5K0ZA

Cryo-em structure of lactate dehydrogenase (ldh) in inhibitor-bound state
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
331
structure length
317
Chain Sequence
ATLKEKLITPVTVPSNKITVVGVGQVGMACAISILGKGLCDELALVDVLEDKLKGEMMDLQHGSLFLQTHKIVADKDYAVTANSKIVVVTAGVLVQRNVNVFKFIIPQIVKYSPNCTILVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDTARFRYLMAERLGIHPTSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPAMGTDKDSENWKEVHKQVVESAYEVIRLKGYTNWAIGLSVAELCETMLKNLYRVHSVSTLVKGTYGIENDVFLSLPCVLSASGLTSVINQKLKDDEVAQLKKSADTLWSIQKDLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase B chain
publication title Breaking Cryo-EM Resolution Barriers to Facilitate Drug Discovery.
pubmed doi rcsb
source organism Gallus gallus
total genus 88
structure length 317
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5k0zA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5k0zA02
2GD1O 2JCYA 3W4JA 4BO5A 5EL0A 1I2BA 4GI2A 4KUEA 4L76A 2ILTA 3GY0A 3VDRA 1ADGA 1LLQA 3R6DA 4ALMA 2TMDA 1T1SA 4GVLA 3ZW8A 3RUFA 4D41A 1W0CA 1R4MB 1DPGA 4BO4A 3KB6A 2VUSA 1GY8A 1RWBA 5JS6A 1E0DA 5I7EA 3W4KA 5CP8A 1AGNA 3MZ0A 2HAEA 4UUMA 1VL6A 1O5IA 1QV7A 1BXGB 4E2XA 3UAGA 4KQXA 3G49A 4LCJA 3VPXA 4P4GA 3CPSA 4J43A 4M86A 4Q39A 1HT0A 4NJMA 3LC7O 5CEJA 4FS3A 5THQA 1U5CA 1U4SA 4O63O 3A06A 1T25A 1HE5A 1T2CA 2NUAA 3KYCA 2GNAA 2EP7A 5GZ6A 4J4BA 4PLYA 1ADFA 1WW8A 2RAFA 3MWEB 1HWYA 3M2PA 3I83A 1KERA 2VQ3A 3KVOA 2ZJ0A 4XQGA 1VSVA 3WYEA 2WSBA 3BMQB 4CM1A 3WXBA 1PGJA 4DREA 4XR4A 2GZ3A 1L7EA 1ULSA 4HP8A 1NASA 2ZIZA 1DO8A 2POQX 3ZWNA 3OBBA 3BTUA 2PY6A 3ITKA 1Y8QA 1NFFA 2XXJA 1Y5MA 4OL9A 4XCVA 1LTHR 3HN2A 5CAEA 1IZ0A 2XF8A 4WCFA 2D0IA 4Z3KA 2ZB7A 1UXJA 2R00C 4XJSA 2Y1DA 4IZIA 3DBHA 5IN5A 2V6BA 1HE3A 2G5CA 2HMSA 3CTMA 3RAJA 3D4NA 3SX2A 3O4RA 3TZ6A 4BQPA 2Q1TA 3H2SA 1NWHA 1U2GA 3BMOA 2IEDA 3K8ZA 1PL8A 3DC2A 4UVEA 1V35A 1DLJA 5IDYA 4E4YA 1AXGA 1BXZA 4Q3NA 3BMNA 3BIOA 3IIEA 4CQMA 1NXQA 2P2SA 3GC6A 1XWFA 2JFGA 2UV8A 2ZK7A 1H9AA 1ONOA 4ZGWA 3CMCO 5HWSA 2BI7A 1B8VA 3KSUA 2E6UX 2GZ2A 1QKIA 4D79A 4DBVO 3IKTA 2PLAA 3HDQA 3ZNPA 1VSUA 1EE9A 2A35A 2ET6A 3A1NA 3FTPA 3Q2KA 4JJIA 3WMXA 3V8BA 2Q49A 4NQZA 1EE2A 3QQPA 2O3UA 3QWAA 1FMCA 3RBXA 1P1JA 4D45A 2ZQYA 3F5SA 4JK3A 2ZTVA 1PJ2A 3DAGA 4EITA 4XB1A 1AE1A 1O94A 3LK7A 4A7PA 3LC2O 1PGPA 3HWRA 3SJUA 1R12A 4BUCA 1CF2O 1P31A 1W8DA 3D0OA 4HFMA 3K9QO 2C7GA 4IDEA 1PR9A 4L4SA 3RC2A 4RVHA 6LDHA 1WNTA 3RWBA 3GFBA 4K9DA 1MP0A 1E7MA 2EP5A 1BXKA 3C8MA 5TNXA 3WJAA 4CV0A 3K6JA 3TL3A 1UDAA 2PD4A 3L77A 5IF3A 3ETDA 3JYPA 3AJRA 3V2UA 1BW9A 3PWSA 1U5AA 3PHJA 1IY8A 1EQ2A 3F3SA 4YACA 4CV2A 4E21A 3NGXA 3LQFA 4GLOA 4GGOA 1ADBA 3JQGB 4E12A 1SMKA 4MKRA 4CM8A 5I8WA 5G0UA 3U4HA 4J7UA 1P74A 3KSDO 3ONDA 4LCEA 1PQUA 2A4KA 1XGKA 4AFNA 4DQVA 3ZHYA 4RCVA 4DPKA 4EUFA 1DC6A 4O59O 3DMTA 4NFSA 1TB4A 2AQHA 2IXAA 4CM4A 2YFHA 1JWAB 3UVEA 4AJ4A 4J1SA 3Q3CA 3BMCA 4WCFC 3CMMA 4I9HA 4R9SA 1C0LA 4BB5A 1YDEA 2X7HA 4BVAA 3L07A 4PZEA 4QTZA 3R3JA 1LDEA 1WWKA 1P1HA 2FR0A 2WDZA 3F5QA 3TSCA 2GDZA 2VOEA 4IGEA 1XU7A 1ZZEA 3PVZA 1V0JA 3GA0A 2AG8A 3D7LA 3GAFA 4F6LA 3WIDA 4TVOA 3BA1A 3IS3A 1BVUA 1NR1A 3NT2A 1MC5A 2OHXA 2IZ1A 1ZK4A 3E9QA 4FD3A 3UGKA 3DEYX 1T1RA 5T57A 3K5PA 4WUVA 2NLOA 1PWZA 1P44A 2VT3A 5ILOA 3ICCA 1KEWA 2OUIA 2Q2WA 3KYDA 1PJTA 1TT5A 4YT2A 4A03A 2BELA 3RIHA 3AM3A 3OEWA 3FSRA 4FFLA 1JW9B 1I32A 4NPCA 2DTXA 2VYNA 5DF1A 3VHRA 2J3JA 3RBVA 2AA3A 2P5UA 1NHGA 4F6CA 4I5DA 1DOHA 1ZUD1 3GQVA 3W8DA 4R9RA 2I5PO 4TRJA 4BL5A 1GUZA 2P4QA 4MKZA 1TA4A 1Q7CA 1GQQA 4YJHB 2E82A 1DSSG 4BO3A 5U9CA 1F8GA 5EMHA 1X7HA 2BRUA 1I8TA 4AJIA 4TROA 2ZATA 4G81A 2EWMA 3VKUA 3B6ZA 1UUFA 1RKXA 4LMPA 4R3WA 1ONPA 3U0BA 3ZCXA 1N9GB 5JC1A 3WJ7A 3T4XA 5A1TA 2FY8A 3NAQA 2PZLA 3ZNOA 4BNYA 4B4UA 4M55A 4RLHA 1B8UA 1DJQA 1K6XA 5BSEA 4YB8A 3ICPA 2B0JA 2IZZA 1ZCJA 1BTOA 4QO7A 2PFGA 4NJOA 3C1AA 3VH2A 3AW9A 1UJMA 1QORA 2Y67A 2FN7A 4MVJE 2J5RA 4W7IA 4IDFA 5KKAA 3KYBA 3DMTC 4B7UA 4CMAA 5C7IO 1EVZA 5KTKA 4J3FA 3WX0A 2Y1FA 4XGIA 3JQBA 5CEEA 1I24A 5KJEA 3VPHA 4AJKA 2J8ZA 2YUTA 2YHIB 3WTCA 4JIGA 3PLNA 2NTVA 1GCUA 3DFUA 5L45A 5COAA 1A72A 1XR3A 3DONA 4OJNA 4E13A 4BGVA 3NX4A 4PG5A 2QZ9A 2F1KA 4RF4A 3I52A 1F12A 3WDSA 2Q4BA 3UXYA 2X0IA 3GT0A 4FFMA 4BKPA 3GR6A 2EEZA 1NP3A 1QYVA 2C0CA 2O7QA 1PJ4A 1ZEMA 1BGVA 1XQ6A 1DFHA 3GHYA 3JQFA 5AQ1A 4LRSB 3PFFA 3QVWA 4J0FA 4OSOA 1E7SA 1LI4A 1RPNA 1I0ZA 4EJ0A 3WYBA 1KIFA 3AFMA 3H9UA 2D5CA 3NGLA 4WJZA 5KNLA 3FR7A 1MG5A 3TRIA 5CPFA 2VHXA 3Q9UA 3RUHA 2HMTA 3A28A 2WE7A 4GX2A 4I08A 4Q3AA 2O23A 5JFOA 3ZWOA 1U9JA 3DB2A 4YJGA 1ZK0A 2HRZA 3WGHA 1NPTO 1JA9A 1VPDA 2P9GA 3MJVA 3EY4A 4YBZA 5AOVA 3R1IA 4TZTA 3RBZA 4CMGA 2EW8A 5JC8A 3KXDA 5JO9A 2WD7A 4CLRA 1F06A 3ZI0A 4PLWA 3D64A 1PQPA 1X1TA 5A5FA 1DC5A 4I5EA 2NU6A 3ANLA 1JLLA 2OP1A 1PL6A 2Y0DA 5L40A 1KS9A 4UULA 4X54A 4JGBA 4ONEA 2NU9A 3ZWWA 4BNTA 2VRBA 4YVFA 1OC2A 4HWKA 5ICMA 5G4LA 2P9EA 1YWGO 1FF9A 3FF4A 1DEHA 4KUGA 2OGUA 3E82A 1ORRA 2C07A 3H9QA 4E5MA 2GLXA 2QYSA 5HS4A 5U1PA 1P3DA 4CV3A 3TZHA 2DBVO 3PWKA 1U3WA 4J6FA 4GLLA 4DYVA 4HXYA 1WXDA 1Y5RA 3PJFA 1ENOA 5KCZA 3GHHA 5EERA 1U8XX 4D3DA 1GQ2A 2B69A 3VVBA 1UZMA 1CWUA 1O89A 2DU8A 4II2A 1ZVMA 4RVUA 4JNKA 1Q7BA 3JD3A 1RM0A 3JQBC 1M76A 1Y1PA 1T2EA 4HFNA 1H6BA 4B8WA 2HK7A 3GH3A 3U49A 4NBVA 1HDGO 1PJLA 4ROSA 2JAPA 5JAQA 1YQGA 2PKRA 5ITVA 3GOHA 4TKLA 4XYLA 2R6JA 5FF9A 1DRVA 4GSLA 5TQVA 3QVXA 2VNSA 1ZK1A 4R5HA 1DC3A 4I8XA 2E4AA 2AQ8A 3IKVA 2NQTA 4FJ1A 2RHRA 3OEYA 3UFXA 3G17A 1C0PA 2HJRA 3N58A 1DIRA 4U5QA 4YT4A 3S2IA 1K5HA 2A9FA 3H4VA 1FDUA 2PKQP 2V7PA 3H5AA 2FWMX 4R5MA 3UHAA 5FEUA 3DTYA 3E1KA 3B1KA 4PCVA 5G0SA 3JQFC 4JQCA 4B4VA 4KTVE 3ZHZA 1H2BA 2HJSA 3A9WA 3HUDA 3OETA 3K73O 5G4KB 4E2YA 2ZYGA 5BR7A 1P0FA 4J91A 1Y8RB 1LLUA 3Q1LA 3RU7A 4J7XA 5H83A 3JD4A 3RASA 2GR9A 3CUKA 4EUEA 1TXGA 1Z45A 4DTIA 4CLOB 5A9SA 3JYLA 5ITWA 2C2YA 4GMGA 4Y98A 5HS6A 3PHLA 1K6JA 4JCOA 2Y68A 3H3FA 1I5RA 2Q1UA 1Y9EA 3WSVA 4IQ8A 1N7GA 2O4CA 2I6TA 4YRAA 5GZ3A 3PTZA 3RC9A 2IYPA 4IS2A 3D3WB 4ND3A 4XQ9A 3QVSA 4YDRA 2YDYA 2HUNA 2WWRA 1Z74A 3AM4A 1J0XO 5T64A 1U3TA 2AXQA 4HADA 3LLVA 1SB8A 2P68A 3NKLA 3TPCA 4YJDA 4BNVA 3FN4A 4E2WA 4CMHA 1Q1NA 1NAHA 1PGNA 2V6GA 4WOJA 3FBTA 5I8ZA 3W8EA 1ULUA 4L73A 4YAEA 4CUJA 3PEFA 4MIYA 4PG6A 2VYVD 1PX0A 1N8KA 4B3HA 2VTDA 3DBLB 1K2WA 4L0QA 1Z7BA 4XYMA 4CM5A 1UP7A 4NBUA 3WNVA 4BV9A 5GY7A 3E6AA 1ONNA 5A06A 5BNFA 4CQMD 4U0KA 2AEFA 4YQZA 3QJ5A 1HDCA 4FQ8A 1DIBA 4P4NA 1R66A 4IS3A 4J90A 3B70A 3OIGA 4XYGA 3W4IA 3ZWAA 3BHIA 3ORFA 3GVCA 4MP8A 2Z1NA 4CM7A 4A10A 3HG7A 3LZ6A 1JTVA 2V65A 3ANNA 4BNFA 2Y0CA 5KWEA 3OQ6A 4GAEA 1G6KA 1U7TA 5JNLA 3GEDA 2B36A 3C7CB 4M1QA 1GUFA 3DOOA 1MB4A 2IRWA 2J5KA 3NT4A 1K0UA 4J7CA 4NH4A 4Y8VA 5EESA 1BMDA 1P1IA 4DYDA 4CPDA 5DCUA 1KOLA 4UEJA 5DP2A 3RUDA 4A73A 3H9JA 1QMGA 4GX0A 3S2GA 4RF5A 3GPDG 1E1MA 3KOUA 3TOZA 2YQ4A 3ITDA 4XGKA 2RBEA 4OKIA 4L8VA 3GZNB 1O6ZA 3INRA 1Y9AA 3U62A 1QG6A 2B35A 4KOAA 3F1LA 2XPCA 4CJXA 1TLTA 2WYUA 3H9GA 5A4DA 4WLVA 1PEDA 3FNGA 5K6AA 1PJ3A 3M2TA 1A7KA 4IM7A 2D3TA 4I5FA 5AXAA 4YQYA 2FPIA 2X0RA 2JD0A 1NQOA 4AJ2A 5CEFA 3S2FA 5EN4A 4ZHSA 5L7YA 8LDHA 2QX7A 4WECA 4YAGA 2Y93A 4TZKA 1PGQA 3ETEA 5I9NA 5B1YA 1V8BA 4RQUA 1E3WB 3GLQA 5L7WA 1YBVA 1KEUA 3PQDA 3FR8A 1F17A 4BO6A 3QSGA 4I5GA 3Q9NA 4PFJA 4XJTA 1D4FA 1GZ4A 2O48X 4BIIA 1DB3A 3AOEA 4J1QA 4PLGA 2H1SA 4MIEA 4DLAA 5KIAA 4DQXA 3W6ZA 5HM8A 1GD1O 3HE3A 3KEOA 1R4NA 5L53A 3GGPA 4IDGA 5HA5A 2VOJA 3DWFA 3JQAA 3DHNA 4GQAA 4D3SA 2O50A 1CDOA 5EIOA 4DRYA 1W73A 1E7RA 5JAIA 3JQEA 2UUOA 5CG2A 5I7VA 3IOYA 3N7UA 1R6DA 1YOVB 5TJ9A 1JKFA 2Q99A 1RM3A 3GPIA 1E5QA 3WYCA 3HJAA 5IN4A 2EJVA 4AJ1A 2C20A 1RYDA 4NHEA 2AE2A 3AU8A 4KDEA 4ZRMA 4ZRNA 1ZMTA 1LSUA 2CMDA 2DPHA 1CQIA 2VYND 2WE8A 4N18A 5TT1A 1QRRA 3BTVA 5DNAA 2WTBA 4J2HA 4BMNA 1AN9A 4DGSA 3G3EA 3U9LA 3MJ4A 4E0BA 5C7OO 2NWQA 5DCYA 4ALJA 3EMKA 5I9LA 2O3JA 4FJ0A 2HK9A 2H5LA 2BF7A 1SPXA 4NDNE 1NVTA 1E3EA 3OFSA 3WIEA 1P1KA 4K6CA 3TL2A 2CDBA 2QW8A 1CERA 4WEOA 3IQDB 3AOGA 4P22A 1B15A 1EEHA 2H9IA 2CF6A 1HDRA 4YRDA 2X9GA 1FK8A 4CMIB 3I4CA 3GVXA 4HY3A 4BKQA 4E2ZA 4RLSA 1C14A 4RL6A 2EKPA 1V3VA 2W2KA 3WS7A 2QRJA 1SB9A 3ENKA 3ZNNA 4YJFA 4FOOA 2GN9A 1EVIA 4BOYA 4J4TA 3WNQA 4FGSA 3CEAA 4GGPA 1NX6A 1GTMA 3DZBA 5BNTA 1KC3A 2EIHA 3K30A 3MJCA 2CF5A 2GN6A 5A3VA 1LUAA 1MGOA 2BLLA 2IEBA 3I3OA 4GKVA 1LDNA 1A7AA 4J0EA 1N5DA 1NHWA 3DL2A 2AE1A 1WDKA 4MINA 4E5KA 5ENVA 3C24A 1M6HA 4E6PA 2DKNA 4OXNA 4PRLA 1HSZA 4IIVA 1BSVA 4LMRA 1WLYA 1NQTA 4KWIA 4FC7A 3ZWVA 3OJLA 3FBGA 3C7DB 3WFJA 5CG1A 2PV7A 3JD1A 1C1DB 4GBJA 3AI1A 3WGTA 4LVUA 4IBOA 2X5OA 3AOEC 1NWCA 3CXRA 1U8FO 1QYCA 1YONA 4R54A 4LW8A 3OQ1A 3DBRA 5I7FA 4RORA 3DAFA 4NI5A 4NG5A 4GX5A 1CQJA 5ENDA 3ULKA 3HN7A 2F00A 1VKNA 1HF3A 1LRLA 3BZUA 2O3RA 4O0LA 1YL7A 3KEQA 1AUPA 3WB9A 4J1TA 1IULA 2DTEA 1RM5A 1PTJA 1LSSA 4BNLA 4EBFA 1Z82A 3SLKA 3JQ9C 1HYEA 2H63A 4GWKA 4MP3A 3VVCA 4WNIA 1I33A 1IB6A 1P1RA 4UEOA 2JHGA 4RVGA 2ZYAA 3L9WA 3PYLA 3PWZA 4C7KA 5MGBA 5J23A 1NVGA 3RD5A 4B3JA 4D3FA 3FNFA 5A9TA 5FI3A 1DFGA 4CUKA 4D44A 4UUPA 4GH5A 4XYBA 4IQ0A 2G17A 4FFOA 4WCDA 2DFDA 1R0LA 4PG7A 1GDHA 1CEQA 1ZO8A 3MTJA 4WPGA 5EJ2A 4DL9A 5A02A 4A2CA 3LDHA 2B4RO 4II3A 1N92A 4IQGA 3FTNA 1QSGA 4Q3CA 3D5QA 1YKFA 4O5OA 5C37A 2DT5A 3M6IA 2AW5A 4NU6A 1GADO 1PIWA 1FDSA 1EUCA 4R51A 5G2OA 3CIFA 3GNQA 5BNIA 2P91A 1HEUA 1MG0A 3ZNQA 4CLHA 4DPLA 3F1KA 3QWHA 3CKYA 3X2EA 3BHJA 3FCOA 1RJWA 2DQ4A 4MVJF 4CMEA 2GSDA 1S7CA 2UVDA 2D2IA 1HDOA 1IYZA 5G0VA 3UH1A 4AJPA 1WP4A 3H2ZA 3JYOA 1SAYA 4XDZA 4R1UA 2DUWA 4BO0A 5IFLA 4M87A 1F14A 3CE6A 3PJDA 4OQYA 5B4VA 3O8QA 1UP4A 4WEQA 1X14A 4CLXA 5B12A 1JAXA 4R1NA 2C2XA 4WLNA 4ZN6A 2FPPA 3AUAA 4RVDA 4E5YA 5H81A 3RFXA 4URFA 3S55A 2V6MA 2J5QA 4HKTA 4JBIA 4W6ZA 3TWOA 5IZCA 3HDJA 2NVBA 2C5EA 1JKIA 1H2HA 4IIUA 5CDSA 5AVOA 5TT0A 3W8FA 1VL8A 4XX0A 2QIOA 1GEEA 4CQLA 3RC1A 3WGIA 2IDZA 2GYYA 4UVDA 3OM9A 5DULA 3ROMA 4N7RA 4BNMA 4L4RA 4ZQFA 4MVJM 3KTDA 1N1GA 4K1LA 3C85A 4HUJA 3K92A 3OP4A 2GRAA 3NT5A 1Y81A 1L1FA 3JQ7A 4NBTA 2O3SA 4XQCA 2FZEA 5IXSA 1Y7TA 3MOGA 1XEAA 5DBGA 4OGWA 3VPSA 1E3LA 3U3XA 3VPGA 3ASUA 4WLUA 5IG2A 3VH3A 4R4JA 4XWYA 2J3KA 5F1OA 1DLIA 4INAA 2Q2VA 2G76A 4UVHA 2BFOA 1YBAA 4ZU3A 3WGOA 1YB1A 4NJMB 2NVWA 4IDCA 5ICSA 1ISJA 5L7TA 4J1NA 3EGOA 3AUSA 4G65A 4Y9DA 3NTOA 3EW7A 4BNHA 3KYCB 4GSKA 4NBWA 2GGSA 4P4LA 2W4QA 1N7HA 3DMYA 1I10A 3RKUA 2X9NA 5TIIA 2IYOA 3GVIA 3TQHA 3MCVA 4BNZA 3QW2A 4CMBA 1NVMB 3ENNA 3LLSA 1R0KA 2DBRA 2RH8A 4H15A 1KY4A 3OICA 3VTFA 1IZ9A 3FPCA 2PD3A 3Q0EA 4FGWA 4OIMA 2RCYA 4PLHA 4ALNA 4BQRA 4FOSA 1VM6A 1LDYA 4ALIA 4IJKA 2YZ7A 4RO0A 1Y8QB 1YRLA 4MJLA 1OOEA 5DP1A 3WQRA 4CMEC 3EZLA 5JYDA 3RUEA 2HRBA 4WCFB 3I9OA 1K3TA 2AEMA 2R2GA 4JROA 3DBHB 5JPIA 1DIHA 2E48A 3C7AA 4M8SA 4LRTB 1XKQA 4Q9NA 4UEKA 4PLCA 3JQ8A 4NFYA 3BMOB 2IXBA 3HSKA 1DDOA 1OBFO 1SOWA 4XB2A 3IUPA 4BKUA 3GG9A 2ZTLA 2HDHA 3L4BA 4IINA 1C1XA 1QV6A 3VZPA 4B79A 4AJLA 2Y1CA 4DBZA 3ZGYA 1UAGA 2JL1A 3BMNB 4BO9A 1JVBA 4CQMB 1XA0A 5TJHA 2NU8A 5AXBA 1EFLA 3RU9A 2CD9A 2YV1A 2CDAA 1HDYA 1HL3A 3PHGA 2Z5LA 3LT2A 5IZCC 3GMSA 3SC4A 4KQWA 2PZMA 5G4KA 5CPBA 3FNHA 4GWGA 4W4TA 4RZIA 4I1IA 2OORA 3GEMA 3VH4A 4YA6A 3TOXA 4UVGA 1EFKA 1YS4A 2O3TA 3EK2A 5IDXA 2UDPA 2Z95A 4AICA 4RDHA 1GCOA 2B4TO 5A9RA 1I3LA 8ADHA 1U3VA 4CR6A 2O3QA 1PWXA 2HMVA 2PK3A 1ZSNA 1PL7A 4N5MA 1LA2A 2DM6A 3OJ0A 4RPLA 1PQWA 1J6UA 3JCZA 1QLHA 2B4QA 4PGFA 3RJ5A 3M1AA 3N74A 5JY1A 1H6CA 1P45A 1WDMA 3F6YA 3WTBA 4PZDA 5LDHA 4E30A 4QFDA 1X13A 1IOLA 4RPHA 2LDXA 4DMLA 5JCJA 4U8GA 1G0OA 1QYWA 3ANMA 3KZVA 3NDIA 1CRWG 2YHUA 4NU5A 4Z9FA 4ZA2A 5TGDA 5FI5A 2EW2A 1JQBA 3TZQA 1BW9B 1ENYA 1B3BA 3DZKA 4L75A 3TZCA 2TMGA 1XCBA 2WM3A 4CM8B 2RH4A 3L9XA 3MJTA 2CZCA 4OOFA 3CZMA 4PG8A 3JYNA 1OI7A 1WZIA 4QEDA 3Q6IA 4GX1A 1EK5A 3DQPA 4CM4B 4XQEA 4YRBA 3OJEA 2FPGA 3FPLA 5L4SA 3HQ4O 1DBVO 1I2ZA 2X0NA 1QYDA 2Y1EA 3BMCB 1KEPA 3MEQA 1ARZA 2PGJA 3L4SO 4L9RA 3D3EA 5CFZA 3JQAD 5DDIP 5CDYA 3JQ6A 3DXFA 4QECA 4XR9A 1PZFA 3GZ4A 2VNAA 1WPQA 1MC4A 3BTSA 2FRDA 4BO7A 4L4XA 5JBIA 1D3AA 4YEDA 3AY3A 3I23A 2O2YA 4JJGA 2JKVA 3IMFA 1B16A 4OSPA 5JE8A 3L4BC 2PKQO 4NNJA 3AUUA 4J2OA 2PD6A 1LU9A 2BFAA 4LSMA 2CY0A 1HE2A 3PGXA 3PZBA 2BD0A 1IE3A 2Z1MA 3EVTA 4E33A 4CMJA 4XIJA 1TT5B 2EERA 5DBFA 4XYEA 1PZGA 1YQDA 3MJEA 3PRJA 2JFHA 4OM8A 2J6IA 3R0IA 3KO8A 2NNLD 4LK3A 4WGGA 4XDYA 4ZVVA 2Q1SA 2P9CA 4OYRA 1DFIA 3NJ8A 4BGEA 2EXXA 1KVUA 3DHEA 1R0SA 1JVSA 3GGOA 2AQIA 3IJPA 3H65A 4XD2A 4TRMA 6ADHA 3B1JA 3IL2A 3SEFA 1N1EA 4ILKA 1HTBA 2VZ8A 4UVIA 2O4UX 3WQSB 1H6AA 1ID1A 2IZ0A 4CODB 2CVOA 2X0JA 4XGNA 1HYHA 5F1PA 4G5HA 4YT5A 4ID9A 3GUYA 3UW3A 3KBOA 1KY5A 1IUKA 1YB5A 2EJWA 1QR6A 1E3WA 2DFVA 3GF4A 3NYWA 2GPTA 1UZNA 4WLFA 4Z0PA 3R3SA 4FC6A 5K0ZA 1PJBA 1R37A 3A14A 2NQ8A 1MXHA 1XQ1A 1MUUA 3I4FA 3MJSA 1OMOA 1CIVA 1A71A 3OJFA 4U7WA 4IXTA 1VJ0A 3V2HA 1E7QA 4LVCA 4CM9A 1HRDA 3IP1A 1WVGA 4ALLA 2W8ZA 3KM0A 1MV8A 5KVSA 1ZEJA 5TC4A 1M75A 4PLFA 1Q0QA 1ADCA 3PK0A 1O95A 2EGGA 3RVDA 3DR3A 1GAEO 2VN8A 1AHIA 2W90A 1DHTA 4RDIA 5A04A 1E7WA 2PH3A 1B3RA 4R1TA 5CHEA 1EVYA 1F0YA 2Y1OA 3E5MA 3PYXA 4K6FA 3KLMX 1GQYA 3KSZO 2C7VA 3JYQA 4O1MA 3GN1A 4FFRA 2NVUA 2YW9A 1LDMA 4JN6B 5A5EA 1L7DA 4I9NA 1PJQA 4B7XA 1EVJA 3NRCA 3BXXA 3PFWO 2YJZA 3OIFA 3P2YA 3QV1A 1LRKA 4EW6A 5ADHA 3IC5A 4CL8A 5L4NA 1XHLA 3G1TA 1CETA 4IDAA 3W6UA 1W6UA 3DZIA 2BI8A 3U4DA 2VHYA 1Z7EA 4B8ZA 1Z6ZA 4B3IA 1J5PA 2VRCA 2Y1GA 4LISA 3D4OA 4PZCA 3S1LA 3Q2IA 2NACA 3EUWA 1TT7A 3H6KA 4FJ2A 2BFPA 3DZGA 5DBIA 2I3GA 4IDBA 4DMMA 5KJ6A 2CFCA 4U0JA 3WGYA 1E3JA 4F46A 4EGFA 2PA3A 1BG6A 1F8FA 3F4BA 1TI7A 2B5WA 3MOIA 1KC1A 4Y6SA 2UYYA 2QZZA 4HFJA 4S3MA 3WSWA 3ADOA 1BWSA 1KYQA 3FHLA 3WG9A 1VKOA 1R4MA 4KWHA 1V3TA 3HFSA 4YJGB 4NK5A 3F47A 4UREA 3QVTA 4AJHA 4DLBA 5B37A 5F21A 1ZW1A 1FJHA 2WD7B 1RYEA 1BXGA 4Y67A 1X15A 3O03A 2GN4A 2VT2A 1HYGA 4DVJA 5DN9A 4RVFA 3QHAA 2DBZA 5F3RA 1HSOA 2CDCA 4YXFA 1UXKA 5G0WA 5COBA 3GDOA 3RSHA 1HE4A 2WJPA 1ISHA 2WD8A 1S6YA 1G1AA 1A4IA 2I67A 1VC2A 4FN4A 5T6BA 3BMQA 1ISGA 5I7SA 2E49A 4R41A 1EDZA 4ZQGA 4O6VA 3WLEA 2Q2QA 3OHSX 1ISIA 1XSEA 1ZKMA 1K6IA 5HRUA 3PZRA 4EUHA 1DAOA 5CDUA 1DRUA 2UAGA 4Z0TA 3PDUA 1EDOA 4Q3DA 4RF2A 1YGYA 4ND5A 4EJMA 4ZJUA 4UAGA 2X5KO 3EAGA 3IJRA 2PH5A 4IMPA 4TVBA 4ALKA 1DXYA 3P19A 3A4VA 3UN1A 3ZWYA 2BGLA 1PS8A 2BFMA 2Q3EA 4EDFA 2YV2A 5L3ZA 4MKXA 3ZU3A 1V6AA 2IODA 2WYWA 4M54A 1YJ8A 2W98A 3DFZA 2G0TA 4QSMA 2GF2A 3OF2A 4YAKA 1NNUA 3OH8A 4KTTE 3LT1A 1K89A 5T5QA 4TQGA 4CMCA 4N54A 4EI2A 5DOVA 3WQQA 5A05A 4XRGA 3GVPA 1V3UA 4JP3A 2CSUA 4DXHA 4KZPA 3EC7A 1QLJA 5JY6A 2PWZA 5IDWA 3L6EA 1EUZA 2OBYA 1EBUA 2QHXA 4UUNA 5DZSA 3P2OA 1KEVA 3RFTA 5A9SB 4TRNA 2JD2A 5JYEA 1U4OA 4FPXA 4Y6PA 5FWNA 5TS3A 3NUGA 2Y99A 2PGLA 3GDGA 4FCCA 1TVEA 1I36A 1Y6JA 2DAPA 2X86A 3EHEA 4ND1A 5ER9A 1U2DA 4R16A 5TF4A 3SXPA 1ZH8A 1ZXBA 3NTRA 5IJZA 1ZMOA 2Q46A 3DOJA 4FR5A 4GL4A 4GPD1 5IAAA 3ADPA 1YL5A 2AHRA 2R00A 3WBFA 4E5NA 2I76A 3B1FA 3C1TA 4EEZA 2I66A 2D8AA 4GVXA 2VWGA 5FYDA 3E48A 3GNSA 4MVJP 3SVTA 4H7PA 3IP3A 4YAJA 1EBFA 1MLDA 1PSDA 1J4AA 1LC0A 3JQGA 3LC1O 1DIAA 2ZB3A 4BNGA 4FDAA 4RVSA 4ZQHA 3RC7A 2RIRA 3G1UA 3QVOA 4PG4A 3DBVO 5IZ4A 1T2FA 5AYVA 1JWBB 1M2WA 1T26A 4WLOA 1XIVA 2VCYA 2X22A 4RJTA 5K6AC 4XEHA 5GMOA 4NBRA 1IPEA 1ZJYA 3BAZA 3IDSA 4QX6A 1SEPA 1I3MA 2YV3A 5CDTA 4TWRA 4W82A 1Q7GA 3P7MA 2QG4A 5F5NA 3I6IA 2BKAA 2QQ5A 2C29D 1GYRA 3AY6A 3KHUA 3PJGA 1O8CA 5MDHA 3AFNA 2HSDA 4JBGA 4D42A 3C3XA 5IXYA 3PGJA 4WKGA 2Q1WA 3HB4X 1D1SA 1FDTA 2JHFA 1DJNA 3K96A 3TZKA 4YTEA 3O9ZA 1E92A 2FHSA 1YH3A 3CSDA 3E9NA 1PU2A 3TN7A 1WAMA 4H16A 3AK4A 3ASVA 3RUCA 1E3IA 4W9NA 1B26A 3FWZA 2B83A 2ZTUA 3B20A 4D46A 1I3KA 1XLTA 4OHUA 2VUUA 4DPMA 4WASA 3V1YA 4MO2A 5BSHA 1H5QA 4YYZA 3UCEA 3UUWA 4MOWA 3AI3A 5JCJD 4CL3A 4DLLA 2BMAA 2JAHA 1HLDA 4AVYA 4KDFA 5ER6A 3ROKA 1UH5A 2XXBA 4YJHA 4MIOA 5T8KA 1H0KA 2EGHA 1LRJA 4LGVA 2JD1A 5L9AA 2HCTA 3WICA 4B4WA 5AXDA 1GYQA 4WLEA 1ZFNA 3D4PA 3LYLA 4ESOA 2EV9A 3U5TA 1A27A 1N9GA 5L4LA 4RPKA 3TDKA 3DO5A 1QYXA 2X23A 3DZHA 1EMDA 3D1LA 1LX6A 2XOXA 4PRKA 2ZKLA 3ZDFA 3AM5A 5ILGA 1X7DA 1G0NA 2VYVA 2GASA 3OJOA 2VHVA 3L6OO 2I99A 1ISMA 5JDCA 1NBOA 1OFGA 1GPJA 3L6DA 3OMLA 3I9LA 4FB5A 1LSOA 5TRTA 1SC6A 1UAYA 1IL0A 1EUDA 1XELA 2DPGA 1HZZA 2I65A 3HHPA 3DAPA 2OOSA 3SC6A 1YB4A 1R4NB 2J3HA 3CINA 3GG2A 4MDHA 5JLAA 3JQAB 1C3VA 2JFFA 4LSWA 3Q11A 3K2BA 2PR2A 4NIMA 1LLCA 1UZLA 2ZB8A 4CV1A 2FR8A 3E03A 2YHIA 1QP8A 3FWNA 4E32A 1NQ5A 5A03A 1BVRA 3QP9A 5GZ1A 2WYVA 1JAYA 3UCXA 1A5ZA 4U6SA 1CYDA 2FSVA 1GR0A 2VZ0A 4QQRA 1GFSA 1VJ1A 3NDRA 4I9UA 3TF5A 1D7OA 4BNIA 1JDJA 3LF2A 1ZSYA 5KVVA 1YBMA 3E5RA 1U3UA 5BT9A 4E31A 3I9JA 2D5AA 2DUUA 3JTMA 4FFNA 3E8XA 3EZYA 1T2DA 2NU7A 1PJSA 1UDCA 1HETA 4W9NC 5LC1A 3P5SA 5DCWA 3GNTA 3PHIA 1SZJG 1P1FA 1P0CA 4NR0A 4R3NA 1E6WA 2CNBA 4ZQBA 4XA8A 5KOIA 1I3NA 2DTDA 5I9MA 1KBZA 1NR7A 3INGA 3RUIA 3DHYA 3DTTA 1H94A 1EZ4A 4FSHA 1R16A 4A0SA 3ZU5A 3ABIA 1V9LA 2W2LA 1ISFA 4MVJA 3DZFA 5JCXA 1GEGA 2HQ1A 4RQTA 1LJ8A 2W2KB 4KMSA 1LQTA 5T8KC 3PQFA 3OA2A 2X8LA 3PIIA 4D0RA 1HXHA 4YJFB 2JCXA 2V6FA 3RCBA 4AG3A 4R01A 3FD8A 1T4DA 3AU9A 4OO3A 3UKOA 4CM9D 5DOZA 1IHXA 4C7JA 3PQEA 1I01A 4JX8A 3QE3A 4DIOA 4PIVA 4YWJA 4DC0A 2B5VA 3WOHA 2FSSA 4S1VA 3LT0A 3T4EA 5TLSA 4NK4A 2ZJ1A 1LBEA 1J49A 1LLDA 3TJRA 1NYTA 1YXMA 4KUHA 3WLFA 1EK6A 2NTJA 3GEGA 2Y05A 3HNPA 4Z9YA 5JDCC 4TKMA 1DRWA 1YQXA 5TSDA 3HDHA 4DC1A 1E5LA 1MFZA 2Y0EA 3VPFA 5KVCA 2OXIA 3ZWPA 4BV8A 4R1SA 5FFFA 4JP2A 3F46A 2QRLA 2EG9A 3NJ4A 7MDHA 2YQ5A 3OQBA 3AWDA 3DBRB 1O0SA 3ZV6A 3JD2A 3ONFA 1UDBA 2X6TA 5JMWA 3VH1A 3TFOA 4N5NA 4BO2A 4BNJA 4PLVA 1OAAA 2X1HA 1AHHA 1E1NA 4OQZA 2VRCD 3VDQA 4M89A 4P8RA 2OZPA 1BRMA 1VE9A 1FDWA 4OH1A 4AJNA 4D7AA 2DBQA 4RGBA 1ZSVA 3RFVA 3AY7A 1PR3A 3OECA 2EHDA 3SLGA 1JKJA 1ZK2A 4D0SA 4IUYA 4EJ6A 2QYTA 1SOVA 1HZJA 1GU7A 5KKCA 5CDGA 3H9EO 4IJVA 3ONEA 4QT0A 4F3YA 3JSAA 2E37A 2P5YA 3PDJA 4BO1A 2CVQA 2YYYA 2Q45A 2Y66A 3I9NA 3VZRA 4HFRA 3VTZA 1H9BA 3HZZA 4Y6RA 4AJEA 1I30A 2X58A 1U1IA 1FXSA 3JV7A 5LCXA 3ZHXA 1B0AA 1ZBQA 3PP8A 4UUOA 4BNUA 3I9KA 1GZ3A 4FIZA 3ZU4A 1Y8RA 1KVQA 3PI7A 1BHSA 3FI9A 3WGZA 4CLEA 4CR8A 4OMUA 4OKNA 3INTA 3VAZA 2ZCVA 3LSYA 4J16A 4K28A 5JW6A 2I3AA 2BGMA 1GV1A 4CLOA 3BHMA 3EVNA 1UXHA 1Q0LA 1A9YA 5L95A 3CH6A 3JD0A 2YY7A 1B7GO 3D5TA 3DDNA 3H5NA 4KP7A 2UUPA 4MVJG 1UR5A 4HNHA 3WGQA 1UXGA 2BHLA 3E9MA 2ZB4A 4JBHA 2CUKA 5H82A 3KRTA 1C0IA 1SO8A 1UXIA 4YT8A 2XAAA 4ZICA 2FMUA 1P33A 4NFHA 1RM4A 3BTOA 3SBOA 1NAIA 3D3WA 4Z6KA 4BNXA 4BHTA 5TX7A 2SCUA 5JAMA 5IDQA 4XRRA 2EKQA 2ZYDA 9LDTA 2BGKA 4L74A 3DOCA 2ZCUA 1MXFA 2HK8A 3U4IA 3QWFA 3ON5A 2VTEA 2BH9A 4AJOA 3O8QB 3ZHBA 4DIFA 3VC7A 3UICA 2HKIA 4U6QA 1ZXLA 1DAPA 1JU9A 4PLPA 1T2AA 1I2CA 3WR5A 4BNNA 3TFQA 1NTOA 3DBLA 4YAIA 1A9ZA 4JXKA 4PLTA 2ZQZA 4E3ZA 3HDYA 3AI2A 2OP0A 2HU2A 1YL6A 4Z0HO 1R15A 2B37A 4CQLB 2NTNA 1KVTA 2VWHA 2OO5A 4MVJH 4A5OA 3GUCA 1NPDA 3G79A 1KVRA 5LDGA 2PTGA 2WEKA 1B2LA 2X5JO 3JQ7B 1GYPA 4NMHA 3ZWCA 3LU1A 1ZJZA 1T4BA 4BB6A 3VZQA 4WOKA 4QXMA 1UP6A 1PZEA 3E18A 1ZK3A 2EKLA 4RV9A 3AUTA 3UF0A 3H3JA 2VUTA 4LN1A 2C5AA 4B4OA 4NZ9A 5ES3A 4MVJI 3KYDB 2OFPA 3NTQA 1DC4A 4IDDA 3RROA 2DVMA 3ZV3A 1NPYA 3G0OA 2GUGA 3TNLA 9LDBA 2GN8A 4IPTA 1HKUA 2PZJA 3PYMA 4IXWA 4QUKA 3U4CA 3ETGA 4BKRA 3GZNA 1VLLA 3F9IA 3V1UA 2NM0A 4A26A 3WBBA 1ENPA 5C5IA 3V2GA 5BSFA 2P4HX 1NFQA 4BMVA 3JQDA 4BO8A 1XG5A 4J4HA 2VWQA 4N5LA 1GL3A 1BDBA 2VWPA 3ZU2A 4OXYA 1X7GA 1Z75A 1PZHA 3S8MA 2G82A 1IHYA 1E6EA 4AL4A 1E77A 3NV9A 4OXKA 4TRRA 3ZN2A 3IAHA 3X2FA 3KUXA 3NEPX 2AG5A 4EEXA 3QY9A 3LF1A 4OAQA 1E7YA 3WGGA 4EZBA 1Z73A 2WMDA 2D59A 4PVCA 3RUAA 2PZKA 3H5RA 5L51A 1PS0A 5JDIA 3JQ8B 4K26A 3ZV5A 3O26A 2HO5A 2Q50A 1XYGA 2AMFA 4J49A 3QWBA 1LDGA 4F45A 5B4TA 1X1EA 2G1UA 1C1XB 4W7HA 1B8PA 1BDMA 1PS9A 1SEVA 2ZTMA 2AEJA 4IGFA 5B4UA 4CM3A 1LDBA 3MWDB 4WE3A 1XDWA 2JJYA 5THKA 3I6QA 1VL0A 3GGGA 4B7CA 4XZ3A 5DT9A 1WMAA 3WWYA 5HTOA 3PIDA 3HFGA 3FNEA 1NM5A 2YDXA 1E1LA 1LSJA 1TEHA 1B14A 1W4ZA 1VJTA 1GPDG 4IMRA 3ZH2A 4QFCA 4ZD6A 4DIBA 4CM6A 3I1JA 1YOVA 3PPIA 1DHRA 4RF3A 4M49A 4TMFA 2D4AA 2CVZA 5COQA 5JSFA 3LVFO 4J9UE 3GDFA 4DA9A 4BGUA 3GMDA 5KVQA 4CUZA 4BMSA 1HDXA 3ROQA 4PN3A 3GRPA 3ZV4A 1T24A 3GAZA 1LXCA 1U28A 3UOGA 2HMWA 3FRJA 2PNFA 1ZIDA 2A92A 3WWZA 3JQCA 4BKOA 4YPOA 3OSUA 4YCAA 4D43A 4P38A 4HV4A 3PJEA 2QRKA 1ML3A 2FR1A 4BS9A 2X4GA 4RPJA 2GZ1A 3KLPX 1LEHA 2C59A 4W99A 5KJ1A 4FBGA 5G0TA 3VKVA 1ENZA 4CMIA 4DWVA 4IJWA 4E5PA 3I9MA 4YR9A 7ADHA 2VHWA 1X0XA 3WFIA 4JJFA 4PLZA 5HBRA 4AJJA 5K9ZA 5EQFA 3UCFA 2GERA 3IUSA 2OMEA 3HADA 5BSGA 4RZHA 4CLRB 2C82A 2FP4A 1SCUA 3WMWA 5T67A 2FOIA 1DIGA 2AQKA 5JDIC 1WDLA 1E3SA 1VI2A 4Q3BA 3T7CA 3HB5X 3QA9A 1VRWA 3GRKA 3GN2A 3QWIA 1EQUA 4EYEA 3GVHA 4HBGA 1FDVA 3STHA 1C1DA 4GKBA 3PLRA 4G2NA 2NSDA 4ZQEA 3VOSA 4HX5A 1XU9A 1GUYA 5U4QA 1MA0A 4R68A 4J9VA 2D1YA 3PXXA 3ZWBA 3H8VA 1YVEI 4IZHA 1QXSA 3LT4A 1PJCA 4WNCA 1KETA 1NFRA 2NADA 4ND4A 4FFPA 2OL4A 3GFGA 4H3VA 1N2SA 4MP6A 4GMFA 5F5LA 4MPDA 4ND2A 4Z9XA 2JCVA 4C4OA 4R69A 4CR7A 5C3MA 3EDMA 4Q3EA 4DUPA 1JN0A 3K31A 5JXWA 1X0VA 3GK3A 4OOEA 5F1KA 2X9VA 3RKRA 4TSKA 1PGOA 4IJUA 1M6WA 2I9PA 4Z3DA 1OC4A 1LQUA 2W2LD 4MVJD 1Q2XA 2RHCA 4QO8A 3KETA 1GV0A 1O9BA 2DLDA 1YO6A 3NDJA 3RI3A 1MFPA 1GZ6A 1LC3A 2VZ9A 3QRWA 3CZRA 1H93A 1D8AA 2HMUA 1A4UA 2DC1A 1IPFA 4BGIA 1MX3A 4HNGA 3ZWMA 1C0KA 1H6DA 3ROPA 1M67A 1SNYA 1ZNQO 3L0DA 5C7LO 3K2EA 1YJQA 4ITUA 1E6UA 4WK6A 2NV6A 3QIVA 1AXEA 2OBNA 2Q4EA 2YFQA 1P77A 3EYWA 4XIYA 1LNQA 1OZAA 5KJCA 2J3IA 3W1VA 5AXCA 3BYZA 4IY1A 3C1OA 3SJ7A 4RPGA 1Q0HA 1U7HA 1KVSA 2C54A 1E1KA 4XKJA 3RQSA 3COSA 5KJFA 4JLWA 2VHZA 2HLPA 5BQFA 2O2SA 4FW8A 1HDZA 3H7AA 5EINA 3V5NA 2EF1A 3O38A 3PHHA 1P9LA 2GCGA 1HLPA 3OIDA 4CLDA 4A27A 3F4LA 1D1TA 3JQ9A 5JO0A 5EPOA 3DZJA 2NVUB 3ZW9A 1CJCA 3S2EA 1WZEA 3ST7A 2H6EA 3M1LA 3I5MA 1YE3A 3MTGA 3V1TC 2A94A 4PVDA 3ZZNA 1WMBA 1M66A 2GO1A 3KV3O 3QLJA 5JAZA 2IE0A 2LDBA 2O7SA 4BNWA 5EQDA 3OA0A 1SBYA 1YDWA 2FZWA 3U09A 4CMKA 3T7EA 4DQUA 1NQAO 2PGDA 4BNKA 3VZSA 3ZWXA 5A3JA 5JMPA 3RJ9A
chains in the Genus database with same CATH superfamily
5I7OA 1MU0A 2Q0HA 4R98A 2P6OA 2GD1O 3KQYA 4V0RA 1Y5IA 5L3SA 3VR5A 2QVZX 3B2QA 4KQCA 1GKUB 1I2BA 4KUEA 1AK1A 1PBTA 3OD1A 1KFKB 1H2WA 2QY6A 2AX4A 3R6DA 4K9NA 4YMIA 3GJ5A 1W0CA 4TTSA 4LOHA 4C0AC 4BO4A 2JZNA 1WKBA 2QUBA 1ADYA 4CKWA 2EX4A 5F78A 1OXXK 3EGDB 3EIHA 5CP8A 1AGNA 2XCUA 1VL6A 3VX4A 1QV7A 4OA8A 4N7MA 1P7WA 1XTVA 1Z38A 2JARA 3EIEA 4TMZA 1F8XA 2ILVA 4G09A 4ABTA 3ZTTA 4LCJA 4LECA 2JFVA 2AT1A 4J43A 4M86A 1N2XA 2QRNA 4Q39A 2VSQA 4IOMA 4Z8XA 2VIIA 4NJMA 4CKBB 2FLKA 1RWVA 3E35A 2CYBA 2WILA 3NIGB 1TGYA 3LPLA 4XLTA 2JGNA 3M4ZA 4G56A 5THQA 3REOA 4O63O 3UEOA 4QKQA 2RD2A 1HE5A 3F67A 2CVPA 1C7FA 3FGOA 1N36B 1EFUA 3BHNA 3OZBA 2EL9A 3OURA 3F8TA 1E8MA 2RAFA 1HWYA 1ZHHA 3OSZA 1FJ2A 4R7GA 4F5EA 4B6PA 1DC8A 1J90A 1PVVA 1NUPA 1OD6A 2ZJ0A 1VSVA 3K1AB 3MYRA 4P36A 2JC3A 4TT3D 4XQGA 3SKYA 5A3RA 1CUWA 5IC5A 3H18A 1X8JA 2XT6A 3M6FA 4PYKA 5CK5A 5JHHB 3ZDYB 2BKVA 4G8DA 1Z5NA 2J5XA 4HQ0A 4MR7A 5AW6A 4W1RA 1SY7A 2VBCA 1Q77A 3BTUA 3PNOA 4EB0A 4XVQA 5D84A 4NCAA 4JB0A 3SR3A 4EUSA 1Z2EA 2PMEA 1YCDA 2ABWA 2XRMA 3FOCA 1IZ0A 3N39C 4WCFA 4AURA 3D7NA 1MA3A 2R00C 2CLOB 5DIZA 3EEQA 3ADDA 2UYOA 3DBHA 3QU5A 5IN5A 2HMSA 3CTMA 3TZ6A 3RAJA 3H3XA 2B7CA 4WFQA 3H2SA 1NWHA 1VHLA 3PQ5A 1QHHB 3DC2A 1Z7GA 2YMLA 5DTQA 2FB9A 4O4JB 2BHNA 2XKBA 2VSXA 1KI4A 4MGEA 3TM4A 4KK3A 1H8EA 2RGGA 3V8QA 4DUGA 2FUG6 1XF1A 1BXZA 4B73A 2M32A 4JB8A 1BOOA 3IIEA 3R7FA 4JSYA 5ISMA 1NXQA 1USGA 3DCNA 1XWFA 1ZM4A 4RK4A 2WF8A 2W4IA 1JJFA 2X0EA 1T1EA 4RNDB 4ZGWA 4QRHA 4B6RA 1N4DA 1U3FA 2H31A 3NANA 2GD6A 4COKA 2WG1A 1RXVA 1VSUA 1W2GA 1ULAA 2ZPAA 2A35A 1JJVA 3FTPA 3OE4A 4JX9A 2RCNA 4K03A 4L6AA 1GZVA 3LUPA 3V8BA 3WMXA 4KR2A 5IT9A 2C9CA 3OD5A 3USZA 3D43A 1F6BA 3QQPA 2JFPA 3R7NA 1JIJA 2C0PA 2W8BA 1Y6RA 2PL5A 1B0UA 1FDIA 1W96A 2I1WA 1P1JA 2QN6A 2YXBA 3QU9A 4JYMA 4RKQA 4DCTA 5AW7A 4KWEA 5E6UA 4QJ3A 2IYLD 3LA8A 3NW9A 3VJMA 3K70C 2MU1A 1JVNA 3DAGA 1AKTA 1K9SA 1LK7A 4BUCA 1PGPA 3HWRA 4NONA 1Z2OX 5AK3A 1W8DA 1N57A 3GO4A 3M6XA 3K9QO 2C7GA 4IDEA 3RC2A 3EH1A 4Q34A 4RVHA 4AULA 6LDHA 4TL9A 2VXCA 1LK0A 4N82A 3O4VA 2EOAA 2POCA 3DLCA 4L07A 3OO1A 3RJMA 3IJ5A 2C5LA 1L5HA 4P83A 3FAZA 2O54A 4OM7A 4CV0A 1EBBA 2OD9A 2VQDA 3HBFA 1HE8B 2OWEA 3FI0A 1Z62A 3UOWA 3D2CA 2WSYB 2PD4A 2FF5A 4NRDA 2D5LA 3PIRA 1L4NA 5IKPA 3T5TA 4X1IA 5FUXA 4MQEA 4JB2A 5GJVC 1U5AA 2P9TA 1EQ2A 3MA0A 2CHFA 1OZFA 1OPRA 1FXWA 3NGXA 1M6NA 3K8QA 3R44A 4GGOA 4GLOA 3H11A 3KV1A 4DS3A 4Q1VA 4MKRA 5EC8A 1EVKA 3EVGA 3H1EA 5G0UA 1KOGA 5CFLA 3EODA 1E2HA 1XGKA 1F5NA 4FZRA 3VAYA 4AFNA 4JDUA 2IIPA 4DPKA 5K0TA 4EUFA 2NO6A 3EAQA 1MQAA 2GPSA 2BR4A 2N3ZA 3QE9Y 1TB4A 2PS3A 2AQHA 4IEIA 1L8AA 2IXAA 3DMNA 3K4PA 1J5EB 2VHUA 3PJRA 1BD3A 1JWAB 5KYKA 1G3MA 2CLEB 3LECA 1E9BA 3V3TA 2DQSA 1T8SA 3BMCA 2ZWIA 4WCFC 4R9SA 3V7FA 1KMNA 5FEMA 3W5SA 1W35A 2IQ5A 3NBAA 5FPPA 4DV6B 4QTZA 1P1HA 5AW2A 1AG9A 5G02A 4KHPB 4JI2B 1P2FA 2Y9PB 5H3LA 2ATXA 4PFKA 1L8XA 2FMFA 1ZA1A 1YGPA 2FQXA 4GYKA 3U3MA 2VJMB 3N0TA 1PG0A 4DM7A 3IS3A 3RC3A 3M4JA 2P0YA 4DAEA 4Z4CA 4Y7CA 2PJRA 1V8DA 4OXIA 3NT2A 2IZ1A 1ZK4A 4FD3A 3LVBA 3DEYX 5LU9A 1P3Y1 1OT3A 1PWEA 3K5PA 3OZXA 4RC9A 3M4YA 4WUVA 1DJPA 4Z4IA 3GQBB 3EEFA 2FZ5A 2CVFA 2NOAA 1TZKA 2X9LA 1YS6A 2CNWA 2VT3A 3BFXA 4E46A 1KEWA 5ILOA 1NULA 1NSTA 3UT6A 3MILA 2NT4A 4MKHA 3OX1A 4YT2A 3I8OA 3OEWA 3DP9A 3E4DA 4FFLA 3N2YA 1I32A 4QATA 4QPNA 4O2AA 2W37A 2WF7A 1WZNA 1P4AA 4I50A 3KB8A 2D2XA 3BDIA 1ZUD1 4AS1A 3IQEA 3W8DA 4MJ7A 1KZ1A 3FSGD 4R9RA 5DHPA 2RK4A 3GFSA 4OHOA 4BL5A 1GUZA 1NLMA 1Y34E 1UK6A 2Z5GA 4Y7DA 1E5DA 4MKZA 2R7MA 4L0MA 1GQQA 1KJ9A 5GIPE 2O8DB 1SBHA 1MH1A 2ORYA 5IHPA 2NZ8A 2L17A 1Y63A 3R5SA 1F1BA 1VG0B 4YMWA 4ZAXA 2AKYA 5K0SA 3WRWA 3B78A 3W2GA 4TROA 4KQEA 1CUIA 2EWMA 3A2NA 3OZIA 3R8CA 2ONYA 3U7QB 2AI1A 5KEIA 4U9UA 1N9GB 3ESQA 2GETA 1UPTA 5JYBA 4HGZA 2HL6A 4EMSA 2QAGA 3UQYS 5CYOA 4FOLA 3NHUA 4RA9B 4AZ0B 5IH3A 4KMMA 4PTLA 4DV7B 3UK2A 2AXEA 4M55A 3HI6A 1B8UA 1WSBA 1GRCA 2QMQA 1K6XA 1NY5A 2YUIA 1X80B 2QUJA 2PYDA 4XFKA 3UK0A 1BS2A 3ICPA 4MUGA 2OEPA 3PFBA 1Y98A 2J9XB 4WVLA 1C9MA 5AICA 1ZCJA 3LDAA 5AVTA 1PJZA 1XVVA 2PFGA 2O8EA 4I4IA 3D81A 2BT4A 3TGLA 5I7UA 3HBMA 1OFTA 4YCCA 2J0VA 1J2UA 3GT7A 2YY5A 4BC0A 4W7IA 5EE3A 1J8MF 2AR9A 2IZ6A 5F33A 5C8XA 4Z4FA 5E8JA 3EZ7A 5C7IO 2Z43A 1IBCA 4MTCA 2ID7A 2NT3A 4B2LA 3ZUGA 2Y1FA 1S02A 4PGMA 3HCAA 1V45E 1JR4A 3DB1A 3ODGA 2ZM5A 1D03A 2D5BA 2F9FA 3VPHA 2AL7A 2WR8A 2YUTA 3R09A 2A9OA 4UHKA 3WHKA 1FFCA 3DBIA 3KSBC 3MM4A 3PFIA 1KR2A 5DJ5A 1XA3A 1GCUA 3DFUA 5IYZA 5L45A 2AYXA 1O6CA 1O5OA 2FGKA 4M36A 3T5DA 3HXMA 2C1XA 3NX4A 1L7BA 4KIUA 3AI7A 2IUTA 2P8SA 4HGQA 4JLDA 4IVRA 4MDYA 3RSQA 4ZI7A 3E2MA 5H8WA 4D4LA 2PGAA 1TQ4A 2V5VA 3WA7A 2R8YA 1PSWA 4EA6A 2G36A 1T6XA 3I52A 5LB2A 5IT0A 1KSHA 1BKYA 3P1JA 4O8CA 3WDSA 4ETMA 4ZKDA 4X6XA 4G97A 4M8KA 2X5XA 5JXGA 2Z1DA 5EJ4A 1WMFA 4FFMA 1U0TA 4WY2A 3ZDBA 1NP3A 1QYVA 2EEZA 2EVWX 2C0CA 3ZS9A 5IABA 2AR0A 2WFLA 1BGVA 1UJ5A 1YRYE 4I6GA 3WLMA 5AQ1A 2PUCA 3PFFA 4N4AA 3QVWA 3HM9A 4MITA 2DJ5A 1E2IA 3H5IA 3U9SA 3V46A 4AP6A 3AFMA 4QOEA 3NGLA 3WZMA 2J0EA 2UZ3A 1EIZA 1LW6E 3DXXA 3FR7A 5F64A 3ZIAA 4A8JA 2BGTA 5DW3A 4JLJA 2JF0A 5CM8B 2VHXA 3Q9UA 3RUHA 1QCYA 3Q3IA 4LS3A 4I08A 4B80A 5JFOA 9MHTA 2YWXA 3ZWOA 2JZOA 5DNCA 2YZNA 1E9CA 1JA9A 1NPTO 2P9GA 3MJVA 3AR9A 1KK2A 2C5BA 3SGLA 1NN1A 2FGJA 4CMGA 3PF9A 3AHIA 5E1MA 2IWHA 1KPHA 3U40A 5JC8A 3M4NA 1EWVA 3KXDA 2VH1A 2ZQ5A 3IOMA 5HUJA 1XN4A 3D64A 1PQPA 1IBKB 5CVVA 5FH9A 2ZM6B 5K01A 2IP4A 2UZAA 2NU6A 2PHZA 2QAGC 3ANLA 4A4DA 1PL6A 2RKOA 1WW3A 2Y0DA 1PLLA 3ORHA 1VKZA 3GAMA 1DDGA 2G9RA 2I2WA 2ALJA 2V6IA 2NU9A 2PH1A 4X54A 3NYQA 1OC2A 1ODLA 2DUJA 4HWKA 5J4HA 2I1LA 3LRTA 1HH4A 4UJ3A 3WP1B 3GLGB 5EPUA 5F23A 3OKAA 4N40A 3B82A 3OY7A 1CJKC 4BVHA 2CGEA 3NATA 2C8JA 4KUGA 1RQRA 1U2SA 3IKMB 1L9XA 3KOXA 4FR0A 2GLXA 1TM2A 3QOXA 2NYUA 1X1CA 2Q5EA 5U1PA 5BUZA 3TKLA 1SVKA 3T1VA 2RMKA 3PWKA 1U3WA 2COUA 3AW8A 4GLLA 5KNCA 2QTRA 3HYTA 4ZIRB 2X14A 4HXYA 1WXDA 1Y5RA 1ISRA 1QJ4A 4DYVA 3TSWA 3ZPXA 2PXCA 4BMDA 2B69A 3HRHA 5JRDS 1CWUA 1IJFA 4RVUA 1N6PA 1ZVMA 1SBNE 4JNKA 5TXGA 1FUIA 2Y4NA 1Q7BA 1P60A 2GVNA 1RM0A 3JD3A 4D9CA 3U3OA 2GS9A 4IIEA 4HMQA 5A7GA 1H6BA 3RIYA 4EHIA 4FDLA 1S01A 2HK7A 1DTWB 2R68A 3AJ9A 4B8WA 4NBVA 4EVQA 2Q41A 2HA0A 3BVPA 3G85A 1HDGO 2AF3C 2IC5A 1PJLA 1T3TA 2FFHA 2O2IA 2PQ0A 3ONWA 4HDMB 4PBRA 2JAPA 4F97A 1G8GA 4JT9A 2PKRA 4JVOA 1T9KA 1C0EA 3GOHA 4PGHA 2AC4A 3ILXA 4C2TA 1HA3A 4ZTUB 2CL5A 1DRVA 3FFWA 5LP6B 2B82A 1C1HA 1AKEA 1T5HX 1XDBA 1ZK1A 5I48A 1IY0A 1LTKA 1JFFB 3DQQA 4RDXA 1UL1X 3IKVA 3GPBA 3DTVB 3SS8A 4ER6A 3ZW7A 2WG0A 2VAVA 1SVSA 3HU2A 4V39A 4UNRA 4JP5A 2HJRA 3S2IA 1K5HA 4RIIA 3H4VA 2O2EA 4UFPA 1IUNA 4C9BA 1GZDA 1PDOA 1QANA 3O9VA 1E1CB 2BTOA 3VYSB 4Z86A 1G19A 1SQ5A 5ECGC 3ZQUA 4JQCA 4B4VA 2WWYA 1H2BA 2NSYA 3TVDA 3RHTA 5LUAA 1CUVA 5DHAA 2JCBA 1F2TA 3OIUA 2D06A 3HGTA 3TD6A 2A9KA 3PB3A 3FOEC 2D2VA 3KWJA 2W2QA 4GPTA 4ZARA 4GXTA 2VAXA 2ZBGA 5FOVA 4J91A 3TW6A 2I4NA 4LFBB 3NOVA 1UINA 2O7VA 3JD4A 4WXEA 3RASA 3ZD8A 2BM1A 2DKOA 3D3KA 1WETA 1IJEA 4B0OA 2ISSD 1T4MA 5KQGA 5EZYB 1Z4JA 3ZE6A 3H8JA 2C2YA 2CBXA 4FYHA 1EKXA 2C8KA 4R0MA 3UWPA 5J2UA 2IUSA 1F6WA 4KGZA 1QQ6A 4LKRA 2H8GA 4NE9A 4R9UC 2QTBA 1A9SA 3T0FA 4BASA 3AR8A 4BMXA 1YZHA 3QW4B 4RX1A 2ZJ2A 4XWOA 3MD0A 2OCBA 3CRQA 3D3JA 4KVFA 5IJ0B 2O4CA 4KSBA 4X8LA 5GZ3A 3FPJA 5K2MA 1USIA 2IYPA 5TQ0A 3WLOA 4YMUA 3IXLA 3AVOA 2PBRA 4QPZA 4XQ9A 3USES 1WE2A 3QKWA 1CY7A 2O2XA 2ZUDA 2M6RA 2WWRA 1OWPA 2OZLA 5HDBB 2R84A 4GRAA 4MPRA 3OG9A 3PD1A 4LDQA 4PCAA 5EMJA 5J1TB 2EDAA 3AM4A 1TF2A 1J0XO 6REQB 5T64A 3DV9A 2AXQA 4JUIA 4D4JA 1SB8A 4YFVA 2P68A 4QLBA 2ZI7A 4DLSA 3SE7A 1W5EA 3TPCA 3P9IA 2Z2IA 4YJDA 1IRXA 1S4QA 4X0EA 1O03A 5EIAA 5TR9A 4A82A 5CX1A 4BNVA 3ENWA 4CMHA 2KPOA 1MVLA 3W8EA 1OI3A 3ELUA 2HI0A 4Q03A 1ULUA 3GP8A 4YNBA 1K8RA 4HWPA 4PG6A 3U3KA 5CCEA 5DM2A 4G63A 4RMJA 2E1PA 4PYLA 3LQ4A 4PBSA 2BMFA 3M34A 3Q5DA 4BLVA 2EBHX 3C48A 5GY7A 4X84A 5BNFA 1BROA 1WHTB 1DZ3A 3P9SA 1SQ6A 1E0KA 3L2OB 1HDCA 3NPAA 1DIBA 3QJ5A 1GZSA 4HXEB 2NYRA 2QTVA 5SZIA 2X2FA 3OIGA 3OQVA 3KAQA 1A96A 1L6IA 2Y3IA 1X38A 2PL1A 2Z1NA 1MO3A 1TCAA 3GW8A 2V65A 3LW8A 4TMVA 1KDTA 3ER6A 4D9KA 3OQ6A 4GAEA 4DSTA 4Z1MD 5EHXA 3AL3A 5JNLA 1RYZA 4CE6A 1S3SA 1GUFA 4ZCIA 1G21A 2JIMA 4QGBA 2Z6AA 1ZH4A 3NT4A 4J7CA 2QL5A 4QDZA 4RHXA 4Y8VA 1P1IA 3KBBA 3TLGA 3OOSA 5E6SB 4WZBB 5EIWA 4CTOA 4AUEA 1ZR2A 3C7TA 4UEJA 1XYVA 4JLVA 3RANA 4AN0A 5JXJA 2JLXA 1O94D 3H9JA 3C41J 2KM1A 2YOGA 4D56A 4FI3C 4UHDA 2Q0XA 1LK5A 1RZVA 2ZSDA 4RF5A 3EXHB 1E1MA 5I5EA 1ONSA 2EYQA 4DY6A 2OCXA 2RBEA 3KFVA 2WSSD 4OKIA 2SHKA 5DEOA 5LYJA 1WMEA 5KNDH 3INRA 4M88A 1K8YB 3NQ41 2W0MA 1MVNA 4KOAA 2HHHB 5IEJA 1TKRA 4CJXA 1TLTA 1WVMA 2O8VA 5EG5A 1FB5A 4HLCA 1GNTA 3L8EA 3QFSA 3T3GA 1QFXA 2P9YA 3SI7A 4A6EA 1EB8A 3ZWKA 2D3TA 1Y8ZA 2AW3A 2CXXA 1GILA 4UDXX 4ME6A 1RPZA 2VQSA 2JD0A 3HYRA 1K3UB 1EHYA 4BY9E 1NURA 1POXA 1UKBA 1USWA 1WF6A 2GK3A 4KQMA 5L7YA 5EJ8A 5KTTA 2R6FA 2Y93A 4TZKA 1PGQA 4JASB 4X63A 5JR3A 1JSRA 4DR5B 1L1RA 3T52A 1MIHA 2OFOA 3GFTA 4RQUA 4EARA 1Q1BA 3X1DA 5L7WA 1ZCBA 1YBVA 4GR5A 4BYMA 3QENA 4MJ3A 2P2LA 4LF7B 2GJSA 1OFUA 3A26A 2NV2B 4X90A 3FR8A 5HOQA 4BO6A 1VBNA 4WZAA 4C4TA 3QSGA 4OQNA 4I5GA 5J2TA 2FV8A 3DVQX 4XJVA 5AI6A 5JCOC 4XJTA 3L8MA 4PY2A 4QASA 4BIIA 2QE7A 2Z2YA 1DB3A 3NHPA 1P2DA 3SYMA 2H1SA 3PC8A 3HKBA 1TZJA 2APJA 4KDCA 1EI9A 4O4HF 1K7EB 2WJVA 4TTJA 3HE3A 4DQXA 1EGHA 2FNAA 3FZEA 4Y6OA 2HA6A 2JAXA 5L53A 4DDMA 1QVZA 2B99A 1JHMA 4GQAA 3I04A 4DMFA 3UWSA 1CDOA 1L5RA 3ZTWA 1W73A 1E7RA 3DLPX 5FLKA 3G9XA 1TLFA 3CVOA 3EVBA 2UUOA 3H5VA 1XF9A 3HEBA 1TYAE 3IOYA 3KHSA 3LP6A 1PV1A 2B1QA 2IYVA 1RM3A 2Q99A 5DHSA 3DWEX 5FV4A 1K63A 4OAOA 4BLWA 3CVJA 4DLZA 1SN7A 3HJAA 4CTNA 4EIWA 1XEXB 4ZRNA 1ZMTA 1LSUA 1NW6A 2DPHA 1CQIA 2J3MA 3FYSA 3LOQA 4U63A 2VJYA 2YS6A 4ILEA 2X77A 2O52A 1QRRA 4FCWA 1Y6ZA 4MEAA 1P7VA 2XQGA 2R87A 1CLUA 1SQSA 2WTBA 3NTVA 4N47A 3JATA 3QI2A 4CTKA 3DR5A 4CDGA 2YYZA 1AN9A 3KQTA 4DGSA 3U9LA 4PZUA 3T5AA 1N7JA 2Q29A 2H18A 5KHAA 3VV2A 4JT2A 4OB7A 3EXAA 3DGEC 3G02A 1N25A 1L5QA 1G63A 4ZOBA 5C9ZA 3OFSA 3EQ6A 2QJRA 3G82C 3TL2A 3G5LA 4X1YA 5GGXA 5IVKA 2QW8A 1CERA 1SIBE 2KQUA 3UNXA 1F51E 3K94A 2CF6A 3OEEA 2DX7A 1QAMA 2ZYIA 1LF5A 1YQ9A 3GLUA 4QBGB 2O2JA 4RHYA 1FK8A 2YWEA 4E2ZA 1E3TA 4YH1A 3UXHA 1EXMA 1N3LA 3UKDA 5A4AA 3WS7A 3EASA 1JFTA 1KXZA 4MQFA 4C7OA 1SB9A 3ENKA 3AYZB 3ZNNA 3DBOB 1QVAA 2PSFA 2VPZA 1TJYA 1V5FA 4IH9A 1WF3A 4GGPA 3UTDA 4QTYA 1GTMA 3DZBA 2W6JA 1L5ZA 3REQB 1G8AA 1FMTA 1TU0A 2EIHA 3A6EA 3V4VB 4HK4A 2GN6A 1AF7A 2WPNA 4F2DA 4EJFA 1QNFA 5ICEA 3NVKI 1Z13A 1KGDA 1E5VA 1J8DA 4J0EA 1NHWA 1SCUB 3RABA 5JZ9A 1E4OA 3MC1A 5DSTA 4JGGA 1T35A 3A2MA 4MINA 1G3IA 4X60A 4E5KA 1A69A 3DGFC 2VF5X 2WUEA 1CUEA 1MGPA 2DKNA 1G42A 1B41A 2F59A 1KP3A 2FPRA 3DMPA 4GI3A 4FMPA 4NY1A 4TTQA 4UM8B 4PBTA 5FYQA 4ZVTA 3RK0A 5HF6A 4BJ3A 4R83A 4YRPA 3KOOA 3HUEA 1D2RA 4LMRA 4V2UA 3FCCA 2P6UA 5BQOA 2E85A 3C7DB 1MRNA 4PO3X 4HVCA 3HCOA 1J00A 1WABA 2PV7A 4AN1A 4DAOA 3HVJA 3WGTA 5HF9A 2X5OA 3O73A 1NWCA 2IHKA 4LPSA 4LYAA 3PC8C 1J9ZA 1XTSA 3IQZA 1KO5A 3DD1A 4ML3A 4US0R 3B3GA 5DVZA 5E0KB 4LW8A 1ZINA 2C5SA 3DBRA 3QHQA 4ZCLA 1BX3A 1BCRB 4XWKA 1GO2A 2IYWA 3F6RA 5LBTA 4B87A 3LW7A 4EY4A 1I0LA 3I6BA 3IHKA 4ARIA 1LRLA 2FYTA 1IQUA 3A4LA 2HBQA 3E81A 3B6IA 5BYJA 4O0LA 4B32A 1PK8A 4LRYA 4G0UA 3EEBA 1AUPA 4QXRA 1DCTA 1EM8A 3MBOA 3WLAA 1JAZA 1O6FA 4BLOA 1PBNA 5F51A 2Q7DA 3SLKA 2OECA 1R9MA 5HMMA 3VU0A 4D9MA 5KQLA 1ZM2A 4HAIA 1S2NA 3ABZA 3AUYA 4Z99A 4AX8A 4P3XA 1ECJA 1ECLA 4B2YA 4HEA6 4GWKA 3VVCA 1QJCA 4WNIA 5CA1A 1SVLA 3QF4B 4UEOA 1VE3A 3AFIA 2UVQA 2Y6UA 5KYYB 3PYLA 4UXHA 3PWZA 1PE0A 2JLBA 4BVKA 3GRAA 4E07A 3OLXA 3RD5A 4ZT4A 2IH2A 5E2IA 1JDNA 1XAGA 4I2VA 3DYIA 1F7UA 1DFGA 2HPHA 1IMOA 5ESDA 4EFLA 4GH5A 4XYBA 1NLZA 1EFRD 3GLIA 4FFOA 4G3XA 4S24A 1HYQA 1C9KA 2DFDA 3SDZA 3UJAA 1ZO8A 2R1VA 1B1CA 4LJ6A 4X6LA 4EHFA 5JZMA 3LBYA 2K4MA 2I4MA 3LDHA 4FYWA 4S1OA 4F8JA 1KJ8A 2EFCB 3ABQB 4OJMX 4Z53A 4R6WA 1LBTA 4GYJA 1UMBA 4JODA 2XTNA 1GZ7A 1P6UA 5ED4A 3C3MA 4I66A 4LBVA 1TM4E 4KXFB 1FDSA 4PRYA 3ZHOA 3PUYA 4R51A 2ACKA 1BQ4A 2I2FA 1N2GA 4NOJA 1ZIXA 1KQ3A 1VIDA 2Y1KA 3QYFA 2DYKA 5JS7A 1R0YA 5C51B 4RTSA 1N7IA 1QHIA 2NSLA 2P91A 2F8LA 4L0CA 4CFYA 4ROTA 5EXXA 4G0ZA 4N0EA 2P9HA 1Z4OA 2A0YA 1FXWF 3BHJA 2AEEA 2O8BB 3GJ6A 4G4GA 1YZYA 4EMBA 1RJWA 3LBIA 4MVJF 2CJWA 5DTIA 3QBDA 4M1YA 3W0LB 1IIRA 2UVDA 2D2IA 4KZKA 4OXXA 1EJ0A 1RQNA 4M60A 4RACA 2VHEA 2PS1A 4IDOA 4WZAE 1HUQA 2CJXA 4N3BA 2WA1A 1ESCA 2WZCA 3Q8LA 2DPMA 1L3IA 3IE2A 4FZ3A 3UH1A 2BN4A 4LOJA 3JYOA 2ZJZA 2PZFA 2CHVA 3TLKA 1Q1AA 1W87A 3PV0A 2IHYA 2QI9C 3KWFA 4OP2A 3I5XA 2YN0A 1JTFA 2ISCA 1N6LA 3U7EB 2VH5R 3N1UA 1UP4A 3QPCA 3Q88A 4CLXA 1E2UA 4WXYB 2HSEA 4R1NA 1FTQA 1IMJA 2XMRA 3HCBA 3HR7A 3H1BA 4WLNA 2FPPA 3AUAA 4Y2TA 3ZCUA 4F1WA 1ABEA 1U0NA 5JH7F 1FSPA 3RFXA 3HCFA 3QKSB 4URFA 4LXQA 2V6MA 4BAUA 1ABFA 2FSHA 1XZNA 1YR2A 3BCHA 2RHGB 3O8NA 3I6YA 4HKTA 4RS4A 1FU8A 3TW8A 3WWPA 4AQDA 3PTAA 2A5DA 2C5EA 3C6QA 3H42B 1QB7A 1YQQA 2AZMA 3U7GA 3QXXA 2G63A 3ZGOA 3EG9B 4GYWA 2FOXA 1G8SA 2JGJA 4L51A 1HT2E 3Q85A 1TJ5A 3QLTA 4Q48A 4XX0A 2XGGA 3S1AA 1BMFD 5SYAA 4AO8A 4YQFA 3WGIA 3SICE 3SQWA 5T3UA 4DCCA 4AKIA 2RHMA 3ROMA 4N7RA 5H59A 4ZQFA 3WWEA 5LYYA 1U0SY 1H22A 1N1GA 3ZOKA 1PEKE 1QH8B 4BMZA 1G6OA 3VR0A 3K92A 3OP4A 2OYRA 4DDWA 3FDZB 5EWLB 4O2AF 1L1FA 5HNKA 3LGXA 3H1GA 1QG4A 1N8NA 3BB1A 3BQMB 4UHEA 1ZNZA 2YXLA 5ECDA 3BOSA 3RUPA 3LUGA 4FDUA 4ED9A 4OI0A 5TMDA 5BMOA 1Z22A 3ZCTA 4QBIA 1JIQA 3U31A 1Z33A 1CUXA 1B6RA 3HWSA 4JLOA 1T0JB 3ASUA 4G8CA 2OPHA 3T9EA 3U3XA 3VPGA 4V2IA 2JDID 4WFJA 4ZPXA 2Q2VA 4UVHA 3W5IA 2BFOA 1OTXA 4X85A 1T9DA 5EXTA 3TTSA 5IAJA 3WGOA 1XAIA 2HJHA 3CUSA 1FDOA 3H16A 4BNHA 1J8YF 3KYCB 5DTMA 2XNHA 3DVLA 3FYCA 1FNSA 1N7HA 3EPHA 3UJ6A 1SC4A 3G2QA 4DA8A 5TIIA 3TQHA 1Z83A 3VGJA 3CB2A 3TK1A 3QOFA 4CMBA 3ZVNA 1D6JA 3N6RA 3GLFE 1Z07A 4KKXB 1KY4A 1FOEB 2OHGA 4ZTBA 1IZ9A 1EDBA 2XSZA 3Q0EA 4FGWA 4OIMA 5CW1A 1AZWA 5J43A 2ZBQA 3NBKA 3EIQA 4DYHA 3SZMA 1VM6A 4ALIA 5JVDA 2X1VA 4F04A 1C9EA 2NXNA 2PRZA 2V0NA 1LF0A 4RO0A 4GQBA 1G4HA 3VI3B 5DP1A 4ND6A 1AT1A 1NG1A 4R1LA 4E6EA 4GM1A 5BQ3A 2CYCA 2BFCB 3FLBA 4OAPA 2AEMA 4X44A 2R2GA 4AF7A 1RAEA 4UMFA 4R2MA 3QE4A 3DUFA 5EWJA 4M8SA 4LRTB 1LI5A 1SQFA 3OTOB 2ZUVA 3BMOB 2IXBA 3RRNA 2F55A 3LY7A 2D7CA 2QMUA 2QRVB 2YRWA 4W5OA 4W1SA 4P4TA 4U6NA 4DFDA 2C1ZA 1D2CA 1QIKA 2HA7A 3IUPA 3FYHA 1OAOA 1VYTA 4B79A 1EG7A 1QV6A 1I4WA 4KNVA 4DJEC 1YD7A 4AJLA 1N2BA 5IYZF 1OFUX 2ODEA 3ZGYA 1D2EA 1UAGA 4KR0A 3O4FA 4M9ZA 3W1EA 2AD5A 3L8YA 3ZR4B 4B35A 4K9SA 4LDPA 4A92A 2Z9CA 3U13A 2ZJ3A 2OB2A 2PWAA 2AZDA 2QZSA 4UOZA 3GMSA 1KE1A 5IJ9B 4KQWA 2VJAA 1P61B 1UPBA 2XRYA 3MLEA 4PHGA 5G4KA 3S2UA 3AILA 4DF3A 4DN6A 1G9TA 3FNHA 3C45A 3NFRA 4GWGA 4W4TA 1ZD9A 1LLFA 1AF4A 1JHOA 1U2RA 1G2IA 2OORA 3GEMA 3VH4A 1ZX1A 3Q8KA 2RGWA 3AZQA 4FQ5A 4LXTA 4OK5A 4NNOA 1TAHA 1XV5A 3R5JA 4V0SA 4B2PA 2QMOA 4CIDA 4UCQA 4D82A 3A8TA 4AICA 3UK1A 2O5VA 1T36B 3GEIA 2O3QA 4W5TA 1J33A 2HMVA 3I30X 2N42A 1KNXA 5AM1A 3G0HA 3QK7A 4RPLA 4UMVA 5CFOA 2FZLA 2CFSA 3RJ5A 1P45A 3F6YA 2NNWB 2WAMA 3QX7A 3PC3A 4MRAA 1X13A 1KP9A 4RPHA 2R6R1 5AI9A 5HUQA 4PQFA 1BMTA 1VE7A 3LQ1A 2JGFA 1G0OA 3K09A 5FQNA 3KZVA 4AUKA 1L4EA 3I2IA 3T1NA 5A4FS 4DKXA 1YZTA 3NHMA 4C6RA 5JD6A 3A6LA 1MOPA 4ZA2A 3AJ8A 3FLEA 2EW2A 4XD7D 3ZXUB 4J76A 3HFRA 4EGJA 5FAXA 2I03A 2WQZA 3THSA 5EHZA 1UOPA 3OLCX 4AZWA 2VZLA 2WM3A 3DL0A 3IT2A 3ERCA 3L9XA 3QBEA 2CZCA 4NE7A 3T41A 4S1PA 4E1BA 1GWNA 4AKHA 5SZHB 1RBYA 4I8IA 4PTYA 1QBKC 5CFNA 3B13B 2HCBA 1OI7A 1YQUA 3R24A 4BP3A 5CCXA 2A78A 1NJFA 2DETA 1PL0A 3DQPA 3OJEA 2FPGA 1XCOA 4FINA 5L4SA 1RI2A 4XPIA 1B76A 2X5NA 1QYDA 3P32A 3BG5A 1ARZA 1LPMA 2PGJA 3MNFA 4L9RA 2A5GA 4M0KA 3MHPA 3WAGA 1XO1A 5A5DA 4F60A 1J97A 3LCJA 1EK2A 5DDIP 1DMSA 3OKCA 4PEVA 3GZ4A 1GVHA 1WPQA 2VNAA 4BV3A 3UWMA 1J23A 4ZMRA 4L4XA 5JBIA 4NNPA 2AD1A 4HYTA 2XYGA 4H4DA 2C2GA 1QRTA 5AJWA 1OAOC 1F60A 3IMFA 2VG8A 4MHOA 2PKQO 2E2WA 3Q3VA 3BEDA 2PVSA 2Q5FA 5HG0A 5BYBA 1M1NA 4HDKB 1Q3KA 1DADA 1X1DA 4BU0A 5TPWA 3UJBA 1DQPA 1EWKA 3T1QA 1DMRA 4RMIA 4LHXA 5DRYA 4L7QA 1GL9B 3P9PA 4IHJA 1AMUA 3KOWA 3UGJA 3LHDA 3L1IA 3O84A 2JFWA 3UG6A 1IXRC 1RYBA 1XWIA 4I3GA 5CLGA 1NQXA 2OORC 3DYBA 3NAMA 2J6IA 2JIDA 4C0XA 1A5TA 4BWYA 1LPPA 2FFAA 2Q1SA 4V3CA 2QX9A 1ZQ9A 1EFVB 1DFIA 1MB0A 1ZYUA 3IULA 1UFVA 2GKGA 5IAEA 4DIEA 2AC7A 1V8ZA 3RYCA 1T3HA 1B1AA 3HZHA 3PEVA 4FI3F 2OA0A 1EUQA 4CKCB 2MSKA 3UHJA 3FPFA 4TRMA 3B1JA 1JKJB 1N3BA 5D5QA 4C4PA 3GUZA 4DT1B 2VDNB 1Q50A 1HTBA 2W6OA 2VZ8A 3L4KA 5FWXB 5DXAA 1PNOA 5ALHA 4FE7A 3OC6A 1XZAA 5DHFA 3P20A 1ID1A 2IZ0A 5GQSA 2HADA 3CBQA 4B47A 3KJHA 1H65A 5FL3A 4XGNA 5DI9A 5F1PA 3W6PA 2WTEA 2FF7A 2V59A 1RWQA 2DHCA 5A7FA 9GPBA 2EBFX 3EZNA 4F4UA 3K09C 5C18A 4KE6A 1NOIA 1RXSA 5IWCA 3FTFA 2DOKA 3W5AA 4MS1A 1Y89A 1QZXA 4K3VA 3ZCPA 4BFSA 1KBOA 2P35A 1YI1A 2ZPTX 1XMXA 4CCYB 2CUZA 5BWCA 1R37A 2I7XA 3A14A 4QGGA 3T34A 4IRMA 5HIMA 3RTEA 1A71A 4WQMA 4IXTA 2LD4A 2DEUA 1BFUA 2HQSA 3GL9A 2ZJ8A 1T1JA 1XP8A 3OQIB 4DG8A 3BT7A 1ORDA 1JFSA 1R9NA 3AMVA 3UUGA 1SU8A 1U99A 2ENWA 1IH8A 4A0RA 4G1MB 1O0CA 1ZEJA 4M0EA 5CH5A 2IXGA 5TC4A 4OLAA 3A9SA 3F4KA 1E4YA 1JR3D 1C8BA 2HFJA 3PK0A 3PNBA 4KMOA 4BEWA 5ENZA 2EGGA 3T1TA 3N70A 2W90A 3PFGA 3LWDA 2A7QA 3KG2A 4MZXA 2Z4RA 1DO0A 3O83A 1ZJ5A 4Q9LA 2X9QA 3ABSB 5ERYA 1QTQA 5B1SA 1EVYA 4JNCA 2COKA 2Y1OA 4C0WA 2XD4A 4K6FA 2EW1A 4B40A 4BWFB 3KSZO 4AMVA 2PAAA 2AFIE 4I1OA 1LY1A 4FFRA 2YW9A 3CWQA 4BGDA 4JLAA 4JN6B 1JEAA 5P21A 3TSYA 4B7XA 5A5EA 2ZYVX 4C03A 5BUCA 1VPLA 4YP0A 4EY8A 1YBFA 3V1NA 2LRHA 2BEUB 5C34B 3BXXA 4CZ2A 4EW6A 2YJZA 1H2YA 2XB9A 3QV1A 1LRKA 3IC5A 4HMPA 1W0KD 3L7OA 1JG7A 3QE2A 3BICA 4LI0A 1R0CA 1Z7EA 3GUUA 5JZOA 4AI6A 3DNFA 2G80A 4LISA 2RHBA 3NGMA 3D4OA 4PZCA 1UZAA 1CR6A 3WKDA 3H19A 1T8PA 3Q2IA 3C8UA 4I7EA 4PAWA 4DOMA 1BS1A 3WHPA 3H6KA 3DZGA 4IDBA 3K20A 1V11A 4MVCA 2C4UA 1MO2A 5EZ6B 1E3JA 2XHZA 1WUJS 2PA3A 3CYFA 3FUTA 4G67A 4KLAA 3FOWA 2PEZA 4HQNA 2B5WA 1FZTA 4ZO7A 4JSRA 2QR5A 1XZIA 2UYYA 1OA0A 4S3MA 4MUYA 5IEBA 3ADOA 3P0IA 5A7HA 3WL8A 1Q5PA 4ENPA 3HFSA 4YJGB 4H3HB 1Z8HA 2WTUA 3UB2A 3HNRA 3W78A 3EGDA 3KX2A 1TDJA 4W8HA 3ELDA 1QFMA 1ZW1A 2B2CA 2C2HA 4B7ZA 3A2LA 1RYEA 2D8MA 2QS9A 3EZ9A 3HU1A 2BMWA 4ES6A 4HLQB 2GN4A 2VO1A 3OPVA 2JGAA 1JLLB 3JSXA 4MGIR 4RVFA 3A3PA 4CKBA 1IBLB 4IJMA 1DBIA 4YQEA 4NCBA 4F0JA 4HRYA 1CHDA 2A9PA 5CA0A 5HR5A 4P34A 4GDMA 3RS3A 3MMZA 1A8UA 3NRJA 1E1QA 3RSHA 4AZSA 3NU1A 1RXCA 4UBJA 1CR0A 1QE3A 3RHFA 1TMGE 1HFEL 1VC2A 2IXFA 4FN4A 4F38A 5T6BA 2TMYA 3AUJB 5J4LA 1YHZA 1ISGA 2QL7A 1DG3A 3ZGNA 5KSZA 3K1JA 5DV9A 3G2OA 3IDQA 1GPWB 4Z1OA 3DAYA 1C50A 3VDXA 2AZXA 2C58A 4RL4A 3THRA 4ARUA 1U0LA 1SOUA 3GH1A 1ZUWA 1Z9BA 4EG7A 2FUG1 2BZ1A 2F90A 5J2TF 3VMFA 1DAOA 3WMEA 4C4RA 1DRUA 5CDUA 3FRHA 4O4IB 4QVKA 1P5ZB 4QVGA 4JYAB 4LZPA 5E4TA 4RF2A 2PX3A 2X7JA 2QTCA 3GP3A 4UAGA 2O59A 1Y4UA 2PH5A 5E1DA 4ALKA 5KQRA 3P19A 1GA6A 3A4VA 2NPIA 3MWLA 2ZJOA 1PS8A 4YROA 1QHHA 5K1ZA 1F38A 1ZD8A 4W9RA 1ILWA 1G3QA 5A3QA 4GP6A 1VZ2A 2YV2A 3W04A 2GBPA 4O4JA 5L3ZA 3VZCA 4QWMA 4NG4A 2O5EA 3DA8A 5IANA 2WYWA 3UFXB 3FPKA 1ODKA 5AJZA 3DFZA 3OQJA 2G0TA 5IT5A 4MS4B 2XUFA 2O0KA 4QSMA 3LE8A 3GCGA 4RVNA 4IQ4A 4YAKA 1NNUA 2QRZA 3STWA 1BKDR 2D62A 5JBQA 1X8LA 4C0LA 3L6UA 1FTWA 2IYQA 2QJOA 2GNPA 3VKFA 5B5SA 2MINB 3EJ6A 4K9QA 4N54A 1ESDA 1Y7HA 2ZTSA 2BGIA 2IVFA 3G2KA 5JQGB 3K32A 3G6KA 4YLGA 4D97A 3CZPA 4CHGA 3VU9B 1H8HD 2EJUA 4D5GA