5JWRA

Crystal structure of foldswitch-stabilized kaib in complex with the n-terminal ci domain of kaic and a dimer of kaia c-terminal domains from thermosynechococcus elongatus
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
233
structure length
231
Chain Sequence
EVKKIPTMIEGFDDISHGGLPQGATTLVSGTSGTGKTLFAVQFLYNGITIFNEPGIFVTFEESPQDIIKNALSFGWNLQSLIDQGKLFILDASPDPDGQEVAGDFDLSALIERIQYAIRKYKATRVSIDSVTAVFQQYDAASVVRREIFRLAFRLAQLGVTTIMTTERVDEYGPVARFGVEEFVSDNVVILRNVLERRRRTVEILKLRGTTHMKGEYPFTINNGINIFDYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Circadian clock protein kinase KaiC
publication title Structural basis of the day-night transition in a bacterial circadian clock.
pubmed doi rcsb
source organism Thermosynechococcus elongatus
total genus 78
structure length 231
sequence length 233
chains with identical sequence C
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5jwrA00
1FX0B 1OXTA 3A4NA 4UXJA 5EE1A 4C9BA 4NH0A 2P5TB 2ZAMA 2F3RA 5HCIA 4ON9A 1W4AA 4LPSA 3FGNA 1GL7A 3THWA 3HDTA 5HE9A 4AKEA 4AURA 1GRQA 2UVQA 2VIIA 3OHMA 4EUNA 2WOOA 3T1TA 5CYPA 1E0SA 4HZUA 2IF0A 4A36A 1N6KA 1Z8FA 4BEJA 1PVOA 3EPHA 5GJBA 4KFUA 5BQ5A 2ZYUX 4M1TA 1VECA 2CLSA 4GPTA 1RRCA 5CB8A 5FUVA 2GK6A 2P67A 2ONJA 1EX7A 3K8YA 4DT1B 4QHYA 4X8HA 3OE7D 1MO6A 2XJ4A 4AYXA 1CIPA 3SHWA 1BIFA 4LHZA 1TEVA 2EW1A 1XTQA 3WYAA 2OE2A 1DG3A 4OQXA 1D9XA 1YR8A 4Q19A 1EXMA 1JALA 3P32A 4LV8B 3ZZ0A 5ANRB 4F4CA 3RS4A 4G5RA 2HCJB 2QMUA 4WZBE 4ZCMA 5HKKD 5KHOC 2O8DA 2PMKA 4GDFA 3AVTA 4F91B 1RJ9B 1ZUIA 4ABYA 1M74A 4BFXA 4M9SA 3U3KA 4C0JA 1II8A 4JLKA 4PO1A 2VP6A 1R10A 3KB1A 4JL8A 1CBUA 1U90A 4JLNA 2EWWA 1Q20A 4PPQA 4RD0A 4NCIA 2DPXA 3IBGA 1VMAA 2CK3A 1MRSA 1G7CA 2B21A 2PMDA 2QGZA 1E2HA 5DSZA 2QBYB 3VR6A 4M53A 1XEXB 1IJEA 4E5UA 4PZYA 3Q9LA 5BN3A 1I4LD 3H84A 4BFZA 3MG9A 3SE0A 1EWQA 2BKUA 3TIFA 1AZTA 3REFA 3DL0A 1EWRA 1MO3A 3BIFA 1NVUQ 2YYZA 1E9AA 1Q44A 1ZVQA 5FOTA 4BLTA 1TU4A 4D0GA 2CLCX 1A5TA 2WICA 4OHWA 4TMXA 2QT0A 2DHRA 2OXRA 2I4IA 2PCLA 5H1YA 3SFZA 5F98A 4NYIR 1TF2A 1NY5A 1AGPA 2QENA 4IEIA 4JJKA 4TYPA 2O8CA 2QAGB 2QPAA 1PUIA 2QAJA 3B9QA 5KSPA 3KQHA 4OHZA 4S35A 2V1XA 4M1SA 3HPQA 3U60B 4AG6A 1N6LA 5TY0A 4DRZA 1HE8B 3UG6A 4EJSB 1G3IA 2P5SA 1KMHB 1ZM3A 4BLQA 1AN0A 1SULA 1OLOA 2W0SA 3T34A 2Z6VA 4FMCF 2X2FA 4DIEA 5CLQA 1XU4A 4LHWA 1R5OA 1WE2A 5EXPA 3LVQE 4P4SB 5FOXA 2WAXA 2AR7A 4Q03A 3C15C 3AH8A 5CM9C 4TZ0A 4NPHA 3SC3A 5AK0A 1HA3A 1D8TA 2BBSA 4GOKA 4TYNA 1XBTA 4FINA 1XXHB 4JVLA 5CLLA 3GEEA 3U4QA 1ONBA 1VCMA 4JLOA 4EPVA 1Z3IX 3IILA 1XZPA 4DCSA 5F9HA 4B75A 2EFHB 2RHDA 1SKYE 2ZRAA 4A0RA 3U7EB 2CHQA 1RYFA 3QSYA 1N6IA 3U44B 2MSCB 2W6JD 3VKHA 5BN4A 2AXNA 5JLJA 1PLJA 4PAOA 1U9IC 3GMTA 4I1UA 3TMKA 2QI9C 1E2PA 3D8BA 1ZNYA 2QA5A 4N3NA 4D25A 3R9XA 2G6BA 3BH6A 3WXMA 1AS2A 4G5QA 1CS4C 2C95A 3QG1A 1JAHA 3IDQA 3NVAA 2YWEA 3GLFB 4HB2A 3CZQA 4POAA 4B34A 4PTLA 1L4YA 2ZTSA 4B73A 4EQ6A 4BUJA 2ZI6A 1EFTA 5JFGA 3GLIE 3EG5A 5JCZA 2IXGA 1Z6YA 3LX5A 3C5CA 4YXWD 3ADKA 4DLYA 1SZPA 221PA 3NDBB 2WWYA 4CZ2A 2PCJA 2IHYA 5GADl 1CJVC 1MRNA 3CPEA 3FKSD 2O8FB 1DAIA 1R0XA 3AVOA 1F2TB 1Y3AA 2WKRA 2CJWB 1JJVA 3OIVA 1E1RA 1OV4A 1ZNWA 3AUXA 3T06B 3LX8A 3WNBA 4OHXA 3TUZC 1OKKA 1T8TA 2GAAA 4MDFA 4Q1DA 2J41A 1G3RA 2BMFA 4LGMA 1NLYA 2CE2X 5C4GB 4LOAA 3NBYC 1W5TA 1ZU5A 3C4JA 1W4BA 2FF7A 2FMXA 1J8MF 2BDTA 4IDOA 4MGKR 3WY9A 4FW9A 4A0FA 5UKDA 2WSSD 1G8GA 3RS3A 2GF9A 4RSGA 4JL5A 2D62A 3V00A 1RZ3A 3I73A 1E0AA 121PA 3DMNA 4TL7A 4XTRA 1KKLA 1G17A 1MV5A 3QKUA 1Q22A 4IDHA 4JJZA 5F2EA 4BQSA 4PHTA 4HLUC 4I1SA 1DTSA 3VR4A 1W0KD 3EX7C 1M6NA 2XTZA 4ZDJA 3K70D 2IYUA 2ZRIA 4LHVA 4DVGA 4L9WA 2YWGA 3TJZA 5H8WA 4XWOA 4OQLA 3AQ4A 2BMEA 3K53A 5G41A 4HSEA 4PO9A 2WV9A 4AD8A 4B3DA 5J4VA 1OF1A 3EARA 2ZRDA 2NO6A 1Z07A 4IFBA 2V7QD 4L4UA 1KGDA 1VPLA 2JLQA 2XTMA 5D3MA 1IN4A 5BYJA 2IS6A 2GJSA 4QBIA 3IQXA 2FFBA 1L2TA 4ZDKA 5JCPA 3CLVA 4RD2A 3A36A 3KKOA 2JJ2D 2Q3MA 3CNOA 4HAXA 3QEJA 4TLAA 3K70B 1LW7A 4F92B 2PJZA 5CK4A 4HAYA 5L3SB 3VR2A 3CX7A 3QF4B 3PUZA 3WYGA 3MGCA 2ZJ5A 1YR6A 3OEEA 3UG7A 4DDTA 1N6HA 1YU9A 4JSYA 1OHHD 1OIXA 2IL1A 4QKQA 3Q5DA 2IS2A 2CL6X 2J5XA 2OAQ1 2GCPA 4C4PA 2RKOA 4JYBA 4TMKA 4PO8A 1RW4A 1AJEA 1W2HA 4NL4H 2GTPA 2ZE6A 4MKHA 2ZXUA 4D2IA 2QUZA 1NBMD 1GVNB 2DBYA 5KDLA 3DVLA 2QGNA 1OE0A 4PHGA 5JBQA 4JBWA 3I62A 5F9FA 3I1FA 1ZAKA 2GILA 2XITA 5KSOA 2DFKB 2WJHA 4G5SA 5EUQB 1G291 2J87A 4B2LA 5KYKA 2FPKA 1GWNA 2OG2A 2ZROA 5JZVA 1KI7A 1KMQA 4B6FA 1QZXA 4TSFD 1E9BA 3PEUA 4NE2A 1OXVA 4HUQA 4OBEA 4Q9KA 3DEFA 1Q12A 2VPPA 2ZYVX 3LLMA 1IJFA 1BO6A 4PC6A 2BHRA 4MRRA 4DKXA 3HP1A 3LH5A 3I8SA 2QL6A 2NTYC 3KKPA 4WVFA 2WHXA 2YOHA 2NPIA 3BJIC 1N0WA 5EZ5A 2JGNA 4W5JA 3R8FA 3LRPA 4PAQA 4HAZA 4DUGA 2XXAB 3B82A 1M1YE 1UBFA 1DAKA 3AP1A 3QPWA 5EXTA 4TL8A 2LWIA 4LJ5A 2XZOA 3VR3A 2XAUA 1WXQA 4L15A 3PQCA 5EZ6B 2O0KA 2C5LA 2P6NA 1OFTA 4EPRA 1TTTA 1QG2A 4NONA 3UK6A 1RRFA 3AF4A 4Q9HA 5AJVB 2NGRA 4UXHA 4DLUA 3AP2A 3AF0A 4PXAA 2ZUDA 4FCTA 4DLTA 1R0YA 2JA1A 4Q1AA 4GFDA 2VBCA 3NTUA 3A6PC 5IT5A 1XMJA 5JJLA 1LTQA 1KHTA 4GBMA 1ZJ6A 2GCNA 3OFND 4B44A 3KKNA 1E1QA 4TMWA 2IXFA 1OFHA 2FOLA 3N2EA 1E2QA 4O2RA 2YWHA 3MMPA 3L82B 4IEEA 4FI3C 4QGAA 4FMCB 1ZD8A 4NCKA 1Q1BA 3LV8A 1HEIA 4S2EA 5HE8A 1C9KA 1TQ2A 3U3MA 5JS7A 2IS1A 2QQEA 3O47A 4Z51A 4YDHB 1F3OA 3T1OA 3WNCA 2QN6A 3NXSA 1W1WA 3SDZA 3QKRB 1DO2A 2GZAA 3TUJC 3BBPA 4M4SA 3SZRA 1R0WA 2JAQA 4A2WA 1H8HD 3W90A 5HCNA 5C2JB 1I2MA 1QG4A 2BMDA 4V0OA 3EAQA 1HY3A 5CJPA 2KBFA 3FKQA 3WP1B 1HURA 4C30A 3EPLA 1NP6A 2GXQA 2ZUBA 4Q18A 3RWMB 2WPDD 2WVJA 1EG7A 2L0XA 2VSOA 1Z47A 1RVDA 2ZRGA 3LW8A 1XCMA 1P9WA 2A30A 3NBZC 3EWAA 3FWYA 5TARA 5KNDA 4TZ6A 1ESNA 3ASZA 3GLGE 3ZVMA 2ORVA 4PSKA 1GP2A 2BM0A 1WCV1 2YHSA 3CF2A 1E2DA 1N5JA 2AKYA 4PANA 3VAAA 4B3FX 2VP0A 3WP0A 1T5LA 4ASUD 2H8KA 1YZKA 1P3JA 3AKDA 1GKIA 4UXIA 1NMZA 3KTAB 4B2IA 1ZC3A 3IPXA 3RLFA 3KFVA 4XVUA 1GILA 1NN1A 3LWNA 4HAVA 5DIFA 3RC3A 3TAUA 1YZLA 2GAOA 3QBTA 2Q9BA 2ZRJA 4X8MA 2W2XA 3FVQA 1CR0A 2J0SA 3EZ6A 4L8GA 3GJ5A 2GKSA 3LBHA 4I4LA 4A9AA 3EXAA 1W5SA 1WA5A 1GDDA 1UDXA 1Q0UA 1UEIA 3GEHA 4DB4A 1S96A 1T0HB 2DWQA 4NTZA 3T1VA 1KSJA 4TQ9A 2OCYC 4Y0AA 2IXEA 4V0LA 2IT1A 4LYFA 3K0AA 3NIBA 4M22A 5FL3A 3TH5A 3DZDA 4RKFA 4UNRA 2RGBA 3W8NA 3RS5A 3CH4B 4I99A 3HR7A 1G8PA 4OHVA 3WMFA 4GSYA 3NH9A 2QTFA 3QKSB 1NJFA 4XD7D 1U8ZA 2GHIA 3E2IA 2CCKA 2ZI9A 3Q3JB 4JT2A 2J1LA 2BKEA 3TRFA 2XTNA 4AC9A 4AK9A 3PIRA 1SQ5A 1SXJA 3I3SR 1IXSB 1E2JA 1OJLA 1U0LA 1A2BA 2AFHE 3CRQA 1WDTA 4LC0A 3VKGA 3CNLA 4R7ZA 1SHKA 2PT5A 4AY2A 4KVGA 2XNSA 4TQAA 2BM1A 3IHWA 1MOZA 3JZAA 3RABA 3WMGA 3SYLA 3LBNA 4KBFA 2OFWA 3ADCA 4IOKA 2ZR0A 4BPBA 1W7AA 4MUAA 3BK7A 1DAGA 3UKDA 3E5HA 4KI0A 1VKJA 3BH0A 2XOKD 1KI6B 2DFNA 2GESA 2D4HA 2WOJA 1TNDA 2PT7A 3R20A 1ETUA 1SGWA 1L4UA 1Z6XA 3V4FA 1EGAA 3GD7A 3CB4A 1QVRA 4QC2A 1CJKC 2JDID 3VHLB 3B13B 3NC1C 2QROA 3QF7A 4Q7KA 1KI3A 2GEDA 3AEZA 4K81B 2OCAA 3GJ4A 3PENA 1TF7A 4GMXA 1G4AE 1ZNXA 4MUBA 2ERXA 2DYKA 3TQFA 4PPFA 3UWKA 4C7OB 3ZH9B 1CF4A 4X8LA 2XNDA 3AGPA 4LPKA 4HAWA 4E07A 1KDOA 4DLRA 2O52A 1FPMA 2BIFA 2WWFA 5KUTA 4MRVA 4V0NA 3T15A 5FTMA 4M9XA 3GP8A 2FJUA 1P73A 1BH2A 1U99A 3OIYA 5IF9A 3RRMA 4A82A 5JSZA 1RYHA 1HQCA 1ZCBA 3QY0A 3RDPA 2O8BB 1T9HA 2RGNA 4QOSA 1DADA 1Z08A 3UWOA 2NIPA 3I72A 3PXGA 3CF0A 5AUNB 4F4JA 1X1RA 1UKVY 1N2CE 3B78A 3L0SA 1YR7A 1OPXA 3IO3A 3K09C 2AN9A 4OK6A 4Z8YA 4BZXA 2ZRCA 5BW8A 3RVBA 3Q7PA 4LRWA 3TW8B 2ZJAA 2X77A 4KHZA 4M9QA 5GVRA 1KK1A 4N1AA 5FUYA 3X1DA 1OXXK 1FNNA 1R5BA 2JLWA 4A0GA 2HT1A 2C9OA 1T8UA 3BE4A 4Z54A 5FOVA 4A8JC 5HZHA 4CT4B 2ZSAA 3EPJA 2ANBA 3P4YA 4OJQA 4NCHA 2BBWA 1ZNZA 3EZ2A 5FR2A 2I1QA 3FHOA 4YMTA 4Q7LA 1N3BA 1D5CA 2ZQ5A 2XSZA 3CKLA 5L3QA 1MKYA 1G5TA 3HU2A 3IIJA 4JS0A 3IUYA 4NBSA 2FSFA 2GWHA 3QXSA 3ZVRA 1Q3TA 5E7MA 2J9RA 2BJWA 1VG1A 4TLCA 3LNCA 5J47A 2RGCA 1OH8A 4AKIA 4QXAA 5DHFA 1KZ7B 2F9MA 3RRZA 4U7DA 1EESA 1XNJA 4RFSB 4E09A 2OSBA 4D26A 2ODBA 4TMZA 3UMSA 5KDOA 3AVUA 2ODWA 2CVFA 3D6TB 4LZZA 2RGDA 4W7SA 4JLJA 1AQUA 3B1ZA 2F1JA 4N0DA 4E22A 2VH5R 4XH9B 1GUAA 2Q3FA 3UXMA 2G0TA 1F60A 4U5XA 1ZP6A 4LWZA 4IDQA 5FTJA 5A5GA 1VYUA 4B48A 1HT1E 4IW3B 2C98A 4TQUS 2ZSDA 4PC1A 5JRZA 4LJ4A 3KXKA 3EIEA 4PQFA 5DI9A 5JEDA 2WBLC 3OAAD 1CRQA 1XD9A 5JWHA 2ODEA 3C7KA 3CBQA 3CPJB 4HDOB 1XDBA 1BKDR 4EJSC 2Z5FA 1PLKA 1H8EA 3HYTA 4LBYA 1FUKA 1G16A 4PPNA 3IGFA 3WBJA 4JLMA 3G5UA 5ELXA 1NG9A 1VIAA 4IVQA 1NMYA 4L9SA 1K6MA 2FA9A 3THWB 2HXSA 2G1KA 3K0FA 4IHQA 1LS6A 2JLVA 4D82A 2OM2A 1ZYUA 2ZRLA 3SYNA 6Q21A 4HZUB 4ZCLA 1RIFA 3ZVLA 2G83A 4B2PA 4LC1A 1S2MA 2R62A 3MWJA 5FR1A 1RFLA 2CL0X 1DAFA 3WRYC 4LV6A 4QL3A 2VP5A 2FSIA 3K9LA 5IK2A 3RAPR 3NKVA 3KQLA 3H1TA 5JEEA 2QORA 4C0SA 3T35A 3B8HA 5CB6A 1IY1A 1ZM2A 2ZJYA 5CM8B 4FIDA 1ODFA 3A4LA 1XEFA 1NN3A 4QJ5A 3HPRA 4JMPA 4CT5A 1CRPA 4R2HA 4C2UA 3NWJA 1FP6A 4ZI2A 5JHGB 3ZQJA 2O8DB 1DVRA 2VP4A 3EA0A 3IPYA 1EFRA 4Q9IA 3W5IA 5L3RA 4PHHA 3PUYA 2X19A 1FX0A 1RKBA 1II8B 1YJ5A 4DCVA 3BRWD 1QBKC 1Z63A 5CDFE 3PEYA 5LDDC 1BYUA 4RVCA 2JLUA 1P2TA 1IXRC 2DWPA 4Q00A 5G40A 4IOLA 4A8JB 4F7WA 1KO5A 2AWOA 2J7PD 1GM5A 1E99A 1P9NA 2EFDB 2GBLC 1JR3D 1IQPA 2JLSA 5LBIA 3SJBA 1IN6A 1WBBA 3EZ7A 4M0LA 3TK1A 2GJKA 4QRHA 1KSGA 3RS7A 1COWA 1Z83A 2FZLA 4YDSA 3AVXA 1SXJE 4BFSA 1KI8A 3CIOA 2W6ID 3MAAC 1GSIA 2EFCB 1AGRA 2ZU0C 4IRUB 3R9WA 4NYJQ 3K9HA 4DLSA 3W3ZB 3U3OA 2RB4A 4RZ2A 3DM9B 2LKCA 1E2EA 3RRYA 3AVPA 4WIAA 5FI1B 1DBSA 4QNMA 3RS0A 3H4MA 3OIWA 2QY9A 5FPSA 5G53C 5K8UA 1VG0B 1R8SA 1EX6A 2AXPA 5B2ZA 3ND9A 1NI3A 1XJ0A 2AD5A 3CW2A 3P4XA 1P2UA 2EFEB 4TLEA 4V02A 4RD1A 3VR1A 3ZQ6A 5TVKA 2JEOA 4ZO4A 1DE0A 1C1YA 2EQBA 4MDEA 1G8YA 5EP2A 5B30A 4BLSA 4MRSA 1FTSA 2J0VA 5CYOA 3OE7A 2ZI4A 1E9SA 4GL2A 1CKEA 1E9DA 2LKDA 4LBWA 3FMPB 4KO8A 4W5HA 5DYIA 1GITA 2FSGA 1E94E 2BEKA 4M9ZA 2ZM5A 1DPFA 5KPDA 4G01B 2JLXA 3U4QB 1DAHA 2KWIA 3FB4A 3GJXC 3SBDA 2JJ8A 4B76A 2BEJA 3R7WA 4GNKA 3PUVA 1QHNA 2K5UA 3PFIA 3ONWA 5JS8A 1LY1A 3QXJA 1Q3HA 1P6XA 3BB4A 2ZE7A 4CEJA 1US8B 4I1VA 3K70C 5FTNA 3EIHA 2OILA 2IYWA 3MUFA 4IDNA 1RPZA 1KDPA 2ZRKA 1U0JA 4KODA 1IN7A 5D3QA 5LD2B 3VFDA 2QAGA 3RYTC 2ASEA 3VQTA 1W0JD 1XTSA 4CEIB 4DLZA 1XTJA 4AYWA 4BGDA 2OXCA 2Q9CA 5GJWC 2ZRHA 1OKKD 4P32A 4LJ9A 4OL0A 2GA8A 3O8CA 1OXSC 2ZRMA 2N46A 1G3MA 2A5GA 3B1YA 3GLGA 1R5NA 1N0VC 3A1TA 5DI3A 2FEOA 1XMVA 4RD4A 1N5IA 4RKEA 1UFQA 3KQUA 3VX3A 1X8JA 2O8EA 2G1JA 4MGZR 1NLFA 1MR3F 4MGIR 3KXLA 5AJZA 4OI2A 3GLHE 4JBXA 2GVZC 4JSTA 1JPNA 1KO4A 3G82C 1GKYA 4PZZA 2C9CA 1FP7A 2G77B 1JB1A 5G3ZA 4MA4A 2WJIA 3GFTA 2WTUA 3C16C 3ASYA 4ZDIA 1U8YA 3RRNA 2CE7A 3I5XA 4WXPA 5EE5B 1Z28A 4A4DA 1J99A 1VHLA 4XVQA 2J0UA 5BWMA 5JRJA 1GRNA 5A0FA 1OT3A 3AV0B 4YMSA 4WW0A 3U7HB 3PITA 2G0NA 4KJZA 3X1ZA 1QDEA 2DFTA 5JHHB 4ZIRB 3OESA 3B2EA 1GTVA 1GOTA 1KIMA 1N0UA 3NEJA 4FMDF 3TQCA 5E7IA 1U94A 2W2TA 1A82A 2VHTA 4URWR 1MO4A 1XTIA 2DY1A 2FPLA 2HCBA 4Q47A 3CZPA 1JBKA 3F5FA 4MITA 1ZBDA 1X8LA 5E4FA 3MFYA 4BE7B 2FFHA 2OBLA 3PUXA 3ICEA 2P6RA 1ZUHA 2ZREA 1SVKA 4IFEA 1OFUX 1NN5A 2AHOA 2GEUA 3TW4A 4ZI3A 4OQNA 1HE1C 3NC0C 1WB9A 2RGAA 2VHCA 5D3MB 4NDZA 2ZS9A 5HR5A 1E79D 3LA6A 4A92A 1G64A 4WBSA 3CRVA 1DS6A 1KSHA 1NY6A 4LSGA 2V9PA 4WXRA 4XSHA 2FE4A 3VU9B 3GQBA 2GDJA 1E9RA 4R98A 4RZ3A 4NCNA 2REBA 4HZIA 3N70A 1B23P 4QHSA 1LFDB 3H2YA 3TNFA 2FDCA 1G3UA 1XFAA 1E4VA 2IBMA 2V55B 2JLYA 1UKYA 4F93B 1KI9A 5FPHA 4C3ZA 3KJHA 1TF5A 3BAFA 1AKYA 2QTVB 4LYJA 3FFAA 1TX4B 1ANKA 3SOPA 3FKSA 4DSOA 3QOFA 1LF5A 4OJKA 4TMVA 4CEHA 4D4MA 4Z1MD 4DHEA 1MABA 4TLDA 4US2R 1IN5A 1OH6A 3SQWA 1OB5A 5IRCD 3NH6A 4CVNA 3B85A 4DUGD 1W49A 1ZIOA 2OLJA 4M2LA 1J70A 3KKMA 3B7GA 4UKDA 1Z0FA 3O8DA 2WKPA 4LCBA 1XJCA 3LW7A 1ZD1A 1ZCAA 3MWLA 2EWVA 2AWNA 2WMNB 1ZD9A 4ESHA 4CW7A 4QJ3A 1HTWA 2WSSA 3KB2A 1NN0A 2D7DA 2WKQA 4HUQB 5DISB 3P20A 1QHYA 1Z0DA 1GRRA 4MQBA 4ARZA 3A58B 2CHGA 2XJ9A 4QM6A 4QFMA 1IXZA 3KUCA 3UPUA 1JEDA 1GNRA 1W0KA 4TTQA 1M7GA 1S3SA 5JMTA 3OIUA 1YRAA 4NYIQ 1CU1A 1SVIA 1P2VA 2YNMA 4Q1EA 4BFYA 5JWOA 3AVYA 3ZDQA 2FSHA 5DHAA 2OFOA 3K0EA 2A2ZA 3CUEF 3KJEA 4B35A 1P9RA 1XP8A 4URUR 1BS1A 4F4IA 3W8RA 3TAHA 3THXA 3W6OA 1RRGA 2V7QA 5FL7D 1U9IA 1Z6AA 4JT4A 5EUMA 4LJYA 3EA5A 4C0HA 3FHTA 2B7CA 3LBIA 4Q7MB 1T6NA 4V0KA 4V0MA 3RSOA 3T5DA 1I4TD 3ZIAD 2DR3A 4QBGB 4PFSA 2GF0A 3U6KA 4OKSA 4OI0A 4DIDA 2VL7A 3FDIA 1UKZA 3RSLA 4CDGA 1XF9A 1CR2A 3GJ0A 2JASA 3M6AA 1U0HC 4D0NA 2IYQA 1YQTA 4KU4A 2IF2A 2D06A 1BOFA 2CNWD 2KE5A 4FN5A 1D2NA 1XMIA 1AK2A 1NSFA 1OHHA 3WMEA 1E0KA 4K8OA 2GXUA 4URZR 3SN6A 3HU3A 2REXB 3SQXA 3SI7A 4GP6A 3B60A 3FYHA 3EC1A 2QE7A 5GJCA 2R44A 3TKLA 2I3BA 1J2JA 1ZC4A 2GZDA 1G9XA 1P2SA 3NBFA 4A1FA 1NBMA 3MWKA 2ANCA 5CK5A 2ZYTX 1S8FA 4D4LA 1UF9A 4A15A 1L8QA 2CBZA 5LB4A 4WZ6A 4CIDA 5KSYA 2IUTA 3ETLA 1BMFD 2IYZA 4TTRA 3RC8A 2KBEA 3FHCB 1JR3E 4Q4HA 3A1WA 4ZCIA 4Q4LA 4DBLC 4URXR 4TSFA 1F5NA 3R8CA 3FPAA 3A1VA 1ESMA 4GOJA 1TQDA 1AA9A 4LHXA 2J7KA 2GXAA 2H5EA 3UATA 4OQFA 2F55A 4YMWA 4K46A 5TMPA 3CH5A 4II7A 3Q72A 5KNCA 3SBEA 4HLUA 1NG1A 4DB2A 2ATVA 3IKJA 1CTQA 1JAIA 4KFTA 1N5KA 1GFIA 3L0IB 1E9EA 2W2VA 2CDNA 1M2OB 1E2MA 2EU8A 1SVSA 5A4JA 3F0TA 4BZPA 5FBLB 1JI0A 4B74A 1R0ZA 1UDWA 2OLKA 4Q1CA 2IYXA 2PZEA 3QEOA 3K0CC 2WZQA 4URYR 1FL9A 2ZANA 4JLVA 2WJJA 3QBVA 4B3GA 3GJ3A 3TSZA 2UZ3A 3AF2A 2IS4A 2GCOA 2UKDA 3QKRA 4CRWB 4Q4JB 2E9SA 1XXHE 2XEXA 5CITA 4WZAE 2CXXA 2J3EA 1RRPA 3KJGA 3VNUA 4B3XA 5EXSA 3RHFA 3OFNA 1X3SA 1E0JA 3QXCA 2BVNA 4LX0A 4KITB 2VF8A 1DOAA 1OFIA 4TYQA 2FWRA 2A7QA 3K0AB 5E95A 1UBEA 1VHTA 2QNRA 3DOEA 3S1AA 2WIAA 1E2NA 3QVVA 2V8OA 3THYA 3GFOA 3REGA 4EAQA 2GRJA 2G3YA 1E2FA 3LQQA 3MRSA 2WWGA 3KDSE 3BXZA 5CDFA 3QPVA 2N1BA 4NHOA 2VEDA 1GG2A 5J4YA 1HH4A 3BOSA 4C0KA 2QMEA 3T12A 5DN6D 3GLFE 3JVVA 5LPNA 1H8HA 2YV5A 2A9KA 5GVSA 4EFMA 3A37A 3BFKA 4FMDB 5EQTA 5B58C 5KOYA 3HJNA 1Z0JA 3LDAA 2BCGY 4TT3D 2WPDA 1OXUA 3OEHD 1KO7A 5HTKA 2V54A 1XB2A 5AJYA 2QTHA 2Q21A 4TYYA 2IYVA 3L2OB 3KQKA 3U3JA 2WWWA 4M21A 4IVRA 2HT6A 2ZEJA 2VHJA 2RGEA 2BC9A 4HB3A 1CP2A 2IX3A 1ZMXA 2NO7A 2WAYA 4C0LA 4LY6A 4YMVA 4N0EA 3IO5A 3CWZA 5DE3A 3LXXA 3LVRE 2OEPA 4ASUA 1EFHA 4HB0A 2HYDA 5L8VA 2ORIA 3CRMA 3PJRA 2PEZA 1OYYA 3D31A 1JPJA 5AWFC 4US1R 4NKRA 2KJQA 4LJAA 2QQ0A 2ZYWX 1K8RA 2W0MA 2ODNA 3GJ6A 3V4RA 3T5GA 1QRAA 2YZ2A 1P5ZB 2W00A 4DCUA 3GJ7A 2ZRFA 1XD2A 2PX3A 1E2KA 5JECA 4JYCA 3Q7QA 5AUQA 2D2EA 2OFXA 1KZGB 1S1CA 2NO0A 5HZKA 2RGXA 3TLXA 3SNHA 2V1UA 1E9CA 1OSNA 2MMGA 4LUCA 3MJHA 4EIWA 4B71A 2FG5A 2ZUCA 4UQOA 3CRRA 4G5OA 2E1RA 3U7GA 3B1WA 3DDCA 5JSZB 5IDVA 3I32A 1E4YA 1JEEA 2W58A 5FBQB 2DB3A 3DKPA 4RCYA 4Q4AA 1SKYB 3TE6A 2AKAB 2XSZD 4CF7A 1UPTA 3Q5EA 4Q1BA 1JJ7A 1KI6A 4ZKEA 3QG5A 2H1LA 1C4OA 1OH7A 1E3MA 3QNUA 4TL9A 3KL4A 3NDPA 3AF1A 1FW6A 1VCNA 2ERYA 4IOJA 3QPUA 4RD6A 3LY5A 5FTKA 2P6UA 4EPXA 2VHQA 4MKGA 4M1MA 1NJGA 2VF7A 1T91A 3K9GA 4GP7A 2FFAA 3M4YA 2G9NA 3VKWA 1WQ1R 5KDDA 3KUDA 2YC4C 1LB1B 1YR9A 2H18A 4C7OA 2NO1A 1QHHB 2QPOA 1XPOA 3GLIB 2ZS8A 2ZU6A 5L3QB 2XB2A 4OHYA 2JJ1D 3SJAA 1E98A 3IEUA 2XOKA 1W47A 1D9ZA 1RC8A 4IOMA 1S0UA 2NQ2C 3TBKA 3IIKA 2PLFA 4LYHA 2ZAOA 4V0ME 2KSQA 4PPGA 1UADA 5BYKA 3GLHA 1PZNA 5DYGA 1TAGA 3IHLA 1FNMA 2JDIA 4XSGA 5DGXA 2C77A 2F43A 2B92A 1XX6A 2BJVA 4QM7A 3P26A 3TUIC 1E2GA 1KSFX 1ZIPA 1KYIA 2Z4SA 3TR5A 2HLDD 4UNQA 5EXXA 4JZKA 3W5JA 4BFVA 4Z8XA 8OHMA 1XTKA 2R2AA 5IK2D 1XZQA 4DWJA 2ZPTX 3VNVA 4MRNA 4OK5A 3QKTA 4YQFA 1CXZA 3K0SA 2ZS7A 1ZM4A 1O3YA 1R4AA 3IQWA 4GT1A 4DZZA 1Q21A 1Z29A 1NBME 3ZLJA 2B7BA 1WBDA 5LB2A 2A5DA 2YWFA 4KYIB 4UNNA 1O87A 4W9MC 2VLIA 3NG1A 1F6BA 5KSZA 1K5DA 4DJTA 3SU8A 4FCWA 2ZVPX 4GOXA 4QNRA 1NRJB 2UZIR 2HJVA 3EPKA 1JECA 3EW9A 2MSDB 1X86B 2CLDX 2IYYA 2R6FA 1A7JA 4TTPA 3V9PA 4HEJA 2ZSBA 5EE0A 3K0FB 2LCFA 3FE2A 2WM9B 2KI5A 4JL6A 4I81A 4LV5B 2B8TA 1NIJA 4FXPA 4M1OA 3CF6R 1EFRD 2YJTD 1GNPA 421PA 1J7KA 4DLVA 4BFWA 4PR0A 2VTKA 4QBHA 5AJXA 2P65A 3AGQA 5TDHA 5K8TA 4LJ7A 1DO0A 4JKYA 2F1IA 2JIZA 2WWIA 2OO7A 3N2IA 5JI2E 2R9VA 4DEYA 4OQMA 4ESVA 1F2UA 2WWXA 1ZW6A 4UNSA 2IYRA 5B64A 4PQYA 5KTYA 5GJVC 1FMLA 4KFSA 5K8IA 1G19A 3UMFA 3ZVNA 1PJRA 5LD2C 4EDHA 1UJ2A 2BMJA 2IYSA 2PZFA 4CYMA 4Q21A 2CK3D 2XX3A 2BOVA 2ZE5A 1Q1QA 1JXMA 1YHNA 2C8VA 2ZR9A 1HUQA 3SFVA 2IYTA 1A2KC 2IEYA 1QHXA 1MT0A 4RJLA 1V5WA 1IOZA 1E6CA 1HQYE 2CCJA 1XPUA 3DM5A 4P4UA 3D3QA 4KFRA 1AS0A 2GJ9A 3BC1A 2WJYA 4KYUA 2XZLA 2F1RA 4HDCA 2R8RA 2YINC 3A8TA 4LDJA 5TV2A 2RGGA 1CJMA 2BWJA 3G0HA 2IC5A 4HLCA 5DLQC 3U7FB 4AIIA 5SZKB 4PSVA 2G88A 1TU3A 3BD9A 3OAAA 3BFVA 1Z2AA 4EPTA 4QBFA 2J0QA 2HYIC 3AVVA 3ECCA 3LD9A 1T0JB 1F48A 5JJKA 4Q1FA 1D6JA 1LS1A 4KLNA 3FMOB 5KPJA 4FD2A 1W44A 2VP2A 4IVPA 4DCTA 3ZD6A 1UEJA 2RMKA 5CIQA 4DSUA 4M8NE 1LNZA 1N6OA 3K09A 2JATA 1ZUNB 3AVQA 2HJGA 4DT1A 3RNLA 5FOSA 1XD8A 2YKGA 4WAUA 5SZJA 1YE8A 3MD0A 4JVMA 4M1YA 4DSNA 2P3SA 1XTRA 1KAOA 4A6PA 4JLBA 1HT2E 1UKEA 5AUOB 3B1VA 3X2SA 1PV4A 3M1IA 2O8CB 2VP9A 3BB1A 1X6VA 4B32A 2QP9X 4LJ8A 4A8JA 1U8AA 1V43A 1D2MA 4MYCA 1KDRA 3BORA 1RJ9A 2H17A 2NG1A 2CHVA 4G3XA 3SJCA 2O5VA 4DCNA 2SHKA 2YC2C 3KQNA 5BN5A 1FFHA 1P7CA 4XOIA 4ZDWA 2PBRA 1KI4A 5EJEA 2V3CC 2MSEB 3HR8A 2IK8A 2ZSFA 3D7MA 3L8ZA 4O0MA 2A78A 4DSTA 4JVNA 2GVDC 4ERNA 3R7WB 4J0QA 1WMSA 3GFPA 2QBYA 1MH1A 3KFXA 1XEXA 3CR8A 1NIPA 4XTCS 1Y63A 1OB2A 1FZQA 4AYTA 1Z0IA 2QZ4A 3PV0A 3VMFA 4CEJB 4RZXA 5K8LA 2HUPA 3I4LA 5G3YA 1I4DD 5HKKA 2ZJBA 3NHAA 821PA 4C0QC 2J7PA 3RWOA 3IEVA 4PC3A 3ICQB 4D4JA 2FU5C 3AF3A 1E32A 1JR3A 4Y0VA 3MJRA 1W46A 3ND8A 4R2IA 5EP3A 1NVVR 3CX8A 2OUKA 2FPMA 4LI0A 1Z0AA 3C8UA 1E69A 3BH7A 3QUSA 2A5YB 3X1YA 3GLGB 1NKSA 2A3RA 2AK2A 5DI3B 4B47A 3P1JA 4W5WA 4HDQB 2W6IA 1E1RD 2VRWA 1TUEA 3QXXA 2O8EB 4U00A 5P21A 4EJSA 1KMHA 1FUUA 4R71A 3W3AA 1NL3A 1E2IA 2CEAA 3L0OA 4G0NA 1IY2A 1DAEA 4HLQB 2D3WA 2HDNB 3RANA 2FNAA 3LXRA 3DO6A 4NYMR 4EQ6B 1TQ6A 2XGJA 2HV8A 2VA8A 1ZU4A 4P4SA 3SEAA 2RHMA 2QMOA 4FWTA 3PUWA 4EPYA 2CVHA 3SYKA 2QM8A 2OHFA 3L43A 3BFXA 621PA 3ZYCA 1DARA 1QF9A 2OBMA 1YRBA 4DEXA 1HYQA 1XXHA 1US8A 4O25A 5FOUA 4MYHA 2PL3A 4KAXA 3I8XA 1T3HA 2J0UB 4HI0E 1Z22A 4WA7A 1K5GA 2H92A 1M8PA 2C04A 1G6OA 2ZITA 3O8BA 2IA5A 4DDWA 1JR6A 4CEIA 1CJTC 1CLUA 2VQSA 3TVTA 3P27A 4D4KA 1KY3A 2PH1A 3U44A 3BGWA 1VG9B 2GXSA 2FN4A 1YZUA 3CM0A 1KJYA 1TPZA 3FTQA 2DWOA 1QHSA 2OT3B 3CPHA 3DMDA 1CJUC 3QQ5A 1W36C 1S9HA 1SVOA 1XEWX 2NMVA 5EP1A 1AKEA 1KK3A 4KCGA 5C46F 4PX9A 4HAUA 1GKUB 1KNQA 2IUSA 2WIBA 3U6BA 1U81A 2RAPA 2FEMA 5FH9A 3GLFA 4DDVA 1W2GA 2Z83A 4FMBB 4JLPA 3FMIA 2B8WA 2ZJZA 3AVWA 4KBGA 1X1SA 2WWHA 1W0JA 2EFGA 4G5GA 1G7TA 1J8YF 4M1WA 3R9IA 4P3YA 3QENA 4PC2A 2GBLA 3A1SA 3OEED 2W6JA 1SVLA 2F1HA 1D2EA 4XWKA 2D2FA 2O8FA 3CR7A 4KLZA 1TUIA 4M1KA 1F2TA 2Z43A 2CJWA 4BWYA 4DLWA 3KJIA 4A6XA 1NVXQ 4HYYA 4YONB 3L8YA 5SZIA 4GRAA 4UJ5A 2BCJQ 1IHUA 1G4UR 2J59A 2ZJOA 3C41J 4IKEA 2B6HA 2Q9AA 3EWSA 2MMCA 3WNDA 5J4KA 5J4LA 4ZIRA 5L3VA 4US0R 3FOZA 1CEEA 3QJYA 4CEHB 3Q85A 5FPKA 4TYWA 1MABB 3KZ1E 5IHPA 4G1UC 3GCGA 1TL7C 2NOAA 3EASA 4JLDA 5FI0B 4BLOA 4YXWA 1JQLB 4BFTA 1XCGB 4UNPA 2JCSA 4P0TA 3THOA 2F7SA 3PCRB 1RE0A 3IBYA 2FH5B 3DPUA 4BLRA 4BASA 4Q5IA 4WOPA 2P0EA 2H7VA 4EPWA 1G8FA 3K1JA 2H57A 1N5LA 2KB0A 3WBKA 4ARZB 3PG5A 2FV8A 4TL6A 3K9NA 5J4HA 3VU9A 2OCBA 4IXMA 4KXFB 5C18A 1QVAA 1H65A 3EZ9A 2C99A 3FFBA 2XB4A 4HB4A 4OI4A 4MKIA 2VSXA 4RCZA 2Q6TA 3B1XA 1VTKA 1W36D 5TXGA 4RY2A 4DC9A 4NP6A 3GJ8A 1T4GA 1Z0KA 3OZXA 1JXOA 3SJZA 4DLXA 3ADDA 1R6BX 2NZ8A 1X8KA 1G18A 3THXB 4JIMA 2ZIAA 5KNBA 1E1QD 5L3SA 3WYFA 2QE7D 1T5IA 2OESA 4FWIB 3KXIA 1E79A 3QF4A 5FPYA 3LQRA 5E3HA 4B3CA 4L16A 4PZLA 1QHGA 1AZSC 2F9LA 4AI6A 5FBRB 1CR4A 1ZM9A 4LK2A 2QU8A 3HWSA 1AQYA 1YZGA 2ZI3A 1S1MA 4HATA 1L7VC 4LBZA 4Q9LA 4XJXA 1NLZA 4BLPA 2O0JA 1W36B 2ORWA 3EC2A 4C2TA 1SXJC 1TQ4A 2BV3A 2GETA 2QRZA 1IBRA 3SS8A 4QJ4A 1G1MA 2AL7A 2ZRBA 2IWHA 3BWDD 2JJ2A 2C03A 1LVGA 4Z1MA 2QRNA 3EZFA 4Q48A 2HEIA 1Q1ZA 1N25A 1NVVQ 1QHIA 2C96A 3AKEA 5C4MA 3O8RA 1P4SA 1YZNA 4UJ3A 4QG7A 1ZINA 3ZGXA 3B9PA 1KJWA 2BBOA 2JLRA 3F3YA 1E9FA 1NKTA 1GIAA 2OAP1 3AB3A 5DH9A 4P31A 3F8TA 3UMRA 2WSMA 4Q4HB 5AUPB 4O2LA 2XXAA 2FFQA 2E87A 3QE0A 2QP3A 2X8AA 4V03A 2X1VA 4A2PA 4ILEA 3VTKA 1ELOA 3CNNA 4NYMQ 5F3WB 4AKGA 1AIPA 2FGJA 2ZJ2A 3A4MA 3QVUA 3GEIA 3JVUA 1VYVA 4H1UA 4QHTA 1B0UA 2ZETA 4Q7JB 1IAQA 3LLUA 2PJRA 2R6DA 1SHZA 2D7CA 4RD3A 4ZKDA 3B5JA 4RZUA 4H1VA 3Q8XB 1YVDA 5FPTA 4B6EA 5FUWA 1DEKA 5JJIA 1JNYA 2GEVA 4PQRA 4C0BA 1Q57A 2ZR7A 3WRXC 5FL7A 4JVSB 5AJWA 1U98A 1Z06A 2RGNC 2AFIE 3PR1A 4DDUA 4BEBA 2PX0A 2X2EA 4AKHA 2GCOB 3AUYA 3TR0A 1II0A 4R9UC 5E7JA 1ZRHA 1J90A 2NPFA 4PC7A 3ZIAA 4E03A 1JQJC 4U02A 2W83A 4P4TA 5C1BA 2OZEA 4D80A 4C0AC 3C5HA 3BB3A 5J40A 4X8OA 3QI2A 1NF3A 4DXAA 1IY0A 3ZS8A 3ZZTA 3I92A 4BRWA 2CNWA 3IIMA 3AM1A 4H9GA 2O0HA 3S1AB 1SXJD 3W34A 3B6EA 1KI1A 3QIAA 3THYB 1GAJA 1UBCA 1Z6TA 3U5ZB 4EFNA 2QEQA 2Y8EA 3VX4A 4ACBA 2IHBA 2EYQA 1PLLA 3TGPA 2QT1A 1Q1EA 3PVSA 4TMTA 1NSTA 3UIEA 1WRBA 2WJGA 3M0EA 5TB5A 3QXHA 1BMFA 4AWXA 3NBXX 2OCPA 3CONA 4OYHA 3AKYA 4CGZA 1FTNA 1XCPA 3W6NA 1ZM7A 4JBYA 1XWIA 1G6HA 2J45A 1VCOA 4GI7A 1VCIA 5CIWA 1PUJA 1LF0A 3DHWC 3U3RA 3ZJYA 1U2RA 1SXJB 1EFUA 4EFLA 3KTAA 2R65A 3H86A 4QGHA 4Q4JA 4XVRA 1KO1A 3J81k 2PEYA 1GL6A 2FX3A 3MCAA 4A2QA 5M04A 2ZVQX 3U2QA 1P75A 3N5CA 4IXNA 4ZPXA 4QGGA 2GJ8A 1TADA 2IW3A 2V4ZA 4MH0R 4D0LB 1WF3A 2HXYA 1NMXA 2C9YA 2XNDD 4Q02A 5JWRA 2OBNA 1G3QA 2H16A 4B43A 2WMOB 2VSFA 4B33A 4YMUA 1P61B 1Z2CA 2YOGA 1W4RA 1M7BA 4KVAA 5CJ2A 1G7RA 1P60A 1KI2A 1S4QA 4NZYA 1UM8A 4YC7A 4BRUA 1GL9B 5DNYB 4HUTA 4Q01A 1G8HA 2VO1A 1VDZA 3ZD7A 2C2HA 5EP4A 1XD2B 3W6PA 4D6PA 3VR5A 4O3MA 3VHXA 4YLGA 1IN8A 1OIWA 5FTLA 3CRW1 1OW3B 3DOFA 3T61A 1R8QA 1BYIA 3CWQA 3I61A 4MYTA 2ONKA 1W48A 5KU1A 4IJMA 4PSAA 3QKSA 1FOEB 1KJZA 521PA 3RS2A 4PHFA 2QSZA 4BFUA 5HPYB 2ZRNA 1KOFA 1SKQA 1Z5ZA 3KX2A 3PEWA 5H68A 1OIVA 4Q4AB 4BZQA 1UAAA 1M34E 2ZE8A 4JKIA 4RFVA 4AG5A 1KDTA 1NVWQ 2R6GA 4F38A 1N6RA 1T3LA 1XEWY 3E1SA 1FMJA 2FGKA 3SHFA 4A0HA 4XIGS 3TVDA 2QG6A 2ZSEA 4GMDA 5DN6A 4EKDA 2C78A 1KTVA 5FOWA 1TMKA 2OV2A 4QGFA 4KSCA 5H70A 2QSYA 2QMHA 2ZJ8A 1G41A 1S9DA 3JZMA 4XD7A 1A4RA 3L0PA 4NYJR 1G5RA 4TT3A 1KNXA 3OEHA 2Z4RA 1CR1A 2RH5A 3OF5A 1VYTA 5FFMA 2QPTA 3LO5A 1XMSA 1FQKA 3X1XA 2DCUA 1TEXA 4ACAA 3CX6A 4URVR 5DO9A 2V6IA 3ZS9A 3HU1A 2CL7X 5B57C 3AP3A 721PA 4MGYR 4PAMA 1R7RA 4MRPA 1G7SA 1KAGA 4HLDA 3A1UA 4LBVA 4ZV4A 1DAMA 3GLHB 2A5FA 2YOFA 4GZMA 1W4CA 1A1VA 3LAWA 5J5CA 4L5BA 4NCJA 1KK0A 1GNQA 1S3GA 2F43B 1GZSA 4TLBA 1N6PA 2Q3HA 4KSBA 3CO5A 4TWZA 3W9YA 3H0KA 3MWYW 5EE9A 4NU0A 2GJAA 1HV8A 4Q9JA 3NHBA 2RCNA 2PZGA 2IYLD 3K0CA 4KV9A 3ADBA 2VHUA 3EIQA 1OH5A 1KO8A 2REOA 3WHLA 2D74A 2F6RA 1KKMA 3BS4A 3GPLA 1XPRA 3TSWA 2A5JA 2WJVA 2O8BA 1H8ED 2NZJA 3X1WA 2QP4A 3AKCA 1G20E 4MYUA 4P33A 1DG1G 4LHYA 5BXQC 4LJ6A 1I2DA 1M7HA 1MO5A 1OYWA 2ECKA 1AM4D 1EK0A 2AD1A 2JIZD 1CULC 2N42A 3U61B 3I5YA 2F3TA 3WHKA 1P72A 1YZTA 4B3BA 3TSOA 4FCVA 2EVWX 2ZRPA 2FZ4A 3DKVA 3E70C 4OI1A 3ZZUA 1QHHA 2AK3A 2QM7A 1IM2A 3GLIA 4GZLA 1WP9A 2CCGA 4I1OA 3MLEA 1N6NA 2AX4A 2NO9A 5EE3A 1SVWA 5KO2A 2V6JA 2GNOA 4OK3A 5FBWB 2GK7A 3DZ8A 1UBGA 2JLZA 2VYFA 1P62B 2Z0MA 1G21E 1DELA 2P2LA 2Q0HA 5FBVB 2R6CA 4JLAA 3FMFA 4LYAA 1II9A 1LV7A 1VG8A 1G5PA 1FQJA 2IEZA 2YVUA 2R6AA 1F2UB 2ZI5A 3LFUA 4XWAA 3NEYA 3MSXA 5JI3E 3SR0A 5AR1A 2CMKA 4RFSA 3T1QA 2BBTA 5FUXA 1XRJA 1T3SA 4TN1A 2JJ1A 1NNEA 1KK2A 1YKSA 2GZHA 2XZPA 4BECA 1E2LA 2QAGC 2PLRA 2I1VB 1R2QA 3BERA 1YZQA 1E96A 4Q66C 4NMMA 3UANA 2ATXA 5SZHB 2J46A 2IWRA 1VIYA 3HYRA 4MKFA 2EYUA 1AS3A 4IDPA 2TMKA 2ZI7A 2HF9A 2DFLA 1EFCA 3PEVA 4D81A 2IUUA 1IONA 3KKQA 2HLDA 1XJQA 1COWD 1Z6GA 2HF8A 1KY2A 1SVMA 4ITRC 3C14C
chains in the Genus database with same CATH superfamily
5T3YA 1EVIA 3HJRA 1OX6A 1FFSA 1A8IA 4MR9B 1P9OA 4NH0A 3C1OA 4S12A 2F3RA 3TL3A 3VC1A 3ZKWB 4JX8A 4ON9A 2ZT5A 2EP7A 5J2TA 1TZBA 1XPJA 3OPYI 1XA4A 3JWJA 1HSZA 2GAFA 2OP1A 3GFQA 4J16C 3ZU2A 1XZBA 4UPEA 4C4OA 2NAFA 1Y4DE 4OVKA 2ONCA 5CYPA 1YS1X 2BGIA 2PKYX 1N6KA 3I9OA 4BEJA 1PVOA 3EPHA 4WWHA 3DLIA 5AVTA 4PLHA 3CZRA 2CLSA 3TKYA 5KVSA 1RRCA 4QXMA 2P67A 4DKJA 1FRZA 5TS2A 3UAWA 4URHA 4DT1B 4QHYA 1YIDA 3QUQA 4JX9A 5BMVB 1KETA 2LDXA 1L8OA 2JAUA 2DKOA 1YS4A 1Q84A 2R66A 1BIFA 4M46A 4YJHB 3DL7A 3SHWA 2WZDA 1CHNA 1W6UA 1IZ8A 2FWPA 2XUIA 2OV8A 2ZUTA 3PC2A 1T9DA 1WXIA 4IH9A 4Q19A 4W9NA 1JALA 1X7XA 3P32A 4OGGA 3BYZA 4LV8B 1T9BA 4MNTA 4UUOA 1Y3BE 2OB2A 3DQZA 3D64A 4WZZA 3VDXA 2HCJB 3KETA 2FVYA 5AM4A 3ZHZA 1C80A 3AVTA 5FQNA 3G9ZA 4GBED 1Y6ZA 1N2JA 4CMGA 4M7PA 4ZCRA 2AZXA 4RHYA 4TM8A 1D2GA 1GHTA 3ESXA 3OE1A 1I7SB 1UUFA 1VIDA 4P7JA 1GPAA 2VP6A 3QI7A 5E8JA 5EKSA 3PF9A 1EBBA 3WJ2A 1CBUA 1P7WA 2G5TA 3H6KA 1Q20A 4O1MA 1M67A 1UP4A 1E6WA 2DPXA 3AX6A 5AI6A 4BY9E 4RKYA 3HV2A 4DQLA 1MRSA 1AHIA 4DDHA 1JV2B 1E2HA 1JE1A 1LK7A 4K0RA 3KL2A 4WERA 1IJEA 1MA3A 4K03A 5KZMB 3MG9A 4F0JA 1F0KA 3DL0A 5A6SB 1MO3A 2HNAA 2XRFA 3KJNA 2FQWA 2YYZA 3KAKA 1ZVQA 3MCVA 4D0GA 4Y6PA 3SQLA 3ZY5A 1V4NA 3L77A 1SAYA 3WGUA 1A5TA 1MIOB 5HUQA 2WICA 4TMXA 2FPXA 4UU0A 2NZUG 3S8YA 1FDVA 4J9VA 4C4ZA 2YS6A 2WAOA 3H7IA 2A9FA 3L6EA 3EFHA 4L4SA 2PNJA 1XVUA 4PYOA 1HDCA 2QAGB 4HH0A 3RASA 4R8KA 3V7WA 5JAIA 4ZANA 1G2QA 3QHPA 3WNZA 5JD3A 2VKQA 3HJUA 4CTJA 3ID6C 2G5PA 2WR8A 1GRVA 1N6LA 1XK6A 2DX7A 3H65A 3IBCA 3LUAA 2NACA 4QYTA 4DRZA 4EJSB 4AQYB 1QWSA 1SULA 4RCVA 4G81A 4ZOLB 1E2UA 3JQ9A 3EPLA 2HA6A 4A5SA 4UPDA 2X2FA 4ZJPA 5K4HA 1VJRA 8MHTA 1R5OA 2C0CA 5EXPA 3DPSA 4HSGA 2W42A 2KW5A 3NTOA 1OWNA 3L8GA 2D1SA 2OAGA 2RGUA 4JI6B 3Q3HA 1AXGA 1CUCA 1RM3A 3DDSA 4O4HA 5AK0A 4V1CB 1ZAYA 4F5WA 1D8TA 2MDTA 2R8PA 2BBSA 4YHBA 3BD7A 4M6WA 1EB9A 4GXRA 2K4MA 5CDHA 4BQIA 1RZRD 5CLLA 3GEEA 1ONBA 4RDXA 3DZJA 3K0BA 1KYTA 2RH8A 3LA8A 3VYTB 4EPVA 2VUSA 1XZPA 4ZQBA 3GG2A 1P0IA 1Y5NA 1P77A 2R79A 4C08A 1I01A 1LTHR 1XDZA 1O89A 1JFSA 3ZOKA 3NJ4A 2CHQA 1RYFA 3ZJ5A 5F7OA 1ZIDA 1QLJA 4REQB 1VYHA 1H23A 1N6IA 2ECQA 3EBLA 2II6A 1I51A 1K8QA 3UN1A 1EXVA 5JLJA 4J7AA 4R8VA 3CUYA 1HR0B 3TMKA 2QI9C 5ICMA 3BIJA 1G8AA 3L8DA 1ULHA 3BH6A 3SMQA 1XQXA 3WXMA 3R3HA 4DXHA 1U2TA 5AI9A 3KKEA 2VJLA 3JQ7A 2GR9A 3KQVA 4IICA 5I7WA 4POAA 4PTLA 4GVXA 1GQFA 3DTVB 5H9WA 5I7OA 2VBGA 2CLMB 4M9UA 2ZTSA 2OQIA 5G0SA 1XU9A 1DV2A 1R0CA 4EUKA 5GONF 5DLPA 5IVHA 3AUJB 3N2NA 5JFGA 3W3AH 5ADUS 4KDFA 3ROMA 4E2FA 1KQGA 1K6XA 4NF2A 2VXOA 4YXWD 4BB9A 4PHCA 221PA 2QD1A 4ZZ0A 3KS9A 2XWJI 4RQBA 1BGVA 4CZ2A 1CJVC 1MRNA 4IAOA 1OBVA 1USGA 3D3KA 4YNBA 3VUFA 2O8FB 1R0XA 2FRDC 2C3UA 1EWKA 3U9LA 3WVNA 3N2LA 3ROXA 4ALNA 4FHGA 4N41A 4KZKA 3V4VB 3TTVA 3AUXA 3T06B 1L4GA 2YJ5A 1RAFA 3B5EA 1RJWA 4IDGA 5LZ5A 1G3RA 1NLYA 2IPLA 2W6OA 3IV6A 1SG9A 1ECGA 1W5TA 3O1LA 2VTVA 1ZU5A 2JFYA 4WUVA 2E48A 3L1UA 4X91A 5AW6A 4QRDA 1OTYA 2ZSHA 3KVNA 5KTKA 5KS2A 1XJWA 4QQKA 2V6FA 3LZCA 3KPWA 3ZCPA 4JL5A 3V00A 5EIBC 3FCSB 4MWEA 4TL7A 4XTRA 5I9MA 1Z38A 1G17A 3HCDA 2B1RA 1Q22A 3L6OO 4IDHA 4WNAB 4OB8A 4DHWA 4EYQA 1IOLA 1W88A 4X6LA 2D5LA 1YS6A 2HTEA 3PD0A 4HQRA 4BLUA 4XYGA 4TS3A 1M3SA 1MDFA 2HFKA 3GVIA 2J4CA 3LSYA 3MT7A 4CHTA 4QT4A 2R8EA 4DVGA 3ENQA 3A9WA 4J0DA 2YNMD 4FBGA 4R68A 3X43A 5BOSA 5MFZA 4XWOA 3AQ4A 2BMEA 3K53A 2CXPA 3I6MA 4J3JA 2OK8A 3L7KA 1OF1A 2OZVA 2ZRDA 1KVRA 1OR8A 2H06A 1M34A 1ULSA 2UZ0A 4L4XA 4DIFA 1E6UA 1O4VA 4ENTA 4RV9A 4D8XA 2VYNA 4RTJA 2PE5A 2UXBB 2GCGA 2V7QD 2ZIVB 5IBCA 1VPLA 2JLQA 2XTMA 3HZZA 3B9RA 1VI2A 4O4LF 4O2AA 1CG6A 4HDRA 3WJ1A 1ODKA 1I94B 1C4XA 3L04A 3CLSC 5JCPA 3CLVA 2P3QA 4K6FA 3DAFA 1U1DA 2CXTA 4HAXA 3CNOA 4JXKA 2XOXA 3O82A 5GV8A 2HY7A 5E9QA 3I2FA 5CK4A 4F92B 2FUNB 3D2LA 5L3SB 1O58A 5IT0A 2CDAA 3K16A 1P1BA 3VDNB 2JAWA 2XQFA 1FRFS 3TRIA 3JWIA 5NULA 4JP3A 2ID7A 3O6VA 2V45A 3AINA 3MGCA 5FO0A 2AI2A 3AV3A 2QTVA 3OEEA 4ZQEA 5EQDA 3TXAA 1N6HA 3B3QA 3UG7A 4CTOA 4JSYA 2PUJA 1OHHD 1M2VB 3TOZA 4WFJA 1HDRA 3F7TA 2P8JA 3Q5DA 2XQKA 4IV0A 3JQAD 3MF4A 4F8EA 3V2GA 5EJ9A 1FFDA 3LY9A 2CL6X 1CK4A 5KYYB 3HO8A 3SVTA 4ZVKA 4TMKA 4X62B 1V7PC 3I30X 2ZT7A 1TW2A 2Z30A 3OQ1A 4MKHA 1YCDA 1C9EA 1GVNB 1DGQA 1KFKB 4KQIA 3DNFA 4FFWA 1OE0A 4JBWA 3I09A 3KTOA 3N05A 2GILA 2XITA 2DFKB 3HSKA 4OH7A 4RESA 4MB0A 1WOMA 3ZJTA 1QORA 4FMPA 3A7DA 3B53X 5K0ZA 3ANLA 4FC7A 1KMQA 1NX6A 3JQBA 5JZVA 1GNVA 2GSWA 5D84A 4TSFD 5JVDA 3VA7A 1Y7LA 3WLRA 1MB9A 2X8WA 1OXVA 3EXEA 3ONDA 1VSQA 2FYTA 3PEUA 4NE2A 4Q9KA 3LLMA 4HNAB 3ENNA 4JR2A 3VYVA 2MYTA 3ZEIA 2IU4A 4E4YA 4PC6A 1ADJA 5K99A 1QTQA 1EE1A 4DKXA 2WIGA 3G8DA 3HP1A 3I8SA 1QNLA 2QL6A 3DNPA 1PRYA 2NTYC 4MICA 1P9LA 1IBCA 3AW8A 3PFKA 3BJIC 4DRYA 2QF7A 2WT4A 4FTWA 5EZ5A 2JGNA 1YNOA 1N3YA 3WGQA 4CE6A 3R8FA 5KNCD 3ODPA 3D54D 4B80A 4RL6A 1ILWA 3C6XA 4XEUA 5J58A 4UMEA 2XXAB 4R1QA 1IHDA 3DFFA 2XYPA 2XY4A 3AP1A 1KH2A 1V41E 3QPWA 1N5MA 3GDGA 4QXPA 4TL8A 5EXTA 1U0BB 2ZT6A 3AT1A 1DLIA 3FPSA 3MCUA 4FE7A 4LJ5A 2XZOA 4XIYA 2C4HA 2P2SA 1WXQA 4L15A 5KNBH 4LISA 3AY3A 2GB4A 1W1UA 1EB8A 2B5WA 4EG1A 5TT0A 2YXDA 3H1PA 3GY0A 3NVMB 4N3GA 2AOTB 4ZYVA 1EJBA 1OFTA 4EPRA 1YIOA 3H6GA 3NIWA 2W2KB 4MKZA 3V8PA 1TTTA 2IH5A 2WU3A 1L1QA 4O08A 4UXHA 1XRNA 1VLJA 3W2HA 2XIQA 1SHTX 3IEKA 1NQWA 4AZTA 4FCTA 3SEFA 4F5YA 3PQ3A 1L5GB 1R0YA 4GFDA 4D79A 1LDNA 1Q83A 5FLKA 1XMJA 3PQ8A 1BVYF 3OFND 1EVZA 1P6UA 2H48A 1WBDA 1E1QA 2IXFA 3A06A 1OFHA 2COEA 2FOLA 3H2GA 4O2RA 1H94A 4M37A 4IZ6A 4P4NA 4NU6A 2YWHA 4XJVA 1LBEA 2NTJA 3MMPA 3L82B 4XM2A 2DU8A 3IP9A 4EP1A 4MRMA 2OZLA 4ZO6A 5DVZA 1ZZEA 1ZD8A 2XRMA 1Q1BA 2O54A 3LV8A 1HEIA 4S2EA 5T4HA 1C9KA 5HIMA 5L7WA 3I1IA 2J6IA 2Z8XA 1DJPA 1PGQA 4ZVUA 1FUIA 1VE5A 2QQEA 4NENA 2FZWA 3O47A 4BBZA 1F3OA 3NXSA 4E30A 2ICAA 4E4RA 2QVXX 2Z95A 1B6RA 2CY0A 2YW2A 3FNQA 2GZAA 3QKRB 4LXYA 5EGNA 3RVJA 4KXNA 4AJIA 1T9AA 2HCRA 2IDKA 2RI1A 3R6WA 3SZRA 3AR9A 3W90A 5HCNA 3VI4B 1I2MA 4MPJA 1RD4A 1UAYA 2FEAA 2UZ1A 2BMDA 4MLCA 3RROA 5CJPA 2KBFA 3FKQA 5AW5A 3U31A 3WP1B 4GX5A 2GERA 3PC7A 2ZUBA 2C2MA 4R16A 3OMWA 2RHOA 3RWMB 2GDZA 2L0XA 2O14A 3ESDA 3LW8A 3NKLA 4MYRA 5EPOA 5A04A 5LLDA 3B6ZA 2A30A 4CM7A 3WV4A 1Q6ZA 3NBZC 2E5FA 1M2EA 3A9VA 3FDXA 5COBA 5TARA 4WRRA 1Q11A 2PXCA 3LPDA 1R9GA 4YLEA 1L7NA 1QLWA 2XLBA 4MV6A 3VNSA 1ESNA 3HR4A 5IC4A 5LYYA 2FW7A 3GGJA 4XGQA 1U7OA 1GQYA 2Q5QA 2YHSA 3VAAA 4ARBA 1E2DA 4ZQGA 4B3FX 2VP0A 1NQ5A 1Q0QA 3WP0A 2VTBB 3HA5A 1W581 4G0OA 4Q3CA 4ASUD 1WUIS 4LS3A 4UUAA 3N8GA 2BPOA 1LBSA 4PRYA 2X3YA 4M54A 4L8VA 3HYNA 3KTAB 4GECA 4PXSA 1ZC3A 3IPXA 4TMYA 1YCFA 4UEJA 1Y9EA 2JHGA 1YZLA 3QBTA 5B7PA 2C1ZA 2ZRJA 4X8MA 1ZLYA 2AQIA 3CXRA 1IXYA 4GWLA 4IUCS 1ZWLA 3C2QA 4CKEB 4OL9A 3MUOA 1DX6A 3UAXA 2L18A 1XNRB 1UAGA 2Y71A 3NOXA 2XDQA 2FPSA 3D6MA 4J1QA 1LSJA 3EXAA 1CVLA 1W5SA 3T5CA 1FFYA 1C0LA 1SUPA 3UJBA 4BKPA 1X80B 4XWYA 2DRIA 1O6ZA 1S96A 3RYIA 2IIQA 4NAHA 4CCWA 5JC8A 3H87A 1C41A 3H9CA 1KSJA 4M0MA 3V6LA 2Y4NA 4D74A 3TL2A 4I3GA 3B20A 2IT1A 4DLPA 3NIBA 5D1HA 2IZ0A 5JSUA 5EWMB 1HC7A 2JZOA 2ZAYA 3AHCA 3EHEA 4RKFA 4Y1RB 3WMWA 5BSKA 1JG1A 4UFOA 4I99A 1PL6A 3DR5A 3TM5A 3L9WA 4PCLA 4UBOA 4J0CA 4IMJB 4UM8B 4ZQHA 3WMFA 3ZE0B 3RNOA 2G1UA 1QRUA 3H19A 4O2BB 3URMA 1NJFA 1JPUA 4GSKA 5SICE 4DMFA 2G4LA 1U0SY 1ZHOA 1T1SA 5DP1A 1NAIA 2ZI9A 1A9XA 1Z82A 3MJ4A 3TRFA 4AC9A 4ZP1A 1ZMOA 3ORRA 3I3SR 1E2JA 1OJLA 1NZJA 2F2TA 1A2BA 3ORHA 2QX8A 4MVJF 5F2KA 4G5FA 5C1OA 1JJIA 1X7GA 1CUAA 1Y9ZA 4HXYA 4KQ2A 2QUIA 3SC2A 4NOKA 2PZMA 4TQAA 1MOZA 4YO7A 1ZL2A 2ADOA 1JLKA 5IUJC 4KBFA 2OFWA 4DV1B 3CT4A 4LGCA 4AB1A 4BPBA 1W7AA 4NBLA 4PX3A 2P9HA 4JEHA 4OSPA 1FSGA 1DAGA 1KVTA 1EHCA 1TI7A 1R0RE 2PZBA 4Y2UA 5LQKA 1SOWA 2XOKD 3O38A 3HC7A 2DFNA 4OJMX 1K75A 5HR5A 2GESA 3R5FA 2HF7A 1OVGA 4IIHA 3I0NA 2JNWA 3PXDA 3LJKA 4WKGA 3GD7A 1KBQA 3SFTA 4LCEA 3FHJA 3ZCQA 3L41A 2JDID 3VHLB 4LE0A 2HHAA 5TR9A 2VNKA 1BMDA 2A14A 2QROA 2RIRA 4UCWA 4DBVO 1ZONA 5IM4F 1DJNA 2A3NA 3LECA 1VE1A 4K81B 4GMXA 5HF8A 3VNAA 5K3SA 2QJWA 4KOAA 3T5PA 4PG5A 1G4AE 4MUBA 4RHUA 2ERXA 3EZYA 3C3KA 3AJAA 7AT1A 4CETA 1HL3A 4C7OB 2P69A 3DBHA 3RW9A 5JAUA 3CY6A 4X8LA 4PF1A 2VG8A 5LP1A 2IZ7A 4NPCA 3KWFA 4HAWA 4LDRA 1UKCA 1QE0A 1NXQA 1FPMA 3M81A 1EFPB 4LRSB 1GADO 3T6KA 3U44A 5CA0F 5FTMA 3ZV4A 2A9RA 2HMSA 2W6NA 3AZQA 3TMYA 4EABA 3OIYA 1YL6A 2A88A 3FRHA 1PQYA 2M2IA 2O7RA 1RYEA 1HQCA 1N1EA 3RDPA 4EMSA 5HZGA 3TMAA 1NLUA 1AZWA 2B34A 2G40A 3AJEA 4N8SA 2NIPA 3I72A 1VBFA 2ALJA 3CF0A 3KYJB 3OA2A 4P5EA 4WX2B 3U1TA 1N2CE 4H16A 1OPXA 3IO3A 3K09C 3O74A 4OK6A 3TPZA 5COQA 2I6UA 3F4LA 2P1ZA 2ZJAA 2X77A 1EVYA 2ZTLA 2OCLA 1NBHA 1U02A 4FZ3A 4D8VA 5I9LA 4OQEA 2EX1A 3K96A 2I78A 1XWWA 2BFOA 4LXXA 2JI6A 3CMMA 3KDPA 1S8AA 4FZRA 2XZTA 3NCHA 3WLJA 5CT4A 3MLBA 2JBAA 5HZHA 5A62A 2V7VA 4M0PA 2ANBA 2JD0A 4OJQA 4CMIB 4LSWA 3A0UA 3BTVA 2BBWA 1U9YA 1E3EA 3EZ2A 3OU2A 3RRBA 1CB7A 2V7XA 5AK6A 5FR2A 1N2GA 4YMTA 4A2CA 1KQ3A 1ZIXA 2HLNA 2ZQ5A 1C0PA 9LDBA 2YYSA 1I6KA 2ZWIA 4XRRA 5L3QA 3IIJA 3MPUA 1EFLA 3ZHYA 2PS3A 2FSFA 3HZRA 2X0EA 3FFWA 4HGRA 4RTSA 1BE6A 1Q3TA 5E7MA 4MGEA 1PVDA 2PGDA 3EGWA 2FOIA 2PX8A 2RGCA 3LNCA 4UTXA 2EGHA 3BXPA 4JT9A 2RFLA 4UVEA 5FWNA 4LYYA 1EU1A 2FWBA 1KJIA 3FTPA 2VPXA 3RRZA 3VVMA 2G4CA 3A25A 5KI6A 1OY1A 3RAEC 3LP5A 1PJAA 4JP1A 4D26A 3AVUA 3J7TA 4UHJA 3VO8A 2ID8A 2FN3A 1D0SA 1P2DA 3PIIA 1GJRA 2P75A 2BM8A 2W6CX 4EYOA 5F3RA 3R6DA 5KYVA 2GYWA 5CB4B 4YUWA 1QFJA 2RI6A 2XE8A 1UZMA 3GL9A 4D9MA 2Q6KA 4N0DA 1YNSA 4E22A 1WU7A 3ZK9A 4U1RA 4GGMX 4BS9A 3HDGA 1F60A 4KDRA 4U5XA 1UWCA 4LWZA 4IDQA 1VYUA 1PR1A 3RU7A 1HT1E 4QDKA 2YMLA 4WFQA 5LOVA 4IW3B 2C98A 4NHEA 1U7UA 2JGJA 3AFIA 4KLAA 1DTWB 1WY5A 4LJ4A 3NATA 2HQRA 3FPCA 2VJDA 3WTBA 3V8VA 4FOPA 2AEEA 5JWHA 4BVAA 1H6BA 3C7KA 4BX2A 3WDLA 4HDOB 1TAQA 2RI0A 1FNDA 2BFDA 1O8BA 1ZUD1 2Z5FA 4P6VF 4ZCQA 4QGSA 1GGKA 1EIWA 3FOWA 1LPOA 1UBUS 4G0WA 2LD4A 3ADPA 3OH8A 3SZ3A 1FFXB 1K0UA 4PVCA 1Z7BA 3GA7A 3WBJA 2J5BA 5JJCA 2DBRA 5IF3A 1QOZA 4L9SA 3RVQA 5C8ZA 1F4VA 2XWPA 3MBIA 5TPZD 3K0FA 3WL4A 1LS6A 4K28A 3WLLA 4NICA 2JLVA 6Q21A 4DREA 2A1TS 4QUBA 2AQ8A 4LKOA 3OWHA 2F4VB 1EDDA 2QTMA 1HM5A 4HZUB 4ZCLA 4K0KB 3ZVLA 3V80A 1JGTA 2G83A 3LHDA 5EIOA 3R5TA 1QANA 2R62A 4WN3A 3VNQA 3AI2A 2NSHA 5BRAA 4EJ0A 1BCSB 1OXMA 1DAFA 4EY4A 3DZKA 3HRKA 2JEYA 5BW5A 2Q50A 3D1LA 5TE9A 4QL3A 3DWIA 4TXLA 2FSIA 4HDMA 4H3HB 3WBBA 1DEXA 1U6JA 2QU7A 4E5MA 3W4KA 4MUYA 1QJCA 2QORA 2C07A 3ICWA 3B8HA 5JMPA 1IY1A 1JLMA 4AYXA 4BX9A 4KR3A 2FMHA 1SG6A 1NN3A 1T6YA 2X76A 3A4LA 3P45A 3PRKE 4R1MA 5IM5A 3V2IA 4JMPA 4V0SA 4NZNA 2P27A 2KS6A 3HKEB 5FNVF 4CT5A 1CRPA 5C34B 4R2HA 3CVWA 4R9SA 2XBMA 3L7DA 1FP6A 4XX0A 3LT4A 5KKAA 2UUPA 1T8PA 3VDQA 4QWMA 1ODLA 1P1RA 4CI9A 4E2YA 3KFLA 4MZDA 2R3SA 3DCNA 3PGMA 3S2UA 3W5IA 3C7CB 4F6LA 1VP9A 1FX0A 1H4TA 1YJ5A 2PT6A 3FR7A 1HRDA 1MEJA 3OIDA 2HPHA 4RW0A 2A1IA 3TSAA 4E94A 1Z63A 3PEYA 3RFVA 3UM9A 5FAXA 2KM1A 1IXRC 2MSLA 3S2SA 1XDWA 1JAXA 1NW9B 1PIWA 3KEOA 1J0XO 2LXNA 4RDIA 4UBLA 5FUBA 4AZ3B 4BCBA 1T35A 1GD1O 1K88A 1OD6A 4U7FA 3EMKA 4QTXA 4X71A 5IFKA 4CUZA 1E92A 1GV0A 1KMIY 1IQPA 1GZ7A 4IYRA 4KMMA 2JLBA 2JLSA 1JTEA 1M1ZA 3AUUA 4BQNA 3E2MA 2AG6A 4EL5A 2GJKA 5A0TA 2PVCA 2GEFA 4N7RA 1T2UA 3OTQA 1BEEA 1U8XX 4Z0TA 1PV1A 2I4NA 2FUEA 4KVFA 3MAAC 1I0IA 1QB7A 2XMDA 2EFCB 3NX4A 4H2DA 2ZU0C 4IIBA 4RJKA 4TUYF 3MQ2A 4R2JA 3WJ7A 3ZZNA 1M1YA 1OZFA 3K9HA 5CXQA 3W3ZB 5SYAA 4RZ2A 5GZ3A 2O20A 4WIAA 1EZ4A 3W3AD 2D1QA 3H4MA 5A06A 5K8UA 3JYLA 1VLHA 2RK4A 1EX6A 2YTZA 3IMKA 4I55B 3W6UA 2C7OA 4I5GA 1XJ0A 2AD5A 1I36A 4LN1A 1XL1A 4EY8A 4TLEA 1B14A 4RD1A 2OKCA 2ORED 4F85A 4IDBA 3BWCA 1GQOA 4K9KA 1PNVA 2JEOA 3V8RA 1DE0A 1WMAA 1C1YA 1WZNA 5LWHA 2C7QA 2AZMA 2YHIB 1C7FA 2WM3A 3LIPA 4ZO8A 5EHNA 5B30A 4MRSA 2Y2VA 4RVNA 2J0VA 2XKKA 5EJGA 3OT1B 2ZI4A 2QRHA 4RNCA 2Q9UA 3AQIA 5F2NA 2EJCA 3C74A 2M1XA 2O3SA 4UM5A 4WOJA 3W79A 1CDOA 3W78A 1E9DA 1CHDA 4LBWA 4KO8A 3EVZA 4FNAA 5FD8A 3T3OA 5DYIA 4ARUA 4G67A 1B1CA 2AFIB 1V3UA 4TKZA 5FWYA 1GYQA 3FYUC 3DWFA 2VZLA 3HADA 1EWVA 2JLXA 1DAHA 5ED0A 5BSGA 1TFRA 1UC9A 2JJ8A 4CJXA 3RIXA 4F21A 1QYVA 1R6AA 3R7WA 1VPDA 2P3LA 4OXIA 4O3FA 3ONWA 2PUAA 2VF5X 3VPBA 3OQPA 2GQ0A 5DHUA 1JEQA 1X77A 4YRTA 4CEJA 3KE8A 2DPGA 4I8XA 4OFZA 5FTNA 3UPTA 4EB8A 1RPZA 2VRNA 3DULA 1KDPA 3WLTA 1QQAA 4Z53A 2JVJA 1D2HA 1IN7A 2REQA 1RWNA 3L4BC 3VFDA 1VKRA 1NYRA 1W76A 4CODB 4U2GA 2X6RA 3PT5A 1E77A 4Y2YA 4C29A 3ZBPA 4F2DA 3R9XB 4RMGA 4AYWA 3EGDB 1CS0A 4O4JA 4NJMA 5FX2A 4IQ0A 1KRXA 5GJWC 2ZRHA 5DHSA 3LQYA 3K05A 4WCFB 3OUZA 5CT6A 4D0SA 1H69A 2WF8A 2BI4A 2ZRMA 3BGDA 1MJNA 1P2BA 4WL0A 1FA9A 2A5GA 1R5NA 4X24A 5DI3A 3K5HA 1FMFA 4RD4A 2WJ4A 3AIKA 2Q4DA 3STXA 3ETHA 3RJTA 2H07A 4EMTA 4R2KA 3KQUA 2F3SA 4KWCA 3GUUA 4J76A 4D5GA 4YFYA 1NLFA 2OHGA 4ZCPA 3WAJA 2YZNA 1BFDA 3O31A 4TV9F 1BS9A 1CZLA 3BWVA 2RAVA 4XX1A 2I1LA 3GLHE 3QYAA 3R5KA 4ERXA 2FPPB 4RWZA 2HHCA 4PN7A 5TPWA 4YV2A 3KXPA 2ESRA 4G2NA 1NF2A 1K4YA 2NU7B 2ZUVA 1JDUA 2G77B 3AU8A 3PWZA 4W82A 3I83A 2AEJA 2PUCA 1T36B 3G5MA 3LCUA 3C16C 4PIPA 4ZDIA 1P17A 2CE7A 4G24A 3ENWA 4WXPA 1F12A 1MXHA 1CEYA 1J99A 5ES3A 3IDOA 1VHLA 4X64B 2CUNA 5FWAA 4E4TA 5A0FA 4UASA 2J31A 2D5AA 3FBTA 3AV0B 4KMOA 4RPLA 5IPFA 2FFJA 2WB4A 1Z6PA 5JHHB 4ZIRB 4FYVA 1XCLA 1XTVA 1GTVA 4R3NA 4X1YB 2HHJA 1GOTA 4NAUA 2FWMX 1KIMA 3HCRA 1NUHA 3G23A 5A7FA 5E7IA 1XNHA 3CV3A 3QMPA 3FCCA 2ZP1A 3O4HA 1NOKA 5LIRA 2DY1A 2IGTA 3KPJA 1F6WA 1VRVA 2HCBA 3MRVA 4MITA 5B12A 1X8LA 3CKKA 3MFYA 3DTNA 1RYYA 1X92A 2JVIA 1GQQA 1GGHA 1HKHA 3PUXA 2QV7A 4Y30A 3E9ZA 4XYMA 4G5HA 4LRTB 3UGTA 1WDKA 1VMEA 2WWYA 1DC3A 4XSVA 2H2DA 2UYYA 2X3FA 2ZREA 2HRQA 3AFHA 3B12A 3E9NA 3JAKB 4NX2A 3ZGYA 1G6Q1 5KNBD 1WJGA 3DBIA 4BV8A 2FSSA 1XZCA 1AKWA 2ZS9A 1UK7A 1E79D 4NDZA 1J2UA 2BFCB 2N47A 5CH8A 1ZD4A 3BWMA 3IQIX 3Q3GE 1G64A 2E4UA 4UHFA 4WBSA 4LSGA 5JBQA 4WXRA 2VHVA 3E9DA 2X15A 1NE2A 2REBA 2CD9A 3FYUB 3HSYA 3L7MA 3UAYA 1LFDB 1KAHA 4W1PA 1G3UA 3K7EA 3GLVA 4NECA 1B2RA 4L7VA 1UKYA 5JR3A 2Z6AA 1PFYA 5FPHA 2EWMA 1WHTB 2CFOA 2GFQA 2OYRA 5ADVA 1QJ4A 4FFLA 2DAPA 2GD2A 4J75A 4QQRA 1S8NA 3FFAA 1TX4B 2VCYA 4FZ5A 4ND8B 1V9CA 1WW8A 1Z16A 1T4DA 2CDCA 4X1KA 2FP4B 2QX9A 3OKFA 2HI0A 5M3BA 1PJZA 3SDBA 1F51E 1TIPA 3SXJA 3WZLA 4BP9A 4DHEA 3CB2A 4BNZA 1IN5A 3QVWA 4PX2A 3SLRA 3DFIA 4LYEA 5JXJA 5IRCD 3SQWA 1PDWA 3FZQA 3KELA 3L4EA 2ACEA 4KB5A 4M2LA 5DN9A 4D3SA 3EEYA 4QZVA 2GHQA 5DXJA 3C1AA 1Z0FA 3O8DA 4LCBA 3KSAC 1Y6QA 3LW7A 1ZCAA 3DD1A 3MWLA 2J4FA 4Z6KA 4OJTA 2BP7B 1TYDE 2WAAA 3I42A 4CW7A 4UM9B 2QKYA 2I7DA 3VJMA 1V37A 3SICE 1UJ5A 2HWXA 4HUQB 1YHZA 1C3OB 4CV3A 4UBMA 1Q5PA 4WDQA 2NVUA 4DARA 4ARZA 4G65A 1W52X 3A05A 3GQVA 5B37A 3T3HA 2JGMA 2WYUA 3ZE6A 4OJYA 3D4LA 3MT9A 3QMMA 1G20B 2X5OA 1JEDA 5TX7A 1JMVA 1UDCA 3TSYA 1VIMA 1T8RA 1H0KA 3PUKA 4CQMD 2CNKA 4OMFG 1IC6A 1G0OA 4BFYA 3AVYA 4JV5B 3ZDQA 4D92A 4RPKA 1DEAA 4QOJA 4R3WA 2OFOA 4AVYA 1NP7A 4X44A 1C2TA 4LXQA 1P7YA 1G4HA 4IILA 4TTTS 3QWAA 4WY2A 3B38A 2EAUA 1PZHA 1GPWB 5JS1A 2IX9A 2WWVD 1J8VA 3W6OA 1RRGA 3DOCA 4GPBA 2Q5FA 5FL7D 1VDMA 3L4SO 2NXJA 3WQSB 4ZEMA 4KQKA 5BYBA 1HX7A 4KAJA 6PFKA 1PS9A 1Z15A 3EA5A 1FLDA 2WMDA 3IPCA 2B7CA 3MA0A 4NI5A 4V0MA 3OZFA 3PS9A 3GUVA 3T5DA 5BR4A 1KDVA 2HJWA 4QBGB 4LVUA 4PFSA 4FS3A 1YAJA 3RRXA 4OI0A 4YQEA 2HK6A 1U7DA 3COSA 4CDGA 3FI9A 1CR2A 3D8TA 3UUWA 3I9KA 2ABWA 2V9CA 5A03A 1F17A 4FHFA 3U81A 5K0TA 1VXRA 1L5MA 1D2NA 2I3AA 5DMHA 2W43A 3WAKA 2NM0A 4DXDA 1Y5RA 4I4TF 4NK5A 3BWEA 4IG4A 2GXUA 4K8OA 4URZR 1KC3A 1R6XA 2REXB 2YUTA 3HU3A 3DA8A 3SI7A 1LK0A 3B60A 4BRZA 3BIOA 1ZCFA 3EVGA 2GZDA 4TVSA 3RTDA 1G9XA 3TCKA 5E2AA 3U4AA 3MJDA 4YA6A 3MWKA 4MW5A 3MILA 2ZYTX 2LRHA 1PR2A 3F2IA 5I6DA 4A15A 2CBZA 1MAVA 2XIJA 5EJ6A 1BKYA 5JFOA 4ZYXA 3FCAA 2AMJA 3BF7A 3ETLA 3DO8A 1ICIA 2DQYA 4ZOBA 1FJGB 3FHCB 1RCTE 2YIVX 4JASB 1RPTA 3PX2A 1HE2A 2RCYA 2PUGA 1RJFA 3A1VA 3FPAA 1GPKA 1O0CA 1EA7A 1AA9A 4ZOEA 4WBNB 3CUWA 1A9SA 1USIA 4FFDA 4XRGA 1YJ8A 4RS3A 4Z99A 1C50A 1TM1E 1XDUA 3D4PA 4OM8A 1N8SA 4Q9DA 4YMWA 3TZHA 3VAYA 4JC8A 3QW4B 5IC5A 3HP7A 3WSVA 2AYXA 3ZNPA 1JG3A 1JFFA 2Y0EA 1NG1A 2DH5A 4HFMA 4RDCA 1GCAA 1M6VA 4HPXB 4PRZA 4PYIA 1RRMA 4BQQA 1E9EA 3I6BA 1YMVA 3IAHA 3U9TA 4YY3B 1E2MA 1RHRA 5A4JA 4BZPA 3N6RA 4OU4A 4TT8A 5AM0A 1K8ZB 4LE1A 3TTTA 5K6TA 1R0SA 1UJNA 2IKSA 3P0EA 1OX4A 3E7PA 3IB6A 2IYXA 3AHIA 4QAQA 5EZYF 4CKCB 3U4MA 2P9QA 2XDWA 1IQRA 4HEA1 1HL7A 3WL6A 4JLVA 3OTGA 3DKIA 1MZVA 1E3IA 2C1EA 4B3GA 1L3BA 3AF2A 4MCAA 3U0VA 1P0CA 2XEXA 3F3MA 2X6QA 1Y1LA 3BCUA 3F47A 4WZAE 2JPDA 3S2IA 5BYAA 2FZKA 5JV5A 1JWAB 1GUDA 1J22A 1GGNA 2BZGA 4BYGA 3QXCA 4ZAVA 4O33A 2WVAA 2BVNA 4LX0A 4KITB 1RHMA 2FN7A 2CV0A 3R24A 3K0AB 5E95A 4WZBB 4ZZ1A 3DFUA 4MK4A 2WIAA 4UVIA 4CV0A 4I2VA 3O2SB 4KK3A 1DWQA 3KAPA 4RGVA 3V7YA 1M1XB 3QLEA 5E1BA 3OZUA 3REGA 4EAQA 5HQTA 2G3YA 3LQQA 5CDFA 3MRSA 5DW3A 3QPVA 2N1BA 5KNDH 1WSAA 1PQWA 1Z35A 1FXUA 2TMDA 4MEBA 2QMEA 4G8JA 5KOJB 5DN6D 3PF8A 3JVVA 4RQTA 2NVBA 1DBVO 2I67A 1CEQA 4DV6B 4EFMA 4B7AA 1NVTA 4IIYA 3Q7TA 1UK8A 3BA1A 4U8GA 5EJAA 3CN7A 3EGVA 1BQ3A 2DVMA 2VFAA 2WG0A 3WIDA 2NLOA 1SKAA 2WPDA 3N8NA 5GONA 1KO7A 5HTKA 3SKXA 1IVSA 4MR7B 5EHZA 1RE1A 3I23A 3SAJA 1UIRA 2A86A 5MGNA 3CC8A 3L2OB 1KORA 2A1UA 1E5VA 4Z3KA 1BDIA 3U3JA 5ESXA 2WWWA 3HVJA 3HKCB 2R1ZA 4IVRA 5JALA 4D3DA 4F96A 2VNHA 1CP2A 4FU0A 2IX3A 3O1IC 1LXCA 2XQJA 1RXVA 1WW3A 5C5DA 2IDJA 4N0EA 3ZCSA 3HYLA 5C8DA 1QUEA 4H3SA 1H93A 3LVRE 2J3MA 3DHNA 1IDN1 1X7ZA 2FJPA 1EFHA 3JRXA 2HYDA 4NZ9A 2BTOA 2AJDA 2LCIA 2ORIA 2PMBA 3VOAA 1JPJA 2PQ0A 5TS3A 2JGEA 3HU5A 4RLSA 1RWWA 2QQ0A 4DOMA 3CZ9A 2ZYWX 3FNFA 3GJSA 3A11A 1XVVA 3L7AA 2OC4A 1RFGE 4IIJB 4P38A 2YVLA 2VAVA 1NM5A 3FFXA 4WLNA 4EARA 2C3PA 4RH0A 3T5GA 3V4RA 1I4EB 2YZ2A 8ATCA 1P5ZB 2OG1A 3N0VA 3ZW8A 2O5EA 3RJ9A 1PTKA 2R7NA 3DMTA 1GDHA 2FX5A 2PX3A 4OQDA 4RAQA 2BEUB 4JKOA 1WW2A 3FPHA 3U7IA 1ZK1A 2QUJA 1N2IA 1RS0A 1R0BA 2CUTA 1OZHA 2V7GA 3F5SA 3EXHA 4PIVA 4X45A 5AVJA 3R7AA 4Q4DA 4XFJA 1IHXA 2UU9B 4R0NA 1RPJA 4LUCA 4BB5A 2J08A 2ISCA 4PZ9A 4B71A 1CNEA 4UQOA 2IHKA 1ZI8A 4J43A 2QRMA 4Y9DA 5EUBA 2HDHA 1G60A