L0SA 5IRCD 4RJLA 4TLEA 3BB3A 2JLYA 4ZCMA 1TUEA 3EZ9A 5AJWA 1TNDA 1DG3A 4GNKA 5FUXA 4DSOA 1G8HA 1FL9A 4KFTA 4B74A 1DAHA 3OEHA 4A6PA 2GCPA 1NBME 1R0ZA 1KI9A 5K8UA 1OB5A 3K9NA 3QKRB 4X8HA 3TUIC 4N1AA 1PV4A 4TMWA 1TEVA 3V00A 2B6HA 2EFGA 3B9PA 1LY1A 4PC1A 2GEVA 3B1WA 4M9QA 4M1KA 5JRJA 1XD8A 1O87A 2QP9X 1BKDR 1Q22A 2QQ0A 5EZ6B 1TPZA 3BD9A 2CVHA 2GEUA 2VLIA 3OESA 1P62B 4KSCA 5FPKA 2ZVPX 4O2RA 2ERXA 3ZS9A 3L8YA 2ZVQX 3QKRA 2GJSA 2OV2A 4TTPA 2QG6A 1W1WA 5GVRA 4GPTA 2GXUA 1HT1E 3JVVA 4M1YA 4A2PA 3UWKA 4BUJA 1M1YE 4LBZA 4JL8A 1E4VA 1E2GA 1VCNA 2ZRHA 2LKCA 4NYMR 2HUPA 3GLFE 2XAUA 3IUYA 3LO5A 3REGA 1Z28A 3LQRA 1KSFX 4JYCA 4Q1EA 3R8FA 1OYWA 2GXSA 1HTWA 2GNOA 2QA5A 4FMDF 1XRJA 3WHKA 2NO1A 2XGJA 5HE8A 1T3SA 3RANA 1MO4A 3VKWA 4J0QA 4MYCA 1P4SA 4B2IA 5DN6A 2AWNA 2J1LA 2J46A 3DHWC 4Q4HB 2B21A 1ZNXA 2WAXA 1ZUNB 2BM1A 1FQKA 3RS3A 4UJ3A 1UEJA 4WW0A 4CEJB 4D25A 1Z83A 4K46A 2AFIE 2D62A 1CR4A 1E0JA 1NN1A 1Q1BA 2N46A 2GJAA 1Z0AA 1GRNA 2FFQA 2NO9A 2QP3A 1OLOA 1G3IA 1G6OA 1N5JA 4Q7KA 3D8BA 2G1JA 2NO7A 2IF2A 4KVGA 4ESVA 4KO8A 1KNQA 1UDWA 3W6NA 4KV9A 1OFHA 3CF6R 4DDVA 2JIZD 1ZUHA 3SN6A 2FH5B 3BWDD 3I1FA 4PANA 5CDFA 3SYKA 1Z0JA 2F3RA 3AH8A 2YWHA 2H92A 5J5CA 4Z1MD 4FN5A 5K8TA 4B3XA 4EPXA 3VU9B 1UBGA 4H9GA 4O2LA 5HKKD 3RRYA 2J7PD 1W7AA 4B76A 1KAOA 1YR7A 5HE9A 5SZHB 4NYMQ 1ELOA 4B43A 3PEWA 5F9HA 4LDJA 2ZRLA 4ZPXA 4Z8XA 3CLVA 5AWFC 3NXSA 4DLRA 3B1XA 4XTCS 3FHCB 1G3MA 4EPRA 1CRPA 4HB2A 1Z47A 2ODEA 1OIVA 1GUAA 1Z0DA 3HYRA 3PR1A 1DE0A 3QBTA 4HZUA 4X8LA 2IXFA 2ZJAA 3NKVA 3PEYA 5AJYA 5JHGB 1E9RA 3C8UA 2CL6X 3OEHD 4M2LA 2ZXUA 2Q6TA 4BFYA 2JLUA 1TQ4A 2ZYVX 4LHYA 3A1WA 3VR6A 2FE4A 2IS1A 4XTRA 1NIJA 4JT2A 1RVDA 2VEDA 4GMXA 2VP2A 2W6JA 2AK3A 3NC0C 4NP6A 1E2KA 2YNMA 4OYHA 3QBVA 4Q03A 4XSGA 1G20E 4EPWA 4G1UC 4HAXA 3MGCA 4QNRA 1E9AA 4BRWA 2OBLA 4FMDB 4OI1A 2IEZA 1JJ7A 4KJZA 4P33A 2HYIC 2R65A 1ZNZA 3K09A 3PUZA 4Q9LA 1PJRA 5FOWA 3SYNA 5BWMA 4CEHB 3GCGA 2WSSD 4EKDA 2ZETA 3VNVA 4EJSB 3EPLA 1QZXA 4HAVA 2X1VA 2A7QA 1RRFA 3T12A 1CULC 2F1HA 1G5RA 4ILEA 2OO7A 1QG4A 1PLLA 1C1YA 3CNNA 4ZV4A 3CBQA 4TYNA 4MKFA 1XZQA 2F1JA 5LDDC 1FPMA 3A4LA 3ZH9B 1ODFA 1GWNA 1NVXQ 3V4FA 1Q0UA 1SHZA 5KYKA 3HR8A 3RRMA 4CEHA 3WNCA 5HCNA 3ZVLA 3BS4A 3T06B 1LNZA 4EJSA 3I8XA 5DN6D 1NSTA 1RW4A 1W2HA 4QGAA 1ZUIA 3SI7A 3B6EA 4OQLA 3WMGA 2A5YB 5FI1B 4B33A 4DLWA 4DT1B 3U2QA 4DDUA 1EG7A 3LV8A 4OK6A 4CEIB 2YOHA 1SKYE 3NEJA 1AZSC 1OHHA 5FOUA 3ICEA 5SZKB 2GESA 3OIWA 5JI2E 5FL7A 3LXRA 2ZSEA 4IDQA 421PA 3LLMA 3GFPA 2QSZA 1CJKC 2VSOA 3U6BA 1N6HA 4B71A 4KBGA 3IO3A 5DI9A 1DO2A 3K9LA 4TLDA 1XTIA 4DT1A 4OQNA 2V6IA 1W46A 5LPNA 1JPNA 3NH6A 4CZ2A 4CEIA 3NG1A 4AKHA 3BGWA 2CL7X 4UKDA 1SXJE 3EASA 1XEXB 4TLBA 4C0SA 4HATA 1RYHA 5AJXA 3WXMA 1NKSA 1OF1A 3GPLA 2ZJBA 3JVUA 2J0UB 1E94E 4V0OA 2GK6A 3WNDA 1D8TA 2ERYA 2QTFA 4RD1A 5C2JB 4PSKA 3U4QB 3BRWD 1IN6A 5GJVC 2AD1A 4P4TA 1GKIA 3TNFA 1XEFA 4AI6A 3GJ4A 2A78A 3T15A 5DYGA 1IN7A 2ZPTX 1XEXA 2ZI6A 3CO5A 3QSYA 4Q48A 4XWOA 1UF9A 2XX3A 1LVGA 2CMKA 3EAQA 2W6ID 4RZUA 5BYJA 4OI4A 1E1QA 2KB0A 4PZYA 1SVIA 2WJVA 2IL1A 2N1BA 2J0UA 3IBGA 4XVQA 2QE7A 4A15A 4JLBA 1ESMA 1AGPA 4DSUA 1UAAA 2VF8A 4URZR 3T1QA 3U4QA 2BM0A 3DL0A 2B8TA 3IQXA 4RSGA 4YC7A 1ZCBA 3SBDA 2SHKA 5L3RA 5A5GA 2W6JD 2ZRAA 4M9SA 4FMCB 1J2JA 3EPJA 3VNUA 4ACBA 2DBYA 1I2DA 2GCOB 1ZD1A 3FKQA 2UZ3A 2ZE5A 3U60B 1GIAA 5TARA 3CZQA 4Q9JA 1T5LA 4C0HA 4LK2A 1G8GA 1E2MA 4PPQA 1AN0A 2EFEB 1HURA 2GCNA 3FTQA 2O8FB 4IOKA 1J8MF 3PEVA 4KFUA 5D3MB 2ZJZA 1OXTA 3MCAA 1RIFA 3AVPA 1XU4A 4URXR 2F7SA 1Z63A 1T3LA 3CNLA 2C03A 2G0NA 2BCJQ 1QG2A 3GQBA 3KFVA 2OEPA 4NCKA 2IYRA 3PV0A 2XTNA 3I5YA 2Q9CA 3SU8A 3TR0A 2W0SA 1W4RA 2RGNC 4P32A 3THOA 1NL3A 1HA3A 1JXOA 1X86B 1RPZA 3MUFA 4O3MA 1I4TD 1IY0A 3Q7PA 4HYYA 4CF7A 1TADA 2O8FA 3J81k 2Z4RA 4ZO4A 1XTSA 1W5TA 1X6VA 3VR3A 2WWHA 2O8DB 1BYIA 1E2HA 1VKJA 1KI3A 5D3MA 2I3BA 1MR3F 1ZAKA 1KIMA 3QQ5A 4EAQA 4PTLA 4A1FA 1OH5A 1GG2A 3GLGE 2A5JA 3HP1A 2Q9AA 2LCFA 2BC9A 2BMDA 2F43A 5CYOA 3ZVNA 2CDNA 4M1SA 3PCRB 2AKYA 2IUSA 4C0BA 1PVOA 3U7HB 5A4JA 1KI4A 4DCSA 2RCNA 2WWGA 2ZJ2A 1E9DA 1OHHD 1WQ1R 3ND9A 4KI0A 3EZFA 5EE1A 4PZZA 5EUMA 5FL7D 2JLRA 4PC3A 1IONA 2FJUA 3F5FA 2O8DA 2XTZA 1KJZA 2HT6A 2O5VA 4Q7LA 4BEJA 2FOLA 1AKEA 5J47A 1HV8A 1Q12A 3FOZA 2Q21A 2BBWA 1PUIA 1MO5A 2W83A 4LPKA 1PZNA 2I1QA 4JVSB 1JEEA 5FR2A 1XMSA 5C4GB 1W44A 4AK9A 4IFEA 4NCNA 4PAOA 4MRNA 2ZJ5A 4HDQB 2BJWA 2QRNA 4IDOA 5KSYA 4IVQA 5JMTA 1Z6AA 2WJYA 3DOFA 2RGGA 2AXPA 2ZQ5A 2F3TA 3OIYA 3AF4A 4OBEA 1XWIA 2DFLA 4PR0A 2D7CA 3BAFA 4P4UA 3W6OA 1VCIA 2ZUBA 4B2LA 2OE2A 4IOJA 5J40A 3W3ZB 4ZDIA 2EFDB 1KO4A 3RDPA 3CKLA 3UMSA 3VKHA 1G5PA 1LF5A 4NBSA 3MAAC 3B1YA 3K70D 1M8PA 4G0NA 1NY6A 1FNMA 4DUGA 2YOFA 1E1QD 4IVPA 3RABA 2WIAA 1XTRA 2HXYA 2W0MA 4LRWA 1UADA 1S96A 2QE7D 3KQLA 3U44A 2IYWA 1Q57A 4QJ5A 4DLYA 2OCBA 3LQQA 1ZM3A 4D4JA 2CEAA 3RS5A 5CJPA 2IYXA 1KSJA 1ONBA 2ZIAA 1VG0B 1QVAA 3BFKA 2W00A 4KFSA 3CH4B 4C2TA 1ZU5A 4B47A 3GLIE 2CK3A 1QHNA 2MSCB 3BORA 1BMFA 1P2UA 2JGNA 4YMWA 3PUWA 1G4AE 3QIAA 4HAZA 5FBRB 4BZQA 3ZZUA 1MRNA 2IT1A 2KBEA 3QKSB 4HUTA 1TF2A 1EFCA 5EUQB 1K6MA 4Q47A 2HLDA 3E2IA 3THYB 5CM9C 1R10A 4M8NE 2QMUA 3PENA 1CTQA 4E5UA 2VHCA 5AK0A 5KUTA 2F55A 3IDQA 1Z6YA 2R6AA 1JI0A 2IUTA 2QZ4A 4CT5A 3AVTA 1AS0A 1DELA 4PQFA 2P67A 2BMFA 3QPVA 2DCUA 1LS1A 2WIBA 1EFRA 4BEBA 2OLKA 2PJZA 3MJHA 3AV0B 1A7JA 3CR8A 3QKSA 2GJKA 2YC4C 2J0SA 4IFBA 4UNQA 5ANRB 2BWJA 3CPHA 4GZMA 2F1IA 4W9MC 4TZ0A 1G4UR 3B7GA 3LBIA 3BE4A 1WRBA 1G3QA 4MH0R 2X19A 3U61B 3KJHA 3NBXX 2IS4A 1PLJA 4JLNA 1N5IA 2WWIA 1VYTA 4S2EA 1VCMA 4U5XA 4LC0A 4PC7A 1VIAA 2Z43A 1SKQA 2GWHA 1IY1A 2QORA 4P31A 2CLDX 2QGNA 1E79A 3MFYA 4G3XA 1KY2A 2EW1A 3QJYA 1EWRA 3ZYCA 3L8ZA 4LUCA 1OB2A 1VTKA 1KK0A 1E2FA 4Q19A 5JSZB 2P6RA 3AKYA 4A0RA 2WJGA 1A4RA 2MSEB 4HDOB 3PQCA 5LBIA 1JR3A 1EFUA 4NYJR 5GVSA 3IEVA 1A82A 3MWJA 3P4XA 2C9YA 4DRZA 3CW2A 2VHTA 2ZR0A 4N0DA 4OI2A 2FZ4A 4TWZA 3ZVRA 1J90A 3HWSA 2C9CA 2J9RA 4GSYA 5HCIA 1RYFA 4RCYA 2XXAB 3FHTA 4GOXA 4DSTA 3C15C 3O8RA 1EESA 3BB1A 3LY5A 4YMSA 2VRWA 1E2QA 4Q4JB 4L8GA 1Y3AA 2FEMA 2ATXA 4TTQA 3A6PC 1N6RA 1KO7A 2GEDA 2IYTA 1MABB 2ODWA 2PMDA 5L3SB 3N2EA 1C4OA 2GZHA 3MRSA 4DSNA 1WCV1 3K70C 4Q00A 2P65A 5G3ZA 1COWA 2IA5A 1YZKA 3X1ZA 1QHSA 5F9FA 3BJIC 3N2IA 2KJQA 4DUGD 1Q3TA 2C96A 4LJ9A 4DLSA 1GNPA 2C9OA 3W34A 1JBKA 2AXNA 3MMPA 4UQOA 4B34A 4E22A 1H8ED 5L3SA 3I61A 1MABA 2FA9A 4KFRA 1II8B 3DMDA 3RNLA 2ZAMA 5TVKA 5CM8B 4M22A 2QT0A 2GXAA 2WWXA 4QBIA 5IDVA 1W0KD 1E9CA 2JLVA 1G21E 2YOGA 3A1SA 4I81A 2WM9B 5G41A 3WBJA 2AR7A 3QXCA 3R9IA 1R6BX 2AKAB 3MLEA 4LI0A 5CB6A 3AVXA 3H0KA 5FBVB 2HCJB 3KQKA 1K5GA 1NVVR 3CRQA 3M0EA 5EXPA 2OM2A 4QL3A 1QVRA 4A2WA 3SFVA 3P32A 1D9ZA 1W36C 2A30A 1A2BA 4BWYA 4F4JA 1BMFD 1OFUX 1XMIA 2ZS7A 4ERNA 4NYJQ 2HYDA 1XD2B 4LGMA 4C9BA 4KLZA 2NZJA 3PUXA 4UJ5A 2HLDD 5L3QB 1XP8A 4V0ME 4HDCA 2PLRA 3BB4A 4DXAA 3LH5A 1XCPA 1BO6A 2V6JA 3KKNA 4A6XA 4D0GA 5KSOA 2ZREA 4UNPA 1ZC3A 1ZNWA 4QBFA 2OHFA 4Q4AB 1E32A 3WYGA 4OQMA 5EJEA 1E9BA 2QL6A 2JJ1A 2VH5R 4HEJA 4HSEA 2IC5A 2UKDA 4NL4H 1XD2A 4TL8A 3R9WA 3B13B 1W4BA 2XZOA 2MMCA 3NBYC 1AM4D 5L3QA 1X8JA 3NWJA 3AGQA 3K9HA 2Z4SA 2ZSDA 4TSFA 3EC1A 1IHUA 1LS6A 2W2XA 3U6KA 1XEWX 2W2TA 5KU1A 2G88A 2VHJA 3DOEA 1MH1A 3BK7A 4D4KA 4CW7A 2AK2A 5CK5A 1NMZA 3QEOA 1HQYE 1SULA 1OXSC 4Q4AA 4B73A 4US2R 3ASZA 3EIEA 5JFGA 1YVDA 1TQ6A 1J7KA 1P75A 1KYIA 4JBYA 1E79D 4MYTA 4C0QC 3B60A 1CJMA 2X2EA 2ZUCA 3MJRA 1H65A 2XEXA 3EIHA 3TRFA 2PLFA 4NKRA 1CU1A 4AIIA 4B44A 2RKOA 5JWRA 1G19A 2RB4A 1S3SA 4G5OA 3AKEA 5CIWA 5JLJA 2JATA 2ZRKA 3DM5A 4IEIA 1KJYA 1JR3D 1NVVQ 1UDXA 5E7JA 2BKEA 3H4MA 2YWFA 2BKUA 1AKYA 4V03A 4B48A 3QUSA 3B5JA 1VDZA 5CYPA 2O0HA 2RHDA 2QTHA 1U0HC 3BOSA 1NP6A 2W58A 1G7TA 2QM8A 4HLUA 4MYHA 4YLGA 1M34E 2BHRA 1ZC4A 2HXSA 1TTTA 1QRAA 1E0AA 4A0HA 3CRW1 2ZYWX 2GVZC 3DMNA 4L5BA 4C3ZA 4RVCA 2REOA 2ZU0C 4FCVA 2IX3A 5B57C 1NNEA 1KI7A 4UXIA 1FNNA 1GSIA 1XTJA 5AUOB 4ZCIA 1COWD 2IK8A 3T61A 3GEIA 5FUWA 2RGAA 4PQYA 2NPFA 4C0KA 3LW8A 1VPLA 1G18A 2P2LA 4HAWA 2H18A 5C4MA 3CX7A 3CWZA 2YKGA 2E9SA 1N6KA 3B78A 4OJQA 2A5FA 5DNYB 2IYSA 4MKHA 2ONJA 3RVBA 5CITA 4US0R 4JLJA 5JBQA 3NDBB 4GP6A 2DHRA 3AF0A 3HYTA 1OYYA 4JYBA 4TMKA 2IYYA 3PIRA 4DIEA 3C41J 3ZDQA 1P2TA 2QM7A 4XD7A 3TW8B 4Z8YA 3GLHE 2ECKA 2JJ8A 4DLXA 1ZM7A 4F4CA 1F48A 5G40A 3R8CA 1ZD8A 2ZAOA 1N5KA 5BW8A 4CGZA 2RGNA 3DDCA 4MITA 1EX7A 3RRZA 4A82A 1NJFA 4A9AA 3CWQA 5LB4A 1AJEA 3SJZA 1G17A 1QHXA 1ESNA 2E1RA 4UXHA 4ZDKA 3GMTA 3I73A 4C30A 1IAQA 4IDHA 5DH9A 3QEJA 4PX9A 4QGFA 2TMKA 4URVR 1KI2A 4TQ9A 1G3UA 5C18A 2BBOA 3UPUA 3HPQA 4JL5A 1HYQA 1P7CA 4JLDA 2GK7A 4ARZB 1HT2E 2RGEA 4AY2A 4UXJA 4PFSA 1TQDA 5H8WA 1GVNB 2NQ2C 4D6PA 2JJ1D 4DJTA 3T1VA 5K8LA 1OXXK 1E1RA 4YONB 1G8FA 4A92A 5JCPA 3WYAA 4AKIA 2VL7A 3V9PA 2K5UA 2HEIA 2HDNB 4BLRA 4AKGA 1LV7A 3TSWA 2C04A 2WMNB 2A2ZA 4Q1DA 4TSFD 5KTYA 1OH8A 2GJ8A 1YRBA 2B92A 4HZUB 1W4AA 2AD5A 4ARZA 5L3VA 3BIFA 4WZ6A 4B2PA 3KUCA 4MQBA 4TN1A 3BXZA 3UMFA 2ZRBA 4W5WA 3ZVMA 1R0YA 2NZ8A 1YZGA 3EW9A 3RYTC 1UM8A 5E7IA 4LYFA 3FFAA 2D2FA 5B2ZA 1R5OA 5FUVA 2XNSA 1KGDA 1ZM2A 4PO9A 3PEUA 4WZBE 3FMFA 2A3RA 4D4LA 2YJTD 4KU4A 3V4RA 1XDBA 2G3YA 221PA 4WA7A 5EE0A 5JS7A 4IRUB 2OG2A 3VHLB 1IOZA 4M0LA 3IEUA 5CLLA 3AVVA 3BERA 4URWR 3CRVA 2QT1A 3PG5A 5AR1A 5JECA 2D74A 2B7CA 3GFTA 4KYIB 4MGIR 2PJRA 3AVUA 3KJEA 2PBRA 1XJCA 1GL7A 3FMOB 2GA8A 3M1IA 4NYIR 4GP7A 1DTSA 2FFBA 3GJ8A 1HY3A 4DBLC 4U02A 1CRQA 4MRVA 3FYHA 3ZGXA 2A5DA 1QDEA 3T34A 3QENA 4XH9B 4I1VA 4XIGS 1YR9A 4NCHA 1KSGA 4YQFA 1WBBA 3B1ZA 3IILA 5UKDA 3FHOA 1GKYA 1ZCAA 4MKIA 4II7A 2ZRCA 2VA8A 3KB1A 1L7VC 3CR7A 4JSTA 1OIXA 2ZI4A 4XD7D 4YMVA 2JJ2A 2XJ4A 2DFKB 3GFOA 3IPYA 3LVRE 1JJVA 3WMEA 1OFIA 2CBZA 1OXUA 2GZAA 1AQUA 2ZRNA 2GVDC 3ASYA 4PC6A 2CXXA 1II9A 1RRGA 3Q85A 4BFZA 2PX0A 3U5ZB 2GHIA 1T9HA 4QHYA 4TYYA 4JBXA 1CF4A 3PUVA 4JJKA 4Q21A 3AGPA 3KXLA 3M4YA 5D3QA 2FF7A 4I1SA 2RHMA 1G5TA 1KDPA 5HPYB 1Q1ZA 1QHHB 3E5HA 3KTAB 3IIJA 3TGPA 2HF8A 2OFOA 4RD2A 3UG6A 2GTPA 2VHQA 4JL6A 1FOEB 4MDEA 2OFXA 4A8JA 4BRUA 3I92A 4QGHA 1O3YA 4IEEA 4LJ6A 3K0SA 4V0NA 1Z6TA 2VP5A 2QEQA 1BS1A 1KO5A 4EIWA 1AK2A 2OFWA 4NYIQ 3U3RA 1HE1C 2PH1A 2ZR7A 1E1RD 4M4SA 4PPNA 4EPYA 2WPDA 1QHHA 1WMSA 3DZ8A 3KTAA 1KOFA 3LX5A 1I2MA 4L15A 2ZR9A 5FOSA 2BJVA 5FTKA 1QHYA 3UATA 5CLQA 4B32A 3TQFA 4R2HA 1JR6A 4LX0A 5LB2A 3D31A 4CYMA 2AHOA 2Z5FA 3NH9A 3K70B 4KAXA 1ZMXA 5AUQA 4Q9IA 3LBNA 2C2HA 1F6BA 3THXB 2VO1A 3MG9A 1X1SA 5FR1A 2YC2C 4AWXA 1NMYA 2JASA 3X1YA 2VTKA 1R7RA 1HE8B 2PMKA 3TAUA 1N0WA 4PQRA 2QMOA 5TV2A 2OESA 3TAHA 1RKBA 3LLUA 5BN3A 5J4VA 3VQTA 4HLUC 1KZ7B 1JPJA 4BLSA 2IXEA 3GEEA 4A2QA 4JLAA 4JLMA 4DCNA 4ESHA 1GITA 1KTVA 1OJLA 1D6JA 4M53A 4OHWA 4PHHA 2QENA 3THXA 3GJ6A 2LKDA 3WRXC 1IXSB 4G5GA 4BLQA 3RC3A 1E2JA 1W36B 1R8QA 4M9XA 5EP1A 2EWVA 4N0EA 2J45A 4RD6A 2ODBA 4B3BA 1UKZA 4C2UA 5CIQA 3VFDA 4I1UA 3B2EA 4FD2A 4Q9HA 5FFMA 4DLZA 1XMVA 2ORIA 2WWWA 2NGRA 5SZIA 4O25A 5AUNB 5E95A 3I72A 1U0JA 2ZITA 3LD9A 4HB3A 1L8QA 3I8SA 2R6FA 3ZD6A 2XZLA 4QRHA 2QNRA 3GJ0A 1DS6A 3ZD7A 2CHGA 3EG5A 1A5TA 1VYUA 4DB4A 1KI8A 1XFAA 3EWAA 1EWQA 1W0JA 3RS0A 1TEXA 4H1VA 1J8YF 1XEWY 4LHVA 2F43B 1P5ZB 4Q7JB 4IJMA 2Q9BA 4D80A 5DISB 3N5CA 1Z5ZA 4TZ6A 2CLCX 4FXPA 5EP4A 3ZS8A 1ZNYA 4KBFA 2O8CB 3CRMA 4ITRC 5SZJA 1E98A 1AS3A 1N3BA 2CE2X 3QXXA 1AZTA 2F1RA 4FWTA 4WBSA 5KSPA 1S9DA 5EE9A 3M6AA 3K0FA 1VHLA 2KI5A 4KVAA 4FI3C 1GL6A 2BMJA 1M74A 1S8FA 2A9KA 2X8AA 4QNMA 4HLCA 4FWIB 5JEDA 4R2IA 4O0MA 1OIWA 4DDTA 3O8CA 2O8CA 1GOTA 3SZRA 1YRAA 1S1CA 2QQEA 3A4MA 2G9NA 4DLTA 4TMZA 4F7WA 4TTRA 2ZJYA 4W7SA 4NU0A 1SVSA 2AWOA 4D26A 3GLIB 5FPSA 4B3DA 2J0VA 1KDOA 3W5JA 2GF0A 4DC9A 4DEYA 2V3CC 3TIFA 2OZEA 1AA9A 1FMLA 4L4UA 4L9WA 3T1TA 4KLNA 2ZJ8A 2NO0A 1FQJA 1CIPA 1MV5A 2DYKA 2WICA 1Z29A 2ZE8A 3AF1A 5JJLA 2R6GA 2R44A 5BXQC 1C9KA 3L43A 1XF9A 3CRRA 3G82C 3LDAA 4GI7A 4PXAA 3THWA 2C78A 1XJ0A 3TUZC 3H2YA 2QY9A 2RGBA 2WVJA 1CJVC 1US8B 2Q0HA 3QKUA 3RAPR 1D2EA 4QXAA 1ZBDA 4IW3B 3GLIA 1LB1B 2FSFA 2Z0MA 4MRSA 1Q44A 2DPXA 5F98A 2J59A 3H86A 5EP3A 3U44B 2UVQA 3TVTA 5FH9A 1E0SA 1CJTC 5FBQB 3FE2A 3QXHA 4JT4A 5J4HA 3U3JA 3K53A 4TMXA 4P4SB 1OE0A 3RHFA 4NMMA 3WY9A 4LJ8A 3P1JA 4OHZA 4BLPA 4X8MA 2H17A 5E3HA 3WHLA 3Q8XB 2DR3A 2QUZA 2BIFA 3NBZC 4OJKA 1XTQA 2ONKA 1US8A 4FCTA 3R7WB 1G7CA 1XTKA 2AFHE 3OF5A 1ZW6A 1TU4A 1U0LA 4OL0A 1IN8A 2REBA 1FUKA 3D7MA 4DCUA 1RRCA 4A0FA 1TU3A 4F91B 1BYUA 4PAQA 2EFCB 5KDDA 3BH6A 3LVQE 1DAIA 3EZ2A 3P27A 1JNYA 2C77A 2QTVB 2YV5A 3BFVA 4BPBA 1XD9A 2V7QA 1NLFA 3DEFA 1OKKA 4P4SA 1VG9B 2REXB 5EQTA 1YE8A 3AP1A 3SHFA 8OHMA 2R6DA 4B35A 2RMKA 1WE2A 4BFTA 1ZJ6A 3R7WA 4LV6A 1G8PA 3T35A 1NIPA 1TAGA 4URUR 2JLXA 3OE7A 5P21A 1S1MA 1W36D 2ZSBA 1QHGA 4GDFA 1MOZA 1EFTA 2H1LA 2OXRA 4NTZA 1TMKA 4V02A 2O8EB 1W0JD 2PEZA 3A4NA 5GJCA 3O47A 4JMPA 4D0LB 3CH5A 1CXZA 4E07A 1XXHB 1Z6XA 1SXJC 1OW3B 2DWQA 2G0TA 3PXGA 2BEJA 1N5LA 1ZM4A 3FMPB 4KCGA 5TMPA 4JS0A 2H5EA 3IQWA 4GT1A 4OQFA 2IUUA 2OT3B 2ZE6A 4PAMA 5KNCA 2R6CA 2ZRMA 3IIKA 3T5DA 1FP7A 3RSLA 2QAGC 1OPXA 2VP4A 2V9PA 2WKRA 5JS8A 1OFTA 1E99A 4YMUA 3JZMA 3SFZA 3IIMA 5FBLB 2O8EA 4A8JC 4PHTA 4AC9A 4Q7MB 1JECA 1R4AA 1DBSA 1XXHA 1F3OA 3W9YA 1BIFA 4R7ZA 3WP0A 2IWHA 2ZEJA 5CK4A 5GJWC 2WMOB 1T0HB 1N0VC 4AKEA 1N6LA 2BDTA 5DHAA 4DCTA 2G6BA 3QXSA 1JALA 1XB2A 2IXGA 1WDTA 4ABYA 1D2MA 5IHPA 1Q1EA 3Q5DA 1X1RA 3AM1A 1RRPA 2ZTSA 4PHGA 4WOPA 1W2GA 2BEKA 3AP2A 2FNAA 4NE2A 1NG9A 2NMVA 1RC8A 3GEHA 4EFMA 4EPVA 4US1R 5HZHA 2UZIR 5J4YA 4NPHA 4LYHA 4TLCA 5EP2A 3A8TA 1YR8A 1E4YA 1T6NA 1YZNA 4AURA 5KHOC 3ZIAA 2C99A 4TYPA 2I1VB 4OK3A 2IHBA 4R9UC 2OCPA 3ZZTA 2FWRA 1AIPA 1Q1QA 3CNOA 4F92B 4ON9A 1CKEA 1U9IA 2RGCA 1UPTA 2AL7A 3E1SA 1M7BA 2OCAA 2XZPA 2V8OA 4NDZA 2BV3A 1D5CA 2Z83A 3AP3A 3LRPA 5EZ5A 3I3SR 2P6NA 5JWHA 2FPLA 2BBTA 1FFHA 1W5SA 1DAEA 1JQLB 3LFUA 1U99A 1GZSA 1ANKA 3QI2A 4OHYA 1P60A 3L2OB 3OEEA 1RJ9A 1YHNA 3U3OA 2WKPA 1JQJC 4B3FX 2F9LA 1ZIOA 1XZPA 2D3WA 3A1VA 5FOXA 1XPOA 3TLXA 5J4KA 1OKKD 3L82B 2GBLA 3KKPA 1DAFA 3S1AB 2GILA 5KPDA 3B9QA 3D3QA 2RGXA 1AGRA 3TH5A 3WNBA 1YZQA 2CK3D 4HI0E 821PA 2YYZA 2ZM5A 3BC1A 2DY1A 4LYAA 4MDFA 2JAQA 2XOKA 1SVLA 1JAHA 1DOAA 1UJ2A 4Q1CA 5TY0A 4F4IA 2I4IA 2Q3HA 121PA 4ACAA 3VR4A 2QN6A 2O8BA 4TYWA 4L9SA 3S1AA 4QGGA 1M6NA 4V0LA 2XSZA 3P4YA 3QVVA 4B3GA 2CCJA 1SGWA 3TSZA 4C0AC 1KI6B 2DFTA 4JIMA 1HQCA 3SQWA 3TQCA 4UNRA 2FDCA 3KX2A 2QP4A 3IHWA 1EFRD 1ZIPA 4C0LA 3SS8A 1ETUA 4ZKEA 1NBMA 2WOJA 4R98A 4ASUA 2HF9A 4PZLA 1E0KA 4DHEA 4GOKA 2V1XA 3LXXA 2QBYB 3A37A 2CCGA 4EFNA 2QPOA 1D2NA 2HJGA 4RFVA 3QF4A 1NI3A 1X8LA 1KI6A 5J4LA 3GLFB 4I99A 4BFVA 2FSIA 4JZKA 2IBMA 3HU2A 4QG7A 3CF0A 3AUYA 2VPPA 2NIPA 3AEZA 3CPJB 5AJVB 3QPUA 4RZ3A 2D2EA 3RS4A 2GDJA 3ZZ0A 2X77A 5JJIA 4CIDA 4XVRA 2ODNA 3KB2A 3K9GA 3DKVA 4GOJA 3VX4A 1SVMA 2QBYA 4TLAA 3CONA 3X1DA 2JIZA 2C5LA 3VX3A 1SVKA 2GETA 2J5XA 3MSXA 5JI3E 4H1UA 3UXMA 2XB2A 2H7VA 3TVDA 2QI9C 3GLFA 4QJ4A 4Z1MA 1YQTA 2KBFA 3ZIAD 1KKMA 3PFIA 1P72A 4Z54A 3AVQA 4JVLA 1L4UA 3C4JA 3RWOA 2ZRJA 4DVGA 2ATVA 1ZINA 1DPFA 2PT5A 4NCJA 1N25A 5TB5A 1G7SA 4RD3A 1OH6A 6Q21A 3NTUA 3PVSA 5DIFA 4QKQA 4TL9A 1UKVY 2EU8A 4DCVA 4B6EA 5EXSA 5F3WB 4LZZA 3W3AA 5DSZA 4AG5A 2WSMA 2JCSA 5FPHA 3SJCA 3GP8A 2GZDA 2VIIA 1KO8A 4RFSB 2V55B 5FTLA 2PCJA 1FTSA 2YWGA 1ZRHA 2CJWA 1ZU4A 2DWPA 2QMEA 1RZ3A 2XNDA 3OEED 4WAUA 4IOMA 4Z51A 5JWOA 3BH7A 4A4DA 2B8WA 2ZRIA 4LCBA 2WTUA 1IM2A 2QRZA 1MO6A 2FFAA 1Z8FA 2W2VA 4FMBB 1VMAA 4LOAA 4Q5IA 4ZI2A 1FMJA 4XJXA 2WHXA 1MRSA 2O52A 3EPHA 3RS2A 3EC2A 1E9SA 4RFSA 3TUJC 3R20A 3Q9LA 4C0JA 1UBEA 1PUJA 4LPSA 5AJZA 3TW4A 2ZRFA 2WOOA 1FZQA 4BE7B 2WSSA 3SBEA 2XOKD 4URYR 1OH7A 2MSDB 1HH4A 4XVUA 5JHHB 4LJ5A 2OLJA 2XJ9A 4Q66C 4C7OB 1XPRA 2C95A 5BN4A 1BH2A 4K81B 5FL3A 4EFLA 4HLDA 2XSZD 3FWYA 3EA0A 5FUYA 5GADl 1Y63A 2RH5A 1XPUA 3R9XA 1A2KC 2X2FA 1JAIA 2ZYTX 4TT3A 4M9ZA 2ASEA 1H8HA 4FIDA 2J87A 2ZYUX 1Z2CA 3KKQA 3RRNA 1NBMD 1VG1A 4A0GA 4QHTA 4ASUD 4C7OA 2P3SA 1DVRA 4EPTA 3KJIA 2F6RA 4YXWA 3SDZA 1XMJA 5KPJA 4GBMA 4LHZA 5KO2A 4BLTA 3OAAA 2R2AA 5JCZA 5IK2A 2NTYC 3ZQJA 2P6UA 2CNWA 1L4YA 2WV9A 4EQ6B 3AKDA 1LW7A 4JVNA 1E6CA 2BMEA 2BVNA 4BFUA 1Z0IA 4JLPA 4OQXA 3VTKA 2BBSA 3BFXA 3VKGA 1NY5A 2FU5C 2PX3A 3HJNA 2FX3A 4Q4HA 2WJHA 3CZPA 2VYFA 1CJUC 4E09A 3ZLJA 1FX0B 5FPYA 5LD2C 1DG1G 1SHKA 1U94A 2FSHA 3T5GA 4HUQB 2WAYA 4AD8A 4MRRA 4MUAA 3U3MA 3HU1A 1CR2A 3P26A 1DAMA 1NVWQ 1Z6GA 1NKTA 3LX8A 4AYWA 1P6XA 4OHVA 4CEJA 3EWSA 3RWMB 5HTKA 3ADBA 2G77B 1D9XA 1FUUA 3HPRA 3W8NA 3X1WA 4EQ6A 3A36A 3CX6A 3H84A 3OZXA 2FMXA 1U9IC 1YJ5A 1YZTA 3A1TA 4QM6A 3UWOA 3QPWA 2HJVA 3WMFA 1Z06A 4IXMA 5EXXA 2L0XA 1SKYB 3SR0A 3WRYC 4BFWA 3MWKA 1GAJA 3W6PA 3QNUA 3EPKA 2CHVA 1WBDA 1VECA 1FX0A 1NG1A 2ORVA 2WWFA 5TXGA 2YVUA 4CDGA 4HUQA 4R71A 2EQBA 3DM9B 2FV8A 1S2MA 1CLUA 4QHSA 2BCGY 1X3SA 1GNQA 2P0EA 2W6IA 2ZRGA 3NBFA 4IDPA 4RD4A 3SNHA 3TJZA 1F60A 1UFQA 2ANCA 3VU9A 3TMKA 1I4LD 1PLKA 2ZE7A 1BOFA 3CUEF 4BFSA 3SC3A 1SXJB 3H1TA 4QC2A 1WXQA 3E70C 4WZAE 2WJJA 2XNDD 1KJWA 1S0UA 3RSOA 1IXRC 3L0IB 5KDLA 2H57A 1DO0A 1GDDA 2GBLC 1Q20A 5AUPB 1KSHA 3UKDA 2IYLD 2QAGB 4RKEA 2JDIA 1KO1A 1VYVA 3OHMA 5CDFE 1AQYA 4M1OA 2FPKA 3FFBA 3NVAA 5FOTA 4BZPA 2F9MA 4A8JB 4MGZR 4GZLA 4AYXA 3KL4A 4MKGA 3N70A 2KSQA 1KNXA 1T8TA 1Z07A 1SXJA 4GRAA 1KZGB 2QPTA 4RZ2A 2ZUDA 1E2NA 3AKCA 1Z0KA 2J41A 5H1YA 2YWEA 2OUKA 4TMTA 3T1OA 4DWJA 4ZIRB 2J0QA 2R9VA 3MWYW 2R62A 3SHWA 4FMCF 3KUDA 2QAGA 3C14C 3AUXA 3I5XA 3HDTA 4RCZA 5HR5A 1G7RA 2VSFA 1UKEA 1T0JB 3IHLA 1G3RA 1KK1A 3NDPA 1GL9B 5JJKA 2IF0A 4XSHA 2PCLA 1UBFA 1NN0A 4PSAA 5GJBA 3AB3A 2HT1A 3FVQA 1SVWA 4TT3D 1R0XA 1H8HD 1EK0A 1IBRA 4JVMA 2GJ9A 1IXZA 2EYUA 4ZIRA 1SZPA 2WKQA 5JZVA 4PHFA 4U7DA 1E2PA 3EA5A 1S3GA 4LBWA 2WZQA 1E2IA 2QPAA 4YXWD 2HCBA 3U3KA 5A0FA 3UMRA 3OAAD 1IQPA 3SOPA 3KJGA 4MYUA 2ZSFA 3KDSE 5IK2D 1E2LA 2QGZA 3NC1C 3HR7A 1KK3A 4FINA 1V43A 2JEOA 2CNWD 2IHYA 1VIYA 1KDRA 2OCYC 3O8DA 3P20A 1KAGA 3DPUA 3KXKA 3C16C 2RAPA 1W47A 3A1UA 3EARA 3GD7A 1U8AA 4LY6A 4QBGB 3UIEA 3CX8A 2CCKA 2YZ2A 3NHAA 3GJ5A 1EXMA 1Q3HA 4LYJA 2ZU6A 3K0AB 2ZI5A 4I1OA 4L16A 3GLGB 3OFNA 1F2UB 1NLZA 4M1TA 1R0WA 3GJ3A 1CS4C 3DO6A 2PT7A 2QROA 1G6HA 1NF3A 1T5IA 1TUIA 4HB4A 1GFIA 1U81A 4ZCLA 5BN5A 2OXCA 2FFHA 3K1JA 4NHOA 2Y8EA 1IN5A 1WB9A 1M2OB 4Q9KA 1II0A 1KMHB 4D82A 2NPIA 1ZD9A 1G8YA 4HZIA 3K0AA 1AS2A 1CBUA 1E9FA 3GLGA 1F2UA 5H68A 3RC8A 4OK5A 3QXJA 1OT3A 3SQXA 1KDTA 1P9RA 1HEIA 3W90A 2FEOA 4JKIA 1YZUA 3X1XA 2V54A 4K8OA 4XWAA 5CB8A 4W5HA 4KHZA 5DE3A 1OSNA 3KKMA 3VR2A 4XOIA 4QM7A 1E2EA 4B3CA 1ZM9A 621PA 1KMHA 1MKYA 2E87A 2ZSAA 3B85A 2R8RA 4KXFB 4KSBA 4LJ7A 4DDWA 1Q21A 2JJ2D 5G53C 1R5BA 1YR6A 3LWNA 2JDID 2IW3A 1GKUB 4DLUA 4AYTA 3K0FB 4S35A 2VP6A 5FBWB 4IHQA 2O0JA 1B23P 4MGYR 2CHQA 2JLSA 1E2DA 3CPEA 4DLVA 2JLZA 1CEEA 1RFLA 4D81A 721PA 2QU8A 3AVYA 4Q1FA 3KQNA 1SXJD 2GAAA 2BOVA 4BASA 1KI1A 4D4MA 4JKYA 1TX4B 1G1MA 1ZYUA 3UG7A 3FMIA 2G83A 2IS6A 2HV8A 3TSOA 1VHTA 3K0CA 3OIUA 2GCOA 1I4DD 5FTMA 3K0EA 2H16A 4YDHB 1R2QA 4IVRA 2PZGA 4JLOA 5C1BA 4WXRA 1Z3IX 1N6NA 1KY3A 3THWB 1XCMA 4IOLA 1JEDA 1G41A 2VBCA 3LNCA 3UANA 3ADCA 1FP6A 1KHTA 5KNDA 3QKTA 3CF2A 1NVUQ 2Q3MA 5EXTA 4E03A 1N6IA 2WPDD 3ETLA 4G5SA 2EWWA 3FPAA 3X2SA 4TYQA 2NG1A 2DFNA 2VQSA 3F8TA 1N0UA 3EZ6A 3NHBA 2ZI7A 3WP1B 5DI3B 1E3MA 2VF7A 3W8RA 2JLWA 1EGAA 1GTVA 4ZDJA 2VP0A 3A58B 4LWZA 1UEIA 5KSZA 3TKLA 5CJ2A 2FPMA 1V5WA 1T8UA 5EE5B 4NH0A 1OV4A 1P9WA 4Q18A 3LA6A 3PJRA 2NO6A 1W48A 4G5RA 4CVNA 1J99A 3LW7A 4QFMA 4BZXA 2ZRPA 1P2VA 3W5IA 2Z6VA 3BBPA 4LV5B 1Z22A 1IJFA 4P0TA 2VHUA 4HLQB 4TL7A 3OFND 4LHXA 4PC2A 4IXNA 2GAOA 5DI3A 3C5CA 4ZI3A 1NN3A 3KKOA 1ZP6A 3Q7QA 2XTMA 5HZKA 4QBHA 1R8SA 2QMHA 2RGDA 1X8KA 1XJQA 1ZVQA 3EZ7A 4QOSA 3SJBA 3HU3A 4A36A 4M21A 3RLFA 4DEXA 1DAKA 3KFXA 4LJ4A 1GILA 3EXAA 3Q72A 4B75A 1R5NA 3DVLA 1YU9A 4FCWA 3IPXA 2FG5A 4KITB 5JRZA 2AX4A 2VSXA 4YDSA 1S4QA 5FI0B 5G3YA 4GFDA 2CLSA 3KZ1E 4HAYA 4X8OA 1G291 1G64A 4NZYA 3CM0A 2D06A 2IWRA 4G5QA 4JBWA 4RKFA 1H8EA 1CP2A 1OXVA 5FOVA 2OAP1 4TL6A 3RS7A 5TDHA 2ZJOA 1W0KA 3EX7C 1CR1A 1E96A 1NRJB 3L0OA 1TF5A 4RD0A 1U90A 4LBYA 4PO8A 1CR0A 3B1VA 1NJGA 3GJXC 3ZQ6A 1NMXA 2ZS9A 1QBKC 2JLQA 4LHWA 2FN4A 4ZDWA 3K09C 1A1VA 4EDHA 5IT5A 3ND8A 1RE0A 4NCIA 2H8KA 1SQ5A 2KWIA 1U8ZA 2PEYA 2ZROA 4M1MA 5JEEA 2N42A 1KMQA 2O0KA 1T91A 1T3HA 4OHXA 3I62A 2ZANA 5DGXA 4DKXA 2GRJA 1DADA 3MD0A 1UKYA 3DZDA 3ONWA 2MMGA 4QJ3A 3LAWA 3F0TA 1G9XA 1F5NA 1SVOA 4JLKA 4Q02A 4UNSA 3TE6A 3WBKA 4D0NA 2WJIA 5LD2B 4IKEA 4C4PA 2V1UA 4GMDA 1TL7C 3MWLA 5L8VA 2DB3A 3FKSA 3AF2A 4EJSC 2VP9A 3EIQA 4PO1A 2CE7A 1FW6A 2FGJA 1XCGB 3LBHA 1N6PA 3DKPA 2B7BA 4BGDA 3U7FB 4Q1AA 5H70A 2J3EA 1N6OA 2OBMA 4OI0A 2ORWA 4IDNA 1N2CE 3THYA 2IYQA 4KYUA 2IYUA 4JJZA 3U7GA 2D7DA 2V4ZA 3VR5A 2ZI9A 3SYLA 1WA5A 2WWYA 3IO5A 4UNNA 3NIBA 1NSFA 2GF9A 3CB4A 1QF9A 2NOAA 1JB1A 4Y0VA 1VG8A 3FGNA 5BYKA 2LWIA 1W4CA 4V0KA 4CT4B 4KODA 4PPGA 3CIOA 5BQ5A 4TQAA 4WVFA 4CRWB 3ZJYA 5DYIA 5E4FA 3F3YA 2OSBA 1P2SA 1RJ9B 2KE5A 4AG6A 2ZRDA 3AVWA 2XB4A 5FTNA 4Y0AA 4DB2A 3U7EB 3ADKA 1IJEA 2ANBA 2G1KA 4I4LA 4N3NA 4Q4LA 5DHFA 3B8HA 3VMFA 1GRQA 3QF7A 5B58C 3G0HA 4PPFA 3QE0A 2IYZA 4RY2A 1QHIA 4XWKA 3REFA 4POAA 3D6TB 1P73A 4G01B 4LJYA 4HB0A 4V0MA 1DAGA 4D2IA 1MO3A 3QY0A 4WXPA 5KDOA 2OAQ1 1XX6A 3SEAA 3FDIA 4OKSA 2FGKA 4HAUA 2PZFA 1TF7A 1E9EA 4LV8B 4F38A 1GNRA 3K8YA 1K8RA 5B30A 2Q3FA 3KXIA 1LFDB 5JSZA 2ZS8A 5DO9A 4PSVA 1EX6A 1EFHA 4MA4A 2CL0X 1XXHE 2V7QD 3QG1A 1KKLA 1F2TB 3VR1A 1Z2AA 2J7KA 2O8BB 5FPTA 3FB4A 4TQUS 1S9HA 4Q1BA 2XXAA 1M7HA 4BECA 1LF0A 2EVWX 3I32A 2FSGA 2GKSA 2IYVA 3TK1A 4BLOA 3ICQB 3SJAA 1FTNA 4EUNA 1HUQA 2AN9A 2IEYA 5K8IA 2QAJA 4Q4JA 3L0PA 3ECCA 3ADDA 1K5DA 5KOYA 1JR3E 3OE7D 5C46F 1IY2A 2A5GA 4F93B 1F2TA 4TMVA 2IS2A 1DARA 3C5HA 3AVOA 3IBYA 3QF4B 4LJAA 3UK6A 1P9NA 4DZZA 5EE3A 3I4LA 3KQHA 4U00A 4BFXA 4LSGA 3NEYA 1KK2A 3C7KA 2YINC 4JSYA 1YZLA 2D4HA 3B82A 5B64A 1M7GA 3OIVA 1DEKA 3K0CC 1W49A 3G5UA 1II8A 3VAAA 4M1WA 3Q5EA 1WF3A 2PL3A 3SE0A 4LBVA 2DWOA 2OBNA 5IF9A 3O8BA 3KQUA 2EYQA 4BQSA 1WP9A 1P3JA 5M04A 1E69A 1G16A 3GJ7A 5FTJA 3TBKA 4FW9A 1MT0A 3PITA 3WYFA 3VHXA 3GLHB 4NONA 2OILA 521PA 4B6FA 4ZKDA 2XITA 3FKSD 1GM5A 2GXQA 1NLYA 3PUYA 3IGFA 1Z08A 2CVFA 3AF3A 1LTQA 3JZAA 2P5TB 4Q01A 1T4GA 1U8YA 4MGKR 1J70A 1IN4A 1B0UA 3Q3JB 4JLVA 2C98A 3BH0A 2P5SA 3QOFA 4WIAA 3IKJA 4YMTA 2ZI3A 5ELXA 4LC1A 4MUBA 4GL2A 1L2TA 4W5JA 4MRPA 1TQ2A 2EFHB 1GP2A 1XBTA 1YKSA 4P3YA 3GLHA 2QSYA 1NN5A 2C8VA 3QVUA 5E7MA 4RZXA 2PZEA 1JXMA 2FZLA 1UBCA 5HKKA 2CJWB 2JA1A 2J7PA 2WBLC 1VCOA 5DLQC 1GRRA 1U2RA 2YHSA 3QG5A 4DIDA 5KNBA 1Z0FA 1P61B 1U98A 3AQ4A
chains in the Genus database with same CATH superfamily
4IXTA 1XNJA 3D02A 1GEGA 1SQ6A 1RRVA 5AJHA 1TT5A 2ZB8A 1D1PA 4TLEA 5KWEA 3O4HA 2UYGA 3BB3A 2JLYA 1BS2A 3OY7A 2OORA 1T3GA 1TNDA 4Z0HO 1A88A 3JRNA 5BSRA 3IMKA 1R6XA 5FUXA 4DSOA 4LF5B 3BJMA 3L6DA 5HUHA 4WOBA 4TKUA 1DAHA 2M98A 4A6PA 3WG9A 2AJLI 4F9EA 4MHOA 5LQRA 1V5EA 3K9NA 1Q0TA 1PV4A 1TC1A 3VUEA 3V00A 1GSAA 1VJTA 4DDKA 2EDCA 2B6HA 1KEZA 1LY1A 2A92A 3JQBA 3WVNA 1XD8A 2CDBA 3EEOA 2QQ0A 2OBYA 5EJ6A 2II6A 5EMJA 2CVHA 5ARCA 4BJHB 3L9WA 5B1SA 4Q4DA 3WLRA 4OHCA 1FSSA 1W4LA 2ZBEA 4DY6A 1ZD4A 3BHNA 4J6EA 3EJWA 5CEJA 5FPKA 4JFRA 2O3JA 4WY2A 3ZS9A 1KZ9A 2ZAYA 1DDGA 5IM4A 2ZVQX 1QRSA 4E88A 1LSUA 2VYQA 1FXUA 1FU8A 3B12A 4XM1A 1NR7A 3DFIA 1RMQA 4LDRA 5DPMA 4LBZA 4QUDA 5EKSA 1T1IA 1E4VA 1RRKA 3QBDA 1VCNA 1U04A 2ZRHA 3B6MA 2XZTA 4QNNA 4TVBA 3LO5A 2X1MA 5FA5A 4WK0B 1I1OA 1VL8A 2WY2D 1J22A 1Q7BA 3LQRA 1WL8A 4IIUA 4Q1EA 4YNBA 3ZWPA 3HWWA 2GXSA 1QH0A 2VJPA 3R8FA 1IVYA 2JFBA 2VOJA 4OSEA 1CHDA 2GNOA 1SQSA 3FJ1A 1ZI9A 1Q0ZA 3DMFA 3H18A 3FNGA 4GXRA 3D4LA 3N2GB 3SZOA 1T3SA 3EOZA 1MO4A 3ZHSA 3KHTA 2LDXA 4IIGA 2C2XA 5EWJB 2VJOA 4RJJA 3URKA 4CKCB 4Q37A 3DHWC 4IWYA 3GLQA 4Q4HB 1GSHA 2B21A 4FW8A 4QOIA 2X0RA 2ZYDA 4WJKB 5CB4B 1WZIA 2QM0A 5LLTA 2WAXA 5EJ2A 4XGQA 4KLCA 5COQA 1UFRA 4J49A 1AV7A 1E6MA 1GGNA 1ZUNB 2H1VA 2X9QA 3NWBA 2BM1A 3HEBA 1XA0A 3O84A 1UEJA 4WW0A 4EI9A 4W5TA 1Z83A 2VT7A 4CEJB 1Q77A 5MFZA 4KUHA 1CR4A 2Q4RA 1Q1BA 2IIQA 2GJAA 3ENZA 3Q6MA 3N2GA 2FUKA 3HXTA 2NO9A 4PN3A 3L41A 4LQCA 1G6OA 1N5JA 3DE6X 3OE5A 4KLRA 3SG0A 1K98A 2LCQA 1ISJA 3LT4A 5EWJA 2IF2A 3BSYA 1GR0A 1XF1A 1Y8AA 4CKCA 1UDWA 4R5HA 3W6NA 1KQOA 5CB4A 3BD8A 4X71A 3NGXA 4IDEA 2XCUA 1YOBA 1ZUNA 2IHJA 2JIZD 3UJ3X 2NXNA 3GRRA 1CRZA 3M1YA 3NRJA 4D3XA 4Y2PA 2ABWA 3C6ZA 3KZCA 2TMDA 3ZY5A 1WTAA 2HWUA 1Z0JA 3AH8A 2ZAGA 4HYTA 2H92A 3TLEA 2H52A 4JT8A 1S5PA 4AMYA 1SRRA 4BV3A 5EHQA 3WYDA 4MPJA 1UBGA 5CBPB 3D3JA 2H11A 3A1EA 4O2LA 2D5CA 3RRYA 5JLAA 1W7AA 4B76A 5DFAA 5HE9A 4B43A 2AW3A 2KLHA 1QIGA 3MTDA 5EWLB 4L28A 2ZRLA 3ZJTA 2XA1A 1O1YA 3HE3A 4HQOA 3CLVA 5AWFC 3NXSA 4N8SA 2IZ6A 1IJKA 4FE3A 3FHCB 1GCIA 1T2UA 4O63O 4KN8A 4XTCS 3H8VA 4C4RA 3W2TA 4EPRA 1C1DA 1UWLA 1QB8A 3DDNA 2ODEA 4BNJA 5LUBA 2NSJA 3HYRA 4XD2A 1DE0A 1H9AA 2YJ5A 5IJXA 4FYIA 5AJYA 2YZMA 1B7GO 1JLRA 1E9RA 3H75A 3IMGA 3JPYA 4I8XA 5JHGB 1JAXA 3HXKA 4WN3A 5CBPA 4EYGA 3OEHD 3QVLA 3CC8A 4RPGA 1VL6A 4I14A 4CG1A 4EY4A 4OCZA 4PLVA 5ALFA 1G0OA 4BKRA 4BNYA 1KVTA 2JLUA 4X7RA 2WD8A 1E7YA 1P4RA 5EWLA 3NAMA 1K5PA 3A1WA 3PGJA 5DM60 4XTRA 1V5GA 1TO1E 4UHBA 4ARCA 1QLJA 4LX8A 1RVDA 2VEDA 3OPVA 4ZOCA 3S70A 4GMXA 1M6YA 2VP2A 5D51S 2JAHA 3L6OO 4BN4A 3DDOA 2B2XA 1LW6E 5GWXA 3FJYA 3UUGA 2MWMA 2HPZA 3W5DA 4LKRA 5ALPA 3WIOA 2XA2A 1Y7IA 4KQHA 2ZDHA 4HQNA 4F9GA 3LVBA 2RHGB 4GDMA 3BL5A 4EPWA 5TNXA 3FNEA 4I55F 4HWOA 4HAXA 3RUFA 2XGGA 1E9AA 4QNRA 2QRHA 2OBLA 4WMLA 1DZ3A 5LQMA 2YN2A 1X1DA 3B1FA 4FMDB 3HB0A 4GQBA 2HYIC 3L5KA 4P33A 4ISCA 1N9GB 1ZNZA 3UBMA 1M0SA 1PJRA 3BGOS 3GCGA 4TXMA 1RXEA 2NZVG 2ZETA 1NRXA 5J23A 3EPLA 1ND5A 2A7QA 3DMTA 3TGWA 4ILEA 4BGEA 1XG5A 2O20A 2JGEA 4IDFA 4A0QA 4TYNA 2B99A 2PIDA 1USUA 1JKFA 2XVZA 3E03A 1ZI6A 5LDDC 5B6JA 2JD1A 1KBZA 2A4MA 2OUIA 3EN0A 3I01A 5H7XA 4GM1A 2ZBQA 4IV0A 1DI0A 4KKVA 5CEFA 2W2LD 1NVXQ 5KVAA 1N1DA 1SVNA 3CG0A 2Y4NA 2W5UA 3ELYA 3ESXA 1N9GA 3HR8A 3PXBA 4G1CA 3OJOA 4IIVA 3IUBA 3IUJA 5NULA 3RRMA 5HCNA 4Z4EA 3DLCA 2QE6A 4GOMD 3L05A 3WB1A 3CT4A 1NSTA 4Y2SA 1RW4A 2HQRA 3AR3A 3IESA 2JKZA 3LT5A 4OHFA 1EB9A 3SC2B 3ZWAA 1DIOB 1P44A 2GBPA 4ZRMA 3L7IA 1ZUIA 2MSWA 2BISA 4U0JA 3SI7A 4AJ2A 1UIMA 3NYQA 4DT1B 4F06A 4DDUA 3VPHA 2C94A 1OFUA 4OK6A 2HUNA 4FEYA 1OR8A 2YOHA 3PC8C 1SKYE 3PRKE 3C0KA 1AZSC 3AEXA 1PNRA 1SUEA 2X42A 3K2EA 1N77A 2ISCA 1PG5A 4BQIA 3L6UA 4EGSA 1FMTA 4XI9A 421PA 3P9KA 2ZTMA 3LLMA 2I66A 4N5DA 4CDMA 1OZAA 1P1JA 3GCDA 4W63A 4OB6A 2IXTA 5BNWA 3SC2A 1LWNA 4KBGA 3U13A 5T6MA 3ZDCA 3DMRA 3W06A 1WV1A 2NXWA 3WL4A 1TM4E 2IU4A 1RIIA 4DT1A 1A76A 2WIKA 2YVKA 3FLAA 3HU5A 1IBSA 1JPNA 5CDHA 1SHJA 3BJZA 1MFPA 1ACLA 1XCLA 2AG5A 3BGWA 2OA0A 2F3UA 2Y9PB 1SXJE 4E2XA 1W73A 4PIVA 1RYHA 1USVA 3OJLA 1PR2A 5HMLA 1OGJA 4FT4A 5FI5A 3DE1X 5C1PA 1TM7E 2ZJBA 4XWWA 3JVUA 4AS3A 3FRJA 3L7YA 4V0OA 3HSSA 3BXHA 3WNDA 1BCRB 5K03A 2QTFA 1F9AA 3ET4A 5E6SB 3SPXA 1WXGA 4MI3A 4X92A 3T3IA 5C2JB 3U4QB 1FUEA 3DDUA 4A27A 2C3YA 4P4TA 1GKIA 4GG1A 1GDTA 3TNFA 1XEFA 2ZB4A 2BTOA 3ZJ5A 3CJQA 1PWZA 5DMXA 1JDPA 4TLLB 1IB0A 3DF7A 2FJ0A 4LCEA 3CO5A 1A8IA 1B73A 1BRTA 1LVGA 2XX3A 3EAQA 3ZGYA 5BYJA 2IEGA 3TCKA 1E1QA 1YCGA 3P9CA 1RXCA 3QJGA 1KF0A 5A5DA 3CLSD 1CEQA 2C2MA 1ZZEA 4MLCA 3FNFA 3OZFA 3ETEA 2FHSA 4A15A 2R6ZA 4UDYX 5E6SA 5I7UA 3R0QA 3PT9A 3T1QA 5HM6A 3VPGA 1UT6A 3U4QA 3DL0A 4YC7A 5KVSA 3ZQUA 5A5GA 2MJLA 4M9SA 2ZRAA 1GO2A 1J2JA 1XROA 2BGNA 4XFKA 1C9YA 3GP5A 5JY6A 1LTKA 2FR1A 2GCOB 3OWXA 3S2ZA 4CTKA 3VHQA 3OBBA 2UZ3A 1GIAA 5TARA 5DRYA 1U1EA 3DMPA 1B3BA 3CZQA 3HABA 3WMXA 3EIWA 3DQQA 4C0HA 3PGKA 4NHEA 4LK2A 3EZGA 1YCFA 3QK7A 2XB6A 2RE8A 1KZ6A 3KTOA 1YASA 2FMUA 4RLSA 5JD6A 3IHTA 4JKOA 4NBVA 4L72A 4KFUA 2ZJZA 3MCAA 1RIFA 2AFHB 1OX4B 2CUKA 3AVPA 1X87A 3WK4A 1RT9A 3NOQA 1OY1A 1PX2A 3T3OA 1JQBA 3CNLA 3DPSA 3LC1O 4EHLA 4MICA 4NNJA 2BCJQ 1C4WA 2CLOB 1LI4A 3EIOA 1QANA 3OCZA 3I5YA 2H08A 4ZV7A 2CLFB 2Q9CA 3SU8A 4HEA6 1W4RA 3KSUA 4N40A 4EB3A 3W7VA 5CVUA 3VPFA 1NL3A 1HA3A 1X86B 1XUOA 3ETJA 3QYPA 4DCJA 1NDHA 4CQJA 1F7VA 2IODA 4AS2A 2LP4Y 1TLFA 3DAFA 4ZO4A 2ZJFA 4E5NA 1X6VA 1JYEA 1GEEA 3HS3A 2IV2X 1L4KA 2UYYA 3MYRA 1PWYE 4YACA 4L8LA 3VR3A 2I3BA 2AFHA 8ADHA 2XAAA 4EAQA 4ER0A 3G2KA 4A1FA 1OH5A 4YS6A 5B12A 1O89A 3HP1A 4EJMA 5B3LA 2HC9A 5IJ9B 2DETA 4QQNA 5EMKA 2F8TA 3N3AC 2BGGA 1JJFA 2BC9A 1NBOA 2XNKA 2F43A 1Y8QB 2A4KA 3HVUA 5KC9A 2VZ9A 3ZVNA 2O19A 3PCRB 2AKYA 3LPMA 1DT5A 2R8YA 4H4EA 3ZWDA 1DBQA 2Q6OA 2BFEB 2RCNA 2WWGA 1U80A 1IPHA 3FBTA 4I9FA 4PY2A 3S7TA 3ND9A 1TC2A 2BRUA 5LU9A 2AZXA 5FL7D 2JLRA 4LNUB 1OAOA 1QUEA 1IONA 3W2HA 5KNLA 3F5FA 2O8DA 3SZ3A 1ZSYA 3F3MA 1XTZA 2O5VA 2OWEA 1B1CA 2A14A 2JVJA 4Q7LA 4HPXB 1AKEA 4BEJA 2HWWA 5IJ9A 4XDYA 1HV8A 1Q12A 3U9TA 1LLUA 1TVMA 5EERA 2H9IA 3EW7A 1RLUA 3HUFA 2L17A 2BBWA 3U0VA 3FOZA 1DCKA 1ONOA 1Y8QA 2PQ0A 3C7CB 3O95A 3Q41A 2WF9A 4MV7A 2NZXA 1GPNA 4JR2A 3VSEA 1WMAA 5AM5A 1E1NA 4P3XA 1JXQA 4C6SA 5IC4A 3V4LA 1JYFA 4YJGB 2ADMA 3DOFA 2JFZA 1T8SA 2TYSB 2WILA 1NNI1 1C9DB 5K01A 2R5FA 4K8RB 2JFUA 2ZDQA 3PNYA 4JDUA 4LNUA 5CT5A 2D7CA 2ETVA 2I7TA 1ZSVA 3RE1A 3DDHA 5EFOA 4B2LA 4QLBA 3SNKA 5J40A 3V5NA 2CZCA 2KLBA 4XQCA 5B5SA 4IZOA 1UPFA 3K1ZA 2PPVA 1KEVA 4CJXA 2AJBA 3H5AA 1WXEA 4UCQA 3VKHA 5HK8A 4V1CI 3GWGA 3GRCA 1KEPA 1GCAA 1DDOA 3AL0C 3B1YA 4G4SO 1M8PA 4G0NA 4IKPA 2W6CX 2D8AA 2X23A 3RABA 3DUWA 3U81A 2XH8A 3FROA 4JP5A 4KR7A 2F00A 5DF1A 2Z58A 1TTPB 3OLVA 1QPGA 1S96A 3URMA 3KQLA 1U0FA 2QRKA 1XZBA 5H9WA 2GJ4A 1HQKA 1XDDA 2FDXA 2IYWA 2P35A 1KJ8A 3JASB 3L06A 4WNCA 1FW8A 3P7MA 4QJ5A 4BCBA 4DLYA 3DP7A 3I1IA 1ZM3A 1OBOA 2JVKA 1YS6A 2EZ4A 3MC1A 4R68A 1EJBA 2CUTA 1N9KA 2HLNA 3PWTA 5THKA 4EG5A 1KSJA 3E1GA 3PE6A 1VG0B 1FF9A 2C2OA 1N75A 2JK1A 1Z12A 2BFWA 3D7NA 4KFSA 4CIBA 1JU9A 2WM3A 3IQEA 1NWHA 2PTHA 3AM5A 3CH4B 5E2AA 3S27A 1DU4A 2EL7A 1QORA 3LRXA 1KYQA 1YB5A 4WDQA 5ALOA 4D3YA 4HAZA 5FBRB 3JASA 2IT1A 4HRXA 2H7CA 1PFVA 3EXHB 3ZZUA 3C6KA 3VKFA 4EFKA 1W30A 2IH2A 2APJA 5A5FA 5HCUA 4KK4A 2XWSA 1PJ4A 2BW0A 3OBIA 5AK0A 4E5UA 5KUTA 2F3PA 3E8XA 3BRSA 4UHEA 2R6AA 1USWA 3QH4A 1RZRA 1C2YA 4CQNA 3UJAA 2WSYB 1K06A 3BFPA 2DCUA 1LS1A 1Q11A 1VSUA 3WLOA 4DSZA 2WIBA 3DDWA 3KYDA 3T7CA 4OFXA 3WJ7A 1SU4A 1NSYA 3AV0B 4I2VA 3EXHA 2OOSA 1EHCA 2NN3C 2YC4C 5DHTA 3NOXA 5DGCA 4B7UA 4CKBB 2J0SA 3RFVA 3WLJA 5T4BA 1ZHOA 3CPHA 4TZ0A 4ED9A 2HBYA 1QYXA 1U3TA 3PTZA 4KK3A 3C39A 4UBOA 1THZA 4YIHA 3GEPA 1TM5E 5JCOA 1WRBA 1SWVA 3U61B 1AY0A 1CUCA 2JF0A 3NBXX 4GRIA 4HRAA 3NIWA 1GU1A 4JLNA 1QKKA 4I4CA 4Z5XA 1VYTA 4U5XA 1VCMA 2FSVC 3KHUA 4L3WA 5B37A 4U2KA 3CCCA 3SYRA 4RQTA 1ID1A 1G0NA 1SM4A 1U9ZA 4NARA 1NNSA 2HA0A 1EVLA 2O1XA 4G3XA 1TW3A 1KY2A 3A2MA 4EYQA 1TQ8A 2Z2YA 4LUCA 4CKBA 1VTKA 2CXOA 1KK0A 4L6IA 8ABPA 2P6RA 3GEBA 1BQ3A 2Y0DA 3H2SA 3N8KA 2WVHA 2UV8A 1A1SA 5LBIA 1MX3A 4J6FA 1EFUA 3E0XA 5DN9A 4CL0A 5GVSA 3IEVA 3ESCA 1A82A 1IM8A 3OPNA 2IHKA 3CW2A 2XUDA 1TLTA 2ZR0A 3G6WA 1ONNA 2SICE 3SS9X 3TTUA 3RSZA 1QAOA 3P9ZA 4V3BA 5KKCA 2XXAB 2JG3A 2FRXA 2O23A 4LOLA 1C5KA 4GF5A 5B1YA 1I10A 1NW3A 5CLGA 1HE3A 2OO3A 4CTNA 3MPUA 4ENUA 3B52X 3ABQB 4P3NA 1XVLA 2GN8A 2HF7A 2PSFA 4Q4JB 1OXMA 4QU0A 1PDWA 1RHKA 3P96A 4JLUA 4CG3A 4RCVA 2SBTA 1KO7A 2IYTA 5L3SB 2HMAA 2CUZA 1AHHA 1SC9A 1UJ4A 4B6SA 3TL2A 1C4OA 4OTZA 4XDZA 4FSHA 4Y0NA 5LZ5A 3CHYA 2IUEA 1U7UA 3V1TC 4CIAA 3NZEA 4JX9A 3PRHA 1DV1A 5A9TA 3X1ZA 2QRJA 4RV5A 3TX2A 4E2WA 1HMPA 3TBHA 4MQ5A 2BCEA 2C96A 4N01A 4NE9A 1KL7A 1XTVA 1Z2EA 4GEGA 4NXMB 1KU0A 2QJRA 2Z04A 1IEXA 4JGIA 1CT9A 2K2QB 2WA1A 1MOPA 3F6SA 4IIFA 4UE6A 4WD3A 3W34A 5G4KB 4BNTA 1SIBE 5L3SA 2HDOA 2X9NA 4XX1A 2C2GA 3AI3A 5EESA 1L5LA 3PF8A 3G5LA 2ZAMA 5JDIC 4BFCA 3W77A 5ERGB 1SZDA 4IHJB 5K3SA 5IDVA 2JLVA 1SURA 3WBJA 5B6IA 3MRXA 5C53B 3L7CA 5LC1A 2YMQA 3M2TA 5FBVB 3SZGA 1K5GA 4QTXA 1NVVR 1VKRA 2FZCA 1QVRA 1YAHA 4A2WA 1WG8A 2M2IA 4LJSA 3P32A 1D9ZA 5JC8A 4I08A 1ZR2A 1A2BA 4F4JA 1G59A 1BMFD 4FFVA 4K9LA 1A7KA 3G1WA 3K0KA 3NOVA 4J0CA 4RO0A 3RREA 1XD2B 3NVKI 3KVNA 4G5XA 1FCJA 4EK9A 4KLZA 1M33A 3A10A 3GLKA 3H1FA 1SBQA 3IAHA 3Q2KA 1W6UA 4IHJA 5L3QB 3KETA 5A0VA 2P9GA 2B4AA 4Y2HA 2PLRA 4BVAA 5LIRA 2W2PA 1ZHHA 2I4NA 2HLPA 5E0OA 5JR3A 1BO6A 3JAKB 1YJXA 4MUMA 3QVXA 3S81A 1QZZA 1ZJ5A 2QR3A 4J9VA 5A06A 1U7TA 4GPD1 3LPAA 5C1OA 4QBFA 3CO0S 3VSBA 2VC2B 4OQMA 2IHTA 4D9BA 1E9BA 2JJ1A 3AB7A 2VH5R 4HEJA 4HSEA 4CMIA 4MVJA 1XD2A 2H51A 3CFYA 2VDWB 3BL8A 3AOEC 4P08A 4EZBA 4OQ4A 2GN0A 4ALJA 5L3QA 4FFNA 4IMPA 1MW9X 1GPKA 2H4XA 3EC1A 3OHPA 1UZLA 3JAKA 3EH2A 1Q2UA 2W2TA 3VR5H 3DOEA 2VNJA 3M83A 4LYYA 3P97A 3DGEC 1JDVA 4TKLA 3T0IA 2AK2A 4W7HA 1GR1A 3LK7A 6PFKA 5JFGA 1YVDA 1TQ6A 1KYIA 2ZR8A 3BA6A 3LQYA 3OM8A 3B60A 3FPHA 3OQ6A 2X2EA 3Q7SA 4M8KA 2P2SA 3GGCA 4OQEA 1T36B 1DC6A 3CINA 4JQZA 3MSCA 4QOGA 3Q8MA 3U7IA 2HCTA 2LRHA 1G19A 2FN3A 3FSJX 4G5OA 3DULA 4ZQBA 1RAAA 3M3HA 2ZRKA 3DM5A 5LA6F 1KQPA 1KJYA 4IEIA 4B6GA 2CYCA 2UXDB 1UBTS 2BKEA 3H4MA 4AU1A 4MW5A 1FTGA 4B48A 5JAOA 1NX9A 3B5JA 1VDZA 1V71A 5CYPA 1U0HC 2M1ZA 4F86A 5JPDA 4GBED 1T8WA 3FCOA 1TCVA 1ZGJA 1C9EA 2QM8A 3W1EA 4YLGA 3M4XA 1M34E 1IMOA 3VNSA 2DC1A 4MX8A 3O1HB 1E0AA 1T36A 2BF7A 1H0KA 1HFEL 2WYHA 4RKRA 3RJ9A 1ORRA 3AT1A 3DMNA 3N8DA 4L5BA 1A7AA 2REOA 3AHIA 3T52A 4YRGA 2ZU0C 4FCVA 4KE8A 1E3SA 3ROKA 2HJHA 4LRUA 4BX3A 1KI7A 4UXIA 3VAYA 4D41A 3I37X 4QRIA 1CUFA 2Z2KA 4ZVSA 4ZCIA 3WGHA 4PQYA 1GTL1 4FYXA 1VPLA 3HLYA 3IV6A 1G18A 1KOGA 1Y98A 1IAVA 1BFDA 1BMTA 2E9SA 2EARA 2FPIB 2PIAA 2QAIA 2Y1LA 5EEHA 4YAWA 5DNYB 3QELB 2IP4A 4ZZ2A 1UL1X 5JBQA 4IIHA 1X8XA 4Q3LA 5KYWA 1RP1A 4A03A 2JHCA 4TXNA 2BI7A 4HDSB 2WZDA 2YYAA 4YRRA 4EATA 1OYYA 4HBGA 4M76B 5DBOA 4C20A 3LTEA 2IYYA 3BHIA 3CW9A 3LUJA 3C41J 2R7MA 1JDNA 1P2TA 2VDUE 1X7WB 4UCFA 4YCJA 5EY5B 3UK7A 4MNTA 1CZNA 2XKAA 4P8RA 5JSUA 5FEMA 1ATIA 1G8MA 1YA8A 2DWCA 2ECKA 2XRMA 2GKGA 2JI4A 4M89A 2X14A 4IAOA 1ZM7A 3SDBA 2DLCX 3V8QA 1R0KA 5JRDS 3ZGVA 2QVCA 3NO4A 4L4YA 4XFJA 2HZBA 1JH9A 2FPIA 4NICA 2C2YA 3O2QB 3QELA 4IILA 3VVMA 5BW8A 3C3MA 4O5AA 1V26A 5AKJA 3T7DA 3WNZA 4E2ZA 1Q83A 5LOVA 1L7EA 4HDSA 4I5FA 4YJ3F 2PBFA 2XNJA 1T0BA 4B5KA 4FB4A 4NZOA 1G5FA 1AJEA 2XZLA 3SJZA 3FYDA 1FSZA 1ESNA 1Z4QA 1BZYA 1EVQA 2EBUA 1ZRSA 3MB5A 4BNUA 2OHGA 4LXYA 3QEJA 5DH9A 5JH7B 4M99A 5LDGA 4TQ9A 1OBHA 3HDVA 1QCZA 4GYYA 2Q4BA 5GZ3A 2BBOA 1MAHA 2J6BA 4WY8A 3U09A 2ZIXB 5JTTA 2GK7A 1HT2E 4KN6A 4J1SA 1RQLA 1GA6A 3BILA 2VK2A 4JIGA 1DTWB 3GFSA 1K8XB 3M49A 4PFSA 2VHYA 1OWMA 3RS9A 1GVNB 4D6PA 4DJTA 3DLBA 1IVSA 4AZ0B 2FRDC 1OXXK 1DXHA 1E1RA 1G8FA 2A9VA 3QGMA 4LSMA 4MJ3A 4OGLA 4ZO6A 3V9PA 4JYZA 1SVUA 5I4BA 5F64A 2DEUA 1PS9A 5JH7A 5KVCA 3I53A 2B0CA 3TSWA 1GPLA 1YXMA 2C04A 4Q1DA 1VM6A 3D4OA 2EIHA 1UWCA 2GJ8A 4EVSA 3FSGA 3ZCRA 4HZUB 2ZIXA 1XWWA 4ZCQA 4JI2B 4EZIA 4C87A 1MQSA 4BWVA 3CSSA 1H1LB 1XPJA 3BXZA 3D8RA 1CHNA 3PBKA 3UMFA 2YIVX 5IAGA 1TM1E 3M6UA 4JY7A 1PZXA 5EVCA 3RIYA 3O6VA 3GPDG 4AZ0A 1ULUA 1UQUA 2FPWA 2WSBA 2YRFA 1UM8A 3H1BA 4ONEA 2R1UA 2RFLA 2D2FA 2PL5A 2FZEA 5B2ZA 1DGQA 4GE0A 3EWIA 1E61A 3PS9A 1TECE 3A0UA 1ZD5A 3QWAA 1TYEB 4ZYZA 3ACBA 3OVMA 3AFNA 4REOA 2YJTD 4WUVA 4NBKA 1SRQA 1FDTA 2G3YA 2ZUSA 5I5EA 1RKVA 1QFYA 1WMFA 3AXSA 1V0JA 3KE9A 3BQNB 2OO5C 2E7ZA 1ISSA 1C3OB 3B3QA 4RPCA 3MJFA 3KR9A 1V48A 4M0LA 5CLLA 4IG9A 1OT5A 2WTBA 1E7WA 3AVVA 2FUNB 3ZWOA 1PZEA 1J7JA 3INYA 3PG5A 4JP2A 4IWXA 4OGGA 4P92A 5AR1A 5G2OA 1PYDA 2IH5A 2SNIE 2VUUA 2WG0A 4MGIR 3RRFA 3AVUA 3RVLA 3HWX1 3JY6A 2DE0X 3FMOB 1H0RA 3ED1A 4EHJA 1ID8A 5I7WA 4ND7A 3OICA 1YL7A 4UCWA 1HY3A 3EOBI 1Y6QA 4UTZA 4XRGA 4KDFA 2Z6UA 4GVPA 1MJFA 2D8MA 1SPXA 2AF4C 5MF6A 2B3DA 1C1XB 2WVGA 3CVOA 4WXHA 1PJ3A 1YR9A 4L7QA 3CRNA 1RYZA 5AJTA 1KSGA 4EI2A 4YQFA 1WBBA 1C3OA 4DKJA 4HNGA 2DFVA 3I9JA 1V39A 1Y6GA 3OLYA 2VWGA 4M9RA 3W0LB 2VA8A 4FKBA 1FYXA 3N0VA 2ILVA 3MCWA 1EAYA 3CR7A 2MOKA 3QIVA 3ZNQA 1OIXA 1F2VA 2ZI4A 5C8XA 4W8GA 2Z3VA 3I3OA 2J67A 2XPCA 5I7HA 5K4HA 4LQLA 1V1RB 2VNHA 3GFOA 5IJ0B 5CVCA 5MDHA 1IK6A 1JJVA 4FNOA 4JJ8A 3H5WA 4TTIA 1OFIA 3N86A 3PEEA 4UD2A 4X6YA 4A2CA 3EQ9A 4Y2RA 4D9FA 1NYLA 4WK4B 1RRGA 4M0PA 2CHFA 5KQPA 1T43A 2HMUA 3F7TA 1S01A 3FF4A 3ZDYB 2XUAA 5KHLB 1CF4A 3KJNA 3O82A 5IMSA 4GS5A 2VKTA 4ZXPA 5F7XA 3KQVA 1C3JA 3M7IA 4L08A 3M4YA 2PY6A 3HH8A 3O4VA 4QQRA 1F3LA 3GI1A 2DPMA 4NWIA 2O8NA 4IZIA 1Q1ZA 3JTMA 3TGPA 1V1RA 3KTAB 3VGJA 5AD1A 4RD2A 3M5PA 1ZK2A 3M6FA 1SCBA 2VHQA 1FOEB 3H1PA 4FXOA 3HDHA 4J0GA 4JL6A 4MDEA 3JR7A 5IYZF 3SLRA 1ST3A 2RAFA 3P0JA 4QGHA 4MMXB 1P1RA 3P5SA 4ZJYA 1CFZA 1Y7LA 3DNMA 3FPSA 3B3FA 5DASA 3FXAA 1M72A 2HDHA 1K97A 1Z2PX 4J16C 4DMHA 2PH1A 2BFFB 3QITA 4PPNA 4WZZA 3ETDA 3QV1A 1OLUA 1OU0A 4NJOA 1PHRA 3OTOB 3WLQA 2ZAIA 1WMSA 3HBFA 3KTAA 4ZREA 5C1DA 2JFWA 3KQWA 1I2MA 1O94D 4QPCA 2PUCA 5CLQA 4AP5A 4B32A 4UREA 2Q9UA 4CYMA 1LVHA 2XQGA 5BN3B 3BZWA 3KK0A 3NH9A 4B7XA 4MI1A 2G4LA 4NAVA 4KAXA 4B3IA 1ZMXA 5E4YA 2CNBA 1UBRS 2VPWA 3PYLA 2WIFA 4Q9IA 3WWYA 5K0ZA 1ECPA 1RHMA 4PSCA 4QQKA 2QX4A 2BFFA 3TM4A 2VO1A 3MG9A 1H05A 1BXGA 2YC2C 1JFLA 4UHDA 3RS8A 1TT7A 2IKQA 3A6FA 4Y3UA 1EFKA 3C98A 4XWTA 1EM8A 3A1DA 4I9NA 3SFTA 4YR7A 2PMKA 4RY0A 4Q3EA 4FGKA 4M0FA 2QMOA 2OESA 4LOIA 3LLUA 3TAHA 4EARA 1SIOA 3VDQA 5BN3A 3VQTA 5J4VA 1B3RA 1AGYA 4HLUC 2IXEA 3GEEA 3L8FA 3OO1A 4WADA 3VYRB 4DCNA 4ESHA 1PL0A 4H35A 1X15A 4YVFA 1GITA 2Q6LA 5LD2C 3AIOA 1OJLA 3I64A 1NR1A 4DUZB 1DNPA 3ZV3A 2PU5A 1J9GA 1UZMA 3ZDDA 2GBFA 4C0XA 2TSYB 2PPLA 2B7LA 3HUDA 3GEDA 3B5IA 4PYMA 3F6PA 4G5GA 3I0MA 4NDAA 1W36B 2RIPA 2EWVA 2A1UB 1JHPA 4KQXA 3VR6H 4YTEA 4QT4A 2ZUEA 4YRFA 2P75A 5D84A 1CDZA 2LIVA 1QP7A 3BPSA 4IRXA 5ALQA 2Z9BA 4LRXA 1SPBS 1SUCA 1C41A 3HYNA 5T4FA 2WT8A 3MRVA 1PNOA 4ER6A 2VA9A 3I72A 1U0JA 2D5IA 3INRA 3LD9A 4CHGA 4DV1B 1HDGO 1FDIA 2R6FA 5I7RA 3I28A 4ML3A 2WD7B 3ZD6A 3VOTA 2QNRA 4HL6A 2BGWA 4AW9A 4KXWA 4JI4B 2WSLA 1U0BB 2ZDGA 2WP0A 2CHGA 4K9KA 2A1UA 3Q11A 3ZD7A 4K2HA 3LPCA 1VYUA 3FUXA 1LNSA 1XFAA 2PTGA 3CLTD 4PBTA 4DQKA 1W0JA 3Q5GA 1R64A 5FWDA 3RS0A 5TPWA 1XEWY 4U7GA 1QCCA 4E13A 4LFAB 4Q7JB 2JBAB 4UU7A 3OZSA 1WKCA 2Q9BA 1THMA 2HMWA 3IAM1 4HNSA 4RH0A 5DTEA 5FP0A 3TQTA 4FFDA 3JD4A 4ZAGA 1F0KA 1X1AA 3FIUA 4FXPA 1HBJA 2XBMA 1ZNYA 2WD7A 1AMUA 2VKQA 2AYYA 3CRMA 3FDXA 3ZDRA 3ZZ1A 4L3OA 3O7WA 5J58A 5IKOA 2H4JA 4GZ6A 1A0OA 2I4OA 3ED5A 4GEKA 4X91A 3RNOA 2JFYA 1XDGA 2KI5A 3CEMA 1KWGA 1THGA 3P5BA 2JBAA 2X0DA 2JJQA 2A9KA 2X8AA 2PD3A 2P40A 2WP8J 3L1UA 3I9MA 7MHTA 2B1RA 1OIWA 1YNSA 1JPUA 3O8CA 4PLGA 4TTVA 3SZRA 1F5SA 3WLHA 3VKUA 1JA9A 3LUDA 3A9UA 4NCAA 2H1IA 3DT9A 1UBOS 2VQEB 5FPSA 3S40A 4GYKA 4NXNB 2J0VA 5DMHA 4KTTE 1OTXA 2GF0A 4Y2JA 4D9GA 2R7KA 1CSEE 4R0MA 1MOSA 2V3CC 1CY7A 1NWCA 4HWRA 3NS7A 2QW0X 4U63A 1JTVA 2VTDA 3DLPX 2ZJ8A 3NM4A 5AVYA 1PWEA 1GA4A 2WICA 3AF1A 3AI2A 4KMMA 3F4BA 3Q0IA 5AUOB 1QE3A 3L43A 4GI7A 4R83A 3CRZA 1A97A 3NXKA 1ZKMA 1W96A 2LW7A 2NVUB 1XOIA 1US8B 3VU0A 1Q16A 2AC4A 3CU5A 4QXAA 2YWCA 1KFCB 4KPUB 1CETA 4YWJA 3F96A 2Z0MA 3CLHA 4MRSA 1Q44A 4WKCA 5DLEA 3TCNA 2QRQA 4Z7QB 1OI7A 2UVQA 1B2LA 4CIVA 5FH9A 5JSHA 3LUKA 2E4ZA 3FE2A 3PNOA 1XLUA 4N41A 2L69A 2K6GA 1AKUA 2BHSA 2FFRA 3RHFA 4NMMA 4PXSA 4LECA 4EG7A 2RB5A 2WJ4A 1CQWA 4DV2B 3HN2A 1HK7A 4HJRA 2YL2A 1E7SA 3Q8XB 4R54A 1AHNA 1VLMA 2Q7DA 1JQDA 2QUZA 5BW4A 3RG2A 3OKCA 4YEDA 5KJFA 2Z3WA 1PR3A 1XTQA 2NVUA 3WLTA 1US8A 3R7WB 1GGEA 2EGGA 4FYWA 5H9VA 2P4UA 4KIFA 1Q84A 2P6OA 4KPUA 1YVUA 4F91B 1TU3A 4PAQA 5KDDA 5BSTA 1K92A 4WDRA 2IY8A 1DAIA 3EZ2A 4HXGA 4ZOAA 3FPEA 2VHEA 3BFVA 2O2CA 3DHNA 4YA6A 3VZBA 3ISVA 3OX4A 4BPBA 3DA8A 1QR6A 3B2QA 2RC6A 4E2FA 5IXJA 2IELA 4BTVA 1MA3A 5I8WA 1B8PA 3O4FA 5H82A 1YE8A 1MORA 2FWIA 2E0IA 3AP1A 1FQWA 5J5AA 2PGAA 2R6DA 4B35A 3MQFA 1UK7A 1IDOA 3VH3A 1WE2A 5DHRA 3ZQKA 1AKWA 3ESRA 3R7WA 3MJSA 3GBPA 3OLXA 3C8DA 1G5IA 4JQOA 4RHFA 3KV1A 2QDKA 2BMVA 3A3NA 3QV2A 4ZPJA 2IW1A 3C3BA 3MUOA 3R7DA 3TLYA 1XEAA 2ZSBA 1CDEA 4KXVA 4ENQA 5FYQA 1QHGA 2ADFA 4PTYA 2YMPA 2H1LA 3V4OA 2J3QA 1TMKA 2DBZA 3NRBA 4HUJA 1NURA 3A4NA 3C6YA 3VC1A 5GJCA 1K7YA 4CLRB 3CH6A 2PVCA 3LZCA 3O47A 3GGPA 5TQVA 5F4ZA 3W5CA 3KEFA 3OWOA 1OW3B 2DWQA 2BEJA 3WGMA 2E82A 4KCGA 4P4NA 4P82A 3HV0A 4KGVA 1BU8A 5BSFA 2UUBB 1A96A 2Q2QA 5KNCA 2JZOA 1QQTA 3UWSA 5L51A 4MB6A 3UGTA 1OPXA 4ZC8A 1C3EA 3HKDB 1XMPA 1E99A 2OP1A 5GPBA 2VI5A 3JZMA 1LBTA 4LSZA 4CIYA 3IIMA 1M75A 5FBLB 4DCOA 3NYWA 4A8JC 3ZEAA 1GKLA 1M5TA 3CE9A 1DJQA 3GVCA 3OA2A 4BAUA 4Q7MB 5H3CA 2XRZA 3W9YA 3KZVA 2LE0A 4BYMA 5ADWA 2CV1A 5CK4A 2NW6A 1NLMA 3PRJA 4CV1A 2N75A 2IOFA 5EXEA 2BDTA 1SUSA 5DHAA 3QXSA 3T5MA 4CU2A 1XB2A 2Y77A 5CFLA 1WDTA 3FFWA 3MOIA 4ABYA 1L5MA 1T29A 1SCDA 1Q1EA 3HKDA 4YAUA 1DC3A 1DBRA 1RRPA 4PHGA 4RH1A 4G0YA 1W2GA 3C43A 3CVJA 1VE3A 2ZCUA 4B46A 1RC8A 4ZK2A 2C8JA 3GEHA 1UBNA 3LDFA 4OHRA 3P9XA 4EPVA 4EMSA 2UZIR 5J4YA 3DL4A 4OSOA 5E3HA 1YR8A 1E4YA 5D6NA 3ZIAA