5KKCA

L-lactate dehydrogenase from rabbit muscle with the inhibitor 6dhnad
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
331
structure length
328
Chain Sequence
AALKDQLIHNLLKVPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLRTPKIVSGKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPHCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWILGEHGDSSVPVWSGMNVAGVSLKTLHPELGTDADKEQWKQVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCVLGQNGISDVVKVTLTSEEEAHLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase A chain
publication title Ligand binding phenomena that pertain to the metabolic function of renalase.
pubmed doi rcsb
total genus 112
structure length 328
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2016-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5kkcA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5kkcA02
5G0VA 2DTXA 2DBQA 1GAEO 4U0KA 1HF3A 1AE1A 2W2LA 2AEFA 1HZZA 4JP3A 4PRKA 3C1AA 3I1JA 3MJEA 4EUHA 5IXSA 5I7FA 2UUPA 4F6LA 4BKRA 3VH2A 1Y81A 4N5MA 1ADGA 2DBVO 3RBZA 3O8QB 3GF4A 4BO8A 4CM5A 6LDHA 1AXEA 2EV9A 3ZHXA 5A9SB 1Q7GA 4GQAA 1CQJA 4OYRA 1GPDG 2P68A 2OORA 1X7GA 3JQ8B 5IZ4A 2ZCUA 1C3VA 1EE2A 2OHXA 4BQPA 2NU6A 1IZ9A 2ZTVA 3ZU3A 5L45A 3HFGA 1B26A 1A5ZA 1MXFA 2VRBA 5EN4A 3C7CB 1BDMA 3L4BA 1C0PA 2YV2A 4BKQA 4RO0A 1KERA 5KKAA 1TI7A 5HBRA 3ZNNA 1YJ8A 2F00A 2Y1FA 3NGXA 1XU7A 1GQQA 1MLDA 4B7UA 1MXHA 4URFA 2J6IA 5JW6A 3Q6IA 5COBA 1H9BA 2B35A 1B15A 1VC2A 2EEZA 1NNUA 1LQTA 4NPCA 5T6BA 3R3JA 4XGIA 2IRWA 3A14A 4ND3A 4NBTA 1LLUA 1V0JA 4U7WA 4BO3A 4HY3A 3GOHA 1NVGA 3JQGA 1I3LA 3VVCA 1VJ1A 1BVRA 2FPIA 1BWSA 4E31A 1E6UA 1ZK1A 4DLLA 2DLDA 4S3MA 1DOHA 3QLJA 3FPLA 1KC3A 1ZEMA 3H2ZA 1GDHA 3WGHA 3G79A 1GUYA 3GZNA 2F1KA 4ROSA 3U4HA 5BQFA 5KNLA 2GO1A 3RQSA 3H2SA 4K9DA 3AOGA 3MJCA 5ENDA 3BTVA 1X7HA 4XR4A 1DSSG 3GNTA 3L6EA 4XYLA 3GMSA 1R16A 1IYZA 4E6PA 4CV3A 3RJ5A 3HDJA 1NX6A 4IDGA 2YW9A 4JBHA 1HE2A 4MVJP 3MJVA 2X1HA 4JROA 1QYVA 2C5EA 3DTTA 1MV8A 3FN4A 1EK5A 1WVGA 3LYLA 3S2FA 3TFOA 1K5HA 2C5AA 1ENZA 1KEUA 5ES3A 1R0KA 3C1TA 3I6QA 3HZZA 3W4IA 2Y68A 1E1MA 2Y99A 1TLTA 1SMKA 3DBLA 2R00C 3CMCO 1CWUA 4GBJA 4W6ZA 3KV3O 4EBFA 4II3A 2NU9A 2XPCA 4BB5A 4E5MA 3ONDA 2UAGA 1O94A 1FDVA 1JAYA 5EJ2A 4FB5A 4R1TA 2HAEA 5CDYA 1CQIA 5JFOA 3AI1A 4XYMA 3AY7A 4A03A 4HUJA 1W73A 2TMDA 3RU9A 3V8BA 5CDUA 4KUGA 3BMOB 3C24A 2NWQA 3WG9A 4YJGB 1XR3A 4R5MA 3SJUA 1C1DB 2X7HA 2IYPA 1RYEA 1E7QA 4CV2A 5A3VA 3UICA 3WGYA 1UXGA 5KJ1A 2EJVA 1N7HA 1VM6A 2Y1DA 3GPIA 3IP3A 3RUIA 4BGIA 1FMCA 4DLAA 1C1XA 1RKXA 1HKUA 2VHWA 1PTJA 1DBVO 2YJZA 2ZYGA 4L74A 5IFLA 5JSFA 1NFFA 1Q2XA 5HRUA 1PQPA 4R54A 3EVTA 3NJ4A 1MFPA 1ZO8A 1T2FA 4YCAA 2DPGA 1O0SA 2D1YA 5TT1A 3OIDA 4PLHA 1MA0A 2IEBA 3SJ7A 1DC6A 1WMBA 3LSYA 5AXDA 3RU7A 4HFMA 1FJHA 2D3TA 4D46A 4AJ1A 4DWVA 3GEGA 3GVHA 5H81A 3JQFA 4AVYA 3WB9A 3JYPA 3PHIA 4RJTA 3DOOA 4HFRA 3MWDB 2G76A 1LRKA 3D3WA 4J9UE 3JQFC 1CERA 4II2A 1XEAA 3DHEA 3HSKA 2JCVA 2HMVA 1U8XX 4FFOA 1YQXA 3PIDA 3JQBA 4YRDA 1Y1PA 3U5TA 1D1TA 3I9NA 2A94A 3E03A 5EL0A 1Y6JA 2JHGA 1J6UA 1S6YA 1U7HA 1I32A 1ISJA 3CUKA 5JPIA 3JQBC 7MDHA 3C8MA 3ZWOA 4FCCA 3DBHB 3ANLA 3TOXA 5DCYA 3BZUA 4WOKA 1QMGA 1QSGA 4Z9YA 5ENVA 3U49A 1OC2A 4MIYA 1I3NA 4E32A 4XRGA 4OL9A 1IPEA 3CTMA 1NXQA 3F47A 5T67A 1PJ4A 1EFLA 2GPTA 4DIOA 4LW8A 1Y8QB 5L51A 1ZW1A 4CMEA 4ILKA 2BGMA 3FHLA 1J5PA 4DC1A 4DPKA 4QO7A 3VDRA 1ISHA 3GZNB 3OBBA 4TKLA 4J7XA 5MDHA 4CMEC 3OIFA 4GH5A 5EMHA 3PJFA 2DAPA 4EGFA 3G1UA 2WD8A 1JLLA 3M1LA 3ZNOA 5JY1A 5ILGA 4DBVO 3BXXA 3WFIA 3M2PA 4CPDA 2VT2A 4KMSA 1MP0A 4YJHB 1E1NA 3DFZA 4XD2A 1YJQA 2DT5A 5JDIA 3QVOA 2GD1O 3TF5A 1RM5A 3RASA 2VHYA 1KC1A 4CM3A 4E21A 3GR6A 3JQ9A 4R41A 4ZGWA 2X0RA 5JBIA 3C7AA 3X2FA 4EUEA 5LC1A 4HXYA 2WD7A 2Q3EA 1OAAA 2CNBA 3ASVA 3JQ9C 4FC6A 3K92A 2CZCA 1I2ZA 2D0IA 2OP1A 5TNXA 3ZW8A 1Z74A 5L4SA 1H0KA 4DMLA 4D42A 4A10A 4R01A 2QRJA 5HS6A 3ZWBA 4D3FA 5A3JA 3LT0A 1NHWA 4Z0PA 2I99A 4CUKA 3NGLA 1G0NA 1QV6A 4FR5A 4N5NA 3PDUA 3DMTA 4UVDA 3GVXA 4XR9A 3GVIA 4IJUA 2NADA 5HS4A 2PD3A 2GN8A 2AG5A 2I5PO 3RSHA 3SC4A 4BO0A 3DMTC 4MVJD 3E1KA 1I10A 3CZRA 4I5GA 2VT3A 2NQ8A 3F1KA 3IIEA 4OKIA 3KBOA 3GAZA 4WASA 1JAXA 4YPOA 1UXIA 4KWHA 3S8MA 2X58A 3QIVA 3VHRA 2JJYA 1YS4A 1XKQA 3IS3A 1D1SA 1RPNA 3K8ZA 1M6HA 3PHLA 3ENKA 4KDFA 5G2OA 1NBOA 4ESOA 3C1OA 3AI2A 2AE1A 1SB8A 4MP6A 3DB2A 4NJMA 3V1UA 4UEOA 4NK5A 3PJGA 5AOVA 4IDCA 4A2CA 2I76A 1E0DA 4CLXA 5CP8A 1NWCA 4WLFA 3IUSA 1Y5RA 1PJLA 1BHSA 2DQ4A 2OO5A 5JLAA 4TVBA 2CVZA 4DUPA 4E2WA 4GKBA 4Q9NA 1F06A 2Z1MA 4R4JA 3UFXA 4DC0A 2Q1WA 3IJRA 4OXYA 3K73O 1E7YA 4BNLA 2Q2QA 1HL3A 2VYVD 1VRWA 1ZK2A 5G4KA 1GZ4A 4H15A 1R4NA 2HDHA 1ENOA 4PCVA 1BVUA 1NP3A 1PJQA 3IQDB 4ZQBA 1BGVA 2B4TO 2EWMA 4RPGA 1NPTO 4UVHA 4CQLB 5JC1A 4R1NA 4GL4A 4CL3A 5KVQA 3BHMA 3OETA 5KVCA 2P4HX 3WGIA 4HP8A 2P2SA 4Z0TA 3ZWAA 3UCXA 2TMGA 2EG9A 4W99A 3B70A 4CR6A 2GN6A 5TLSA 1U9JA 3B20A 2VUTA 3FNGA 1F8FA 1KIFA 1P33A 3FWNA 5AVOA 5CEFA 3DZHA 5KWEA 4YQYA 3K96A 3HB5X 4DREA 4PLCA 9LDBA 3WYCA 1LDEA 5JAZA 1T2AA 3IJPA 1CRWG 3OMLA 4BV8A 3ROMA 3GRPA 1HT0A 4CODB 2ZCVA 1BW9A 3MWEB 4CM8A 1T4DA 1ZFNA 4RDHA 1B3RA 1SBYA 4O0LA 1DJNA 1B16A 1IY8A 4YRAA 3M1AA 1HWYA 4R9RA 4CMIA 1I30A 3BMNB 5F1OA 2PH3A 3E9MA 3K5PA 4RZHA 3WLFA 2LDXA 3OJFA 1Q0HA 1D3AA 2WD7B 3L77A 4BNJA 1H6DA 3D4PA 3CXRA 3PJEA 4I5DA 4ND2A 1R37A 3SXPA 4E2ZA 4PG6A 3EHEA 1E7MA 3JD4A 1PQUA 1X0XA 3GGOA 4RPJA 4J7CA 3WBBA 5B4VA 3QWBA 5DBFA 2EKLA 2BLLA 3EMKA 5KOIA 3MTGA 5T57A 3OJOA 4BHTA 4BMVA 4DMMA 4XGKA 2RH4A 1ONNA 5IDXA 4F6CA 2BRUA 4IGFA 3I6IA 4J90A 1IUKA 3EZYA 5G0SA 4P4NA 4RDIA 4BO9A 1IZ0A 1E1KA 1NVTA 5F1PA 3W1VA 4JNKA 4Y98A 4FFRA 4BNVA 2EKQA 3EYWA 4RPKA 5TT0A 3FNHA 4YWJA 3GUYA 2XF8A 3K9QO 4EITA 4RVFA 2FZWA 4WNCA 4B3JA 1T1SA 1Z6ZA 5IG2A 3BMCB 5L7WA 1K3TA 1IE3A 4GLOA 4Y6PA 3U62A 1I3KA 4RVUA 1H2BA 3P7MA 4ALJA 1PL7A 1FXSA 2FP4A 1R0SA 3DR3A 2IODA 4BNGA 1YDEA 4YT8A 1X13A 3CKYA 4Q3NA 3IAHA 4UUNA 3FTNA 4D41A 1XWFA 5DN9A 3B1KA 1QYWA 4BUCA 2OL4A 2J3JA 4UAGA 1WZIA 4AJJA 1E77A 2WTBA 2W2LD 1LX6A 8ADHA 3UXYA 1A4UA 3K31A 3HFSA 3P5SA 2OP0A 3PGJA 4IDFA 1DC3A 4IBOA 3ETGA 3NDRA 4I5FA 4NBUA 2QG4A 3R0IA 3NTQA 4TRJA 3ZWXA 3BHIA 2WYVA 4XB2A 2EF1A 1ZMTA 2C59A 4HX5A 2DKNA 1UZMA 1WLYA 3PK0A 5K6AA 3E6AA 1H6BA 3UGKA 3VH1A 3X2EA 2VHXA 3RCBA 4FOOA 3H8VA 3RUAA 1LDMA 4XQGA 3KLMX 2VYVA 2QRKA 5K6AC 1E7WA 4Z0HO 4Q3AA 4WLEA 4UVIA 1AN9A 1PJCA 1ZH8A 1UDCA 2JHFA 3RC1A 1N8KA 3RBXA 3WJAA 3KYDA 4LMRA 3TZ6A 4MJLA 4AJOA 3TN7A 1R4MB 5COAA 4LRSB 5JYEA 2X5JO 3B1JA 3NTOA 2PZLA 1YRLA 2B4RO 3I52A 3WICA 5U9CA 4Z9FA 1M75A 3OQ1A 2V65A 3WOHA 2JFGA 3MJ4A 4DRYA 4CUJA 1JW9B 1EK6A 1W8DA 2RHCA 1IULA 3WQQA 4J7UA 2ZB8A 5G0UA 4GX2A 4WE3A 4D7AA 2PV7A 3DAPA 2NV6A 5IDYA 1T25A 2B37A 3H9QA 3DEYX 2YDYA 1BW9B 3GA0A 4KQWA 5IAAA 5IZCC 2J8ZA 1VKNA 3PHHA 4U8GA 4E5YA 1N1GA 4D79A 2ZB3A 1HEUA 3N74A 4GVXA 4BNKA 1P1FA 1GYQA 5EINA 2WE8A 4Z6KA 5JCXA 1SZJG 1I33A 2NSDA 3QP9A 3QVSA 2PLAA 2PK3A 2NVWA 2CF5A 3JD3A 3R3SA 1UAYA 4OKNA 3B6ZA 5EESA 1PX0A 4BNZA 1L1FA 1PIWA 3NEPX 4NK4A 3H5NA 4WEOA 3GZ4A 4P8RA 4EYEA 4KP7A 4JBGA 1ENPA 5CDGA 4RPHA 1LQUA 2HK7A 3V2GA 2ILTA 5L9AA 4W4TA 3PIIA 4CLDA 1SO8A 1P3DA 1P1IA 3INGA 5L95A 1RM4A 1YWGO 1B2LA 5JE8A 1FF9A 5DULA 1VL8A 4HADA 4XGNA 1NM5A 1DO8A 4JLWA 2UV8A 3BA1A 2GSDA 3ZWVA 4E30A 2BF7A 2Q1TA 1DFGA 2X22A 2Q99A 3PEFA 1L7DA 4HBGA 4GGOA 3SVTA 5L7YA 4C4OA 4EDFA 3IKTA 3LLSA 3IUPA 3ZCXA 4KTVE 4E33A 1WXDA 2FR0A 4FSHA 4WJZA 1AHHA 5EIOA 3CPSA 1E3JA 3DBRB 3G17A 3HJAA 3WTBA 3BIOA 1ARZA 3JQ7A 1LXCA 1VLLA 2C54A 1V6AA 3RKUA 1E3IA 2HU2A 3FF4A 3WDSA 1PGOA 2EGGA 2WM3A 1E7RA 2EIHA 4FBGA 1QYXA 5HA5A 4MINA 1P45A 2AXQA 5IF3A 2OUIA 1U4SA 2VWPA 1DFIA 3GVCA 4WLNA 3KB6A 1Y9AA 1H2HA 1Z7BA 1KVQA 5DCWA 1OI7A 1EUZA 2UDPA 2ZYDA 5BNFA 1PWXA 3TL3A 5A02A 5ADHA 1SPXA 1D7OA 1NHGA 5KJCA 3E5MA 2RBEA 3CEAA 1M66A 1P44A 3JQ6A 2BKAA 2NNLD 1ID1A 3AWDA 2YHIB 3GRKA 3AFNA 3E48A 3QSGA 3ZHZA 3PLRA 4WKGA 4CLOA 4JCOA 4NHEA 2YFHA 2Z5LA 4DPMA 4HNGA 4ZHSA 1PJSA 5DT9A 5DBIA 2FPPA 1PEDA 5EQDA 1KS9A 4W7IA 4CLRB 1ZEJA 3OJEA 1Y5MA 3ZU4A 1T2DA 4MIEA 1KYQA 4XJSA 3VZQA 4D3DA 3CZMA 1HDCA 2B5WA 3AUSA 3M6IA 3OA0A 4OXNA 4YAEA 3PXXA 5TX7A 2AW5A 2AEMA 2E48A 4HKTA 2D5AA 1T26A 3AM4A 4XA8A 2WJPA 4G81A 4P4LA 4Y9DA 2O50A 3CINA 1JQBA 4ID9A 3SEFA 4BS9A 4LN1A 2JFFA 3F5SA 4PZDA 4AJKA 3QJ5A 1XELA 2FWMX 1T4BA 1P0FA 1QR6A 1S7CA 1NPYA 4Q39A 3UAGA 2VOJA 3UN1A 2PKRA 1PS9A 3OJLA 1XQ6A 3PFWO 1GUZA 2EW2A 3WFJA 3W4JA 2BHLA 2QHXA 3BMQB 2GUGA 3ON5A 4LSWA 4P4GA 2I3GA 5GZ6A 4I5EA 4KUHA 3MTJA 1P74A 3NT4A 4UUOA 2W98A 2VUSA 2VNAA 2O7QA 1DAOA 3RJ9A 1DRUA 1R0LA 3AY6A 4LMPA 4B7XA 3OHSX 4ZU3A 3VC7A 4A7PA 4J0FA 4GMGA 4DA9A 4EJ0A 4QQRA 8LDHA 5FEUA 3DMYA 3ZNQA 4X54A 3ZV6A 2ZTUA 5JC8A 2Y1GA 1TA4A 3PWKA 1P1RA 1CYDA 4WEQA 1EBUA 2GR9A 4R1UA 4AL4A 1A71A 3ZWMA 2B83A 1PR9A 1F8GA 1ISMA 2JD0A 4TRRA 4G65A 3AU9A 4BGUA 2CSUA 1ZNQO 2NM0A 3RBVA 3KYBA 2IXAA 1H5QA 1AHIA 2YY7A 1SCUA 1UXHA 4MVJG 4YYZA 1UJMA 2E37A 3NAQA 2R00A 1YGYA 1I36A 4WOJA 4PRLA 3PTZA 5KJ6A 5JDCA 3G49A 4AJIA 2JFHA 2D5CA 2VNSA 2VZ0A 3QE3A 3LT4A 4UULA 3PYXA 4E5PA 5DDIP 2J3IA 3UF0A 5JDCC 3WGGA 4OMUA 3R6DA 2Z95A 3OQBA 5A05A 2PR2A 2I3AA 3GHHA 1PL8A 3T4XA 3CSDA 3TRIA 1HE5A 1HYGA 3HDHA 3HE3A 4JP2A 4OH1A 4PVCA 2QIOA 5KIAA 3WQRA 1JWBB 4GGPA 4DTIA 1LRLA 3BTUA 3DDNA 2ZJ0A 3H5RA 1ZUD1 1BXKA 1LUAA 4XX0A 2Y1CA 3F3SA 1WDMA 3IKVA 3IC5A 4BL5A 1LDGA 3C7DB 1IB6A 3MOGA 2D2IA 4ZRNA 2PNFA 3DOJA 3G0OA 3TL2A 3I3OA 3D7LA 2EW8A 3EDMA 3O9ZA 3GGGA 1U28A 1WDLA 3RUCA 4A73A 5BR7A 5F5NA 1HSOA 2H63A 1QLJA 2QYSA 5JO9A 4GLLA 5COQA 2C07A 1PJBA 2DTDA 3C85A 1TT5A 2NACA 4BV9A 5B37A 3CH6A 3MEQA 1EVZA 1ZJZA 4PG5A 3SLGA 1XCBA 3N7UA 1LDBA 2GF2A 3DZJA 4PLYA 1DC4A 3NV9A 4HFNA 4RF3A 3A1NA 1K0UA 2O3RA 3WGQA 2FOIA 4M8SA 2C2YA 1Q1NA 2CFCA 2DBRA 3NKLA 4UUMA 3LZ6A 4PZEA 3ST7A 4J49A 1GQYA 1GV1A 2JD2A 2HSDA 2O3QA 1YL7A 2O7SA 3QA9A 1ENYA 4IMPA 3LC1O 5FI5A 3RC2A 1IOLA 4DYVA 1MG5A 3FI9A 1LLQA 3RAJA 1E92A 2FZEA 3W6UA 5JY6A 3ZU2A 1U1IA 3WGTA 4AJPA 1UP6A 3ZHBA 2ZJ1A 4BNFA 4CMHA 4B7CA 3JYNA 3ONFA 4EW6A 3K2EA 2EXXA 1LC3A 4HV4A 4O59O 5EQFA 4UREA 1O5IA 1UH5A 3DZKA 4A0SA 1OMOA 4WLOA 2RIRA 2GN4A 3OIGA 3VKVA 1HE4A 3QV1A 4GPD1 4YAGA 2BGKA 3JQGB 1DRWA 3LK7A 1QRRA 4CQMD 4DYDA 3DZBA 3MOIA 1DAPA 3E9QA 4LCJA 2R6JA 3TZQA 3HG7A 1QV7A 1YOVA 3I4FA 1R66A 2BFOA 3P19A 4OO3A 4E2YA 5L3ZA 1B0AA 1E6WA 2GGSA 2AQKA 2I6TA 2X4GA 1U3VA 2X9NA 4E3ZA 4R1SA 2EERA 4NJOA 1GEGA 1GYPA 3EW7A 2X8LA 3GPDG 3U9LA 4ALKA 3DZFA 4RVSA 2YHUA 4NI5A 4ZJUA 4ZICA 3DWFA 3VH3A 3RFVA 3S2GA 2P4QA 5TC4A 3DZIA 3GC6A 3KEQA 4NFHA 4WPGA 3UCFA 1XQ1A 2J5KA 1H93A 3PYMA 4QTZA 4FDAA 1BTOA 5BSEA 4NBVA 1E3WA 2W2KA 1VJTA 1AUPA 1HDXA 3H3JA 5T64A 3PQEA 2HQ1A 3OH8A 2J3HA 3K30A 3DBLB 1QLHA 5L40A 1VSUA 2PH5A 5G0WA 1GPJA 4TRMA 1MG0A 4YDRA 1YE3A 1QKIA 4FFLA 4TWRA 1LLCA 3DQPA 2OMEA 3GDFA 1XYGA 1FDTA 1UDAA 2A9FA 3FNEA 3MJSA 4XCVA 2VWGA 2VTEA 4IQGA 1KVRA 2NVUA 3PPIA 1MC4A 3GVPA 3V1TC 4L4RA 4IJWA 3LLVA 1W0CA 4AJLA 3HADA 1NPDA 5I8WA 2EJWA 1EVYA 4Q3CA 4BO6A 4WUVA 2CMDA 4MVJI 4M89A 1VJ0A 3H9JA 3OSUA 1NR7A 4DIBA 2OOSA 2A4KA 3DBVO 1GL3A 3N58A 1M2WA 4XKJA 3RC7A 2FSSA 4XQ9A 2CDBA 1C1XB 2X5KO 3Q9NA 4YRBA 4OAQA 4YT4A 2O3JA 3W8FA 3I9MA 2PFGA 3PJDA 1A7KA 3ZH2A 2XAAA 4I08A 4UEKA 1E5QA 5U1PA 1RM0A 4YR9A 5C5IA 1N9GA 2QQ5A 4CM4A 4M49A 3LVFO 4U6SA 3SC6A 4PGFA 2HMTA 4E2XA 2CVQA 1YL6A 2P9EA 1A9YA 1EFKA 2RAFA 2GASA 1PZHA 2DTEA 2C7GA 3I4CA 5JNLA 1O95A 3F4LA 4INAA 1OBFO 2BH9A 4Y67A 1I5RA 2YUTA 3CIFA 4JGBA 4YEDA 1UP7A 4OIMA 5DP2A 4MVJH 1I2CA 1I8TA 3LT2A 4H7PA 4BVAA 4D44A 4JIGA 4DIFA 5CFZA 2CF6A 3D3WB 2Y1EA 3B1FA 2POQX 2BD0A 3H7AA 4BKUA 3MCVA 2HMUA 4XJTA 2E49A 2X0IA 4YBZA 3TPCA 5H83A 4B4UA 1R6DA 1UXKA 1LC0A 2AQ8A 2WYWA 4J4TA 3PQDA 4BNTA 1VI2A 3BTOA 1IPFA 2NTJA 4YT2A 3VKUA 1Z73A 4NIMA 1C0IA 3AUUA 1EUDA 2O2SA 1XLTA 2PGJA 2VOEA 3JYLA 4RGBA 3FBGA 4DGSA 3EGOA 5CG2A 4BIIA 1T1RA 2QW8A 3T4EA 2HLPA 2EHDA 3HHPA 2GZ3A 2WE7A 1QYCA 4R3WA 4YACA 3UVEA 2H1SA 2HKIA 4I9NA 4ZA2A 1K6XA 2OBNA 4UEJA 2HJRA 5G4LA 1HDZA 1P31A 3IDSA 3AU8A 2GZ1A 4CQMA 3HUDA 3OM9A 2HO5A 4MKZA 1YL5A 2Q2VA 4P22A 1HDRA 3ZGYA 5CPFA 1DHTA 4DBZA 4FW8A 2DFDA 4DQUA 5IDQA 3D64A 5CDTA 3QQPA 3D1LA 3Q0EA 2ZB4A 1T2EA 1U5CA 2XOXA 3AJRA 4K1LA 1H6AA 5I8ZA 3ZHYA 5DNAA 2Q46A 4NNJA 2E6UX 5JMPA 5GZ3A 1F17A 2QZ9A 2Y05A 3GLQA 1QYDA 2HUNA 5FYDA 7ADHA 2PTGA 5ICMA 4QX6A 4AFNA 2P91A 4JXKA 4GSKA 1I3MA 3HDQA 2ZIZA 5FI3A 4H16A 1FK8A 3F46A 4BMSA 5A5EA 1WMAA 4B3IA 2IE0A 2O2YA 5AYVA 3WNQA 1BMDA 2PY6A 2J5RA 4QT0A 3ANNA 4QFDA 1GZ6A 4XZ3A 4CM7A 4U0JA 2AQHA 5KTKA 4J3FA 3EVNA 2HK9A 4FPXA 2PGLA 4IDEA 4YJFA 2B69A 1KEVA 1Y8RA 4MP8A 4B4WA 3ZV5A 4BNNA 3L07A 1SAYA 5LDHA 1UR5A 2WWRA 2X0JA 3VDQA 2C2XA 2VHVA 5CPBA 3TZKA 4I8XA 1TT7A 2AEJA 1BXZA 4NU5A 1MC5A 3FNFA 3ROKA 2B0JA 3NYWA 3EC7A 3W6ZA 1W4ZA 3VPFA 5BSGA 3JSAA 4J4HA 3F9IA 4CM4B 4NJMB 3AFMA 4NG5A 4I1IA 2YFQA 9LDTA 4I9HA 5TQVA 1V3UA 1E3SA 2DVMA 4IDBA 4WCFA 1G6KA 4ONEA 4IQ0A 2NVBA 4FS3A 1KOLA 1LJ8A 2GRAA 3OP4A 5A1TA 1O6ZA 5THQA 4RPLA 4WCFC 1KEWA 5BNIA 1M76A 1CDOA 4BO7A 5BNTA 4A5OA 1KETA 2RH8A 3CE6A 1YB5A 1P77A 2BMAA 1WW8A 1JN0A 3KSZO 5I9LA 4LCEA 2AE2A 5G4KB 1LLDA 3S55A 1R4NB 2ZKLA 1O8CA 1ML3A 1X1EA 1PZFA 3WLEA 4L8VA 3KTDA 1EMDA 3PQFA 3FRJA 2DUWA 2O3TA 3GK3A 3KYCA 4M86A 2SCUA 1O9BA 3PI7A 4JQCA 3TZHA 3KZVA 3UCEA 5DF1A 1GCUA 3FSRA 4OHUA 3LDHA 4J4BA 3INTA 4FC7A 1Q7BA 2BFPA 4ZVVA 4GX5A 4W7HA 5IN4A 1RYDA 1XG5A 2BFMA 4NFSA 1B8PA 4S1VA 1EE9A 4IIVA 1U7TA 3WMWA 1E5LA 5C7IO 4L76A 3A4VA 4E0BA 3ZDFA 3RUDA 2AQIA 4QO8A 1PJ3A 3O38A 1Q0LA 3ZZNA 2H6EA 3O8QA 2BGLA 1GR0A 5IZCA 2Y93A 5F5LA 5A9SA 3WGOA 4CQMB 4J91A 5CEJA 4YJDA 2VZ8A 3OQ6A 2O48X 4CM8B 1HXHA 3JQ8A 1QP8A 3PDJA 2JKVA 5AXBA 4WNIA 3TDKA 4BO1A 1WWKA 3QHAA 4J1SA 4JJGA 3JD1A 3PHGA 4IMRA 3ETDA 1CEQA 3H6KA 4CR7A 3LQFA 1KBZA 2GYYA 1ADCA 3EY4A 5TS3A 5C7OO 4BGVA 2VQ3A 3E5RA 4IZIA 3ZN2A 1L7EA 4CMIB 1VKOA 1HDOA 2C29D 4GSLA 4FGWA 3FCOA 1PGNA 1NQTA 1IHXA 5KCZA 2DBZA 4TVOA 2V6BA 3L9WA 1B7GO 3GNSA 3QRWA 5GZ1A 3ADPA 4MKRA 3HQ4O 3VTFA 1PZGA 1DC5A 4DLBA 3KEOA 1YONA 3ZNPA 4XRRA 2A92A 4KDEA 4LRTB 2HRBA 1NQOA 1N5DA 2QZZA 4A27A 3RI3A 3QVTA 3D5TA 1GTMA 1JWAB 4CMGA 5IXYA 1ZKMA 3I9KA 3K2BA 5I9MA 3U3XA 1CJCA 3ICCA 1ZCJA 2FMUA 1Q7CA 4CM9D 3WMXA 2ZQZA 1TXGA 4WCDA 4TRNA 1DJQA 1F14A 4LISA 4TMFA 4Q3DA 4OGWA 2W4QA 1GADO 1QORA 4MVJM 1WNTA 3ZW9A 5L4LA 2RHRA 1NR1A 2O3UA 3DFUA 5DOVA 3PZRA 2HJSA 3EK2A 3RUEA 1U8FO 4AJHA 4YAKA 1XHLA 3NTRA 2DPHA 2OZPA 3GEMA 3QW2A 5JS6A 3VZPA 1MX3A 4J43A 4OXKA 1UZLA 1HE3A 2Q4BA 3W8EA 3RFXA 1ZSYA 1WDKA 2P9CA 4JJIA 4K28A 1NQ5A 4YAJA 1FDWA 4B3HA 3INRA 1NYTA 3ZV3A 3IP1A 4NBRA 2YYYA 1U3UA 1Y7TA 1N92A 1EQUA 2FR1A 3FWZA 2O3SA 4PFJA 2UUOA 3QVXA 1KY4A 3I9LA 1NASA 3PP8A 2FN7A 2XXBA 2I66A 3RC9A 1YB1A 5BT9A 4CJXA 1B3BA 1LDNA 1JU9A 4E5NA 5LDGA 4AJ2A 1K2WA 2G17A 3SBOA 1LNQA 4J1NA 1I0ZA 2RCYA 5U4QA 4QXMA 3WR5A 1QXSA 1Y9EA 4BO5A 4RORA 5ICSA 5BSHA 1SNYA 3BMOA 5T8KA 1F0YA 5ITWA 3NJ8A 4HWKA 4YJGA 2J5QA 3NX4A 2E82A 5KJEA 5ER6A 2Y1OA 3DO5A 2Q1UA 3GNQA 3ZI0A 1A72A 3U09A 5T8KC 1KVTA 3GEDA 3ANMA 3JCZA 4C7JA 1U2GA 1E7SA 1YH3A 4BO4A 4KOAA 3AY3A 2YDXA 1EVJA 3KYDB 2FPGA 4J1QA 3TZCA 4O5OA 1H94A 4MPDA 4UUPA 3F4BA 4C7KA 3MZ0A 4YT5A 3LF2A 3BAZA 5TIIA 3WNVA 4U6QA 4CMJA 5HWSA 5A5FA 4PG7A 5JCJD 4OSPA 3IL2A 1KEPA 2JD1A 3KVOA 1BG6A 1GYRA 1UZNA 3AOEA 3DHNA 4PLWA 5FF9A 1TB4A 4BNHA 1HSZA 4D0SA 4IS3A 1DHRA 1MB4A 4FFNA 3EAGA 3BTSA 3HN7A 3MJTA 4Z9XA 4YA6A 3AOEC 1LU9A 3VZRA 3L0DA 3PHJA 4R68A 1V8BA 1MUUA 4W9NA 1F12A 3BYZA 1GZ3A 1PJTA 3JD0A 1PQWA 4AJNA 1YXMA 1MGOA 2I65A 4W9NC 1R12A 1P1HA 5DCUA 3FTPA 3L4BC 1XSEA 3KO8A 2IDZA 5CG1A 3DBHA 5LCXA 4IQ8A 2VRCA 5I7VA 2IXBA 2YQ4A 1UUFA 2D4AA 1G1AA 4MDHA 1LDYA 2FSVA 4GX1A 5L4NA 1Y8QA 1UAGA 4UVEA 3TOZA 4PIVA 3WQSB 1TEHA 3AUTA 3TSCA 4RQUA 3SX2A 4G2NA 5KKCA 3HB4X 3U0BA 2PGDA 5JAIA 2EP5A 3DL2A 3HWRA 1LA2A 1YBMA 2VWQA 3VVBA 4TQGA 4KWIA 3DHYA 4GX0A 1YQDA 2FY8A 4NU6A 3LC2O 1YDWA 2DUUA 2VTDA 2Y0DA 4EI2A 4FJ0A 4CM9A 5JAMA 3IMFA 4HFJA 4YJHA 3ULKA 2X0NA 2FR8A 4HNHA 4NH4A 4B8WA 4AICA 1IL0A 5A03A 1HLDA 4KUEA 3H65A 5MGBA 5TJ9A 4F46A 1V3TA 3AM5A 3STHA 3VPSA 1AXGA 4ZD6A 3VPXA 4EEXA 4RVHA 3ROQA 4RL6A 4B79A 1K6IA 2EP7A 3JQ7B 1YBVA 2NU7A 3UKOA 2H9IA 5AXAA 4ALLA 3WSVA 1C14A 1I01A 4YQZA 1JA9A 1U5AA 4L73A 2Z1NA 3UOGA 2HCTA 3P2OA 3DAGA 3M2TA 4CMKA 3JQCA 3OF2A 3E82A 3GT0A 4NQZA 2EGHA 3NT5A 3D5QA 1AGNA 2Q2WA 4JN6B 5JO0A 4XYBA 4NR0A 1ZSVA 3WIDA 1R15A 3H5AA 3RKRA 3Q3CA 3GG9A 5A04A 2V7PA 5C3MA 1RWBA 4N18A 2C0CA 3AK4A 3GHYA 5TSDA 3T7EA 3ITDA 4QEDA 1X7DA 1ZK4A 1YO6A 1DIBA 1NFQA 3V2UA 3RFTA 4XIJA 4RLHA 4CLOB 2I67A 2O23A 2VUUA 4B4OA 1OFGA 5CHEA 3RWBA 1NQAO 4F45A 3U4IA 1T2CA 3JV7A 4ITUA 1J4AA 4Y8VA 2IEDA 2IYOA 2ZQYA 1PS0A 4B8ZA 2Q1SA 4BMNA 5KVVA 1GUFA 1M6WA 1XIVA 4EUFA 1JVBA 2VCYA 4IINA 1QG6A 3JQEA 3A28A 4RF2A 2I9PA 3JQAD 1XDWA 4JK3A 4QUKA 1E1LA 1JDJA 2ZTMA 4MKXA 1EBFA 2VYND 4XB1A 5AQ1A 1V35A 3S2IA 3L6OO 4BO2A 1Z45A 5B12A 2CY0A 3T7CA 3KUXA 2OXIA 4NBWA 2O4CA 1J49A 4M87A 4CM6A 4LGVA 2PWZA 2Q45A 1GCOA 4ZRMA 5JCJA 3NT2A 3ZWWA 1V3VA 2X23A 5DZSA 4CL8A 2CVOA 2BELA 4YTEA 4PG8A 2LDBA 3FR8A 2CDAA 3Q11A 2V6GA 3H9EO 3QWAA 1E3LA 1YBAA 4MP3A 4ZN6A 2G1UA 3AW9A 3RROA 1DPGA 2V6MA 1D8AA 3KRTA 3OFSA 1Z75A 2X6TA 4CQLA 4FFMA 2JAPA 3IOYA 3LT1A 2GN9A 2HMWA 3DONA 4XQCA 4WGGA 4ND5A 2QRLA 4J2OA 4J9VA 1NVMB 4K26A 1EDOA 1PR3A 4DQVA 4B4VA 5IDWA 1RM3A 1ZXLA 2PZKA 4G5HA 4JX8A 4PLVA 1B14A 3F6YA 5ITVA 1YKFA 1IHYA 4PLPA 1EUCA 1PGQA 5B4UA 3KSUA 5K9ZA 3COSA 3WTCA 1KVUA 4GKVA 3TJRA 1DDOA 1PGPA 4IXTA 4MOWA 4MVJF 1V9LA 2CD9A 1X15A 4W82A 4PVDA 5H82A 1DB3A 3W4KA 2G0TA 2DFVA 3FR7A 4IJKA 3ZV4A 3Q1LA 3HNPA 3WYBA 2ET6A 2P5YA 1ISIA 1C0KA 4DXHA 3Q2KA 4GMFA 3GH3A 4R9SA 5TRTA 3TWOA 4CUZA 3FBTA 1PS8A 5J23A 5ILOA 4L4XA 3BMNA 4DQXA 5JXWA 4KTTE 4EJMA 2X5OA 3DZGA 3JD2A 1ZBQA 1Z82A 3L9XA 2JL1A 3P2YA 5JDIC 3VPHA 1SEPA 2NQTA 1DEHA 3DXFA 3OEYA 2AA3A 3NDJA 3V1YA 4D43A 1HDYA 1ZK3A 4DL9A 5GMOA 1EEHA 3R1IA 1VSVA 1TVEA 2AMFA 5I7SA 4IDAA 4TKMA 1W6UA 5L7TA 4IJVA 1J0XO 1O89A 3F5QA 4TROA 3ZWYA 4RQTA 3ZWCA 3PFFA 4E12A 6ADHA 3QWHA 4Q3EA 4CLEA 4FIZA 3WBFA 4QFCA 3LC7O 2D59A 4BNUA 2NU8A 3KSDO 4A26A 4U5QA 1K89A 1HRDA 5DOZA 4Z3DA 2C20A 5A9TA 1LSSA 2C82A 3WS7A 4GAEA 2HK8A 3GQVA 1ULUA 4IM7A 1WAMA 2BI8A 4OSOA 1JKIA 1ONOA 2YV1A 3HN2A 4ZQHA 1TT5B 4O63O 3G3EA 5JYDA 1BXGA 4ND4A 2B4QA 2GDZA 2PD4A 4K6CA 1EVIA 1RJWA 4XWYA 5FFFA 3S1LA 1VE9A 4BB6A 3JQDA 4P38A 2JAHA 4AJEA 4FFPA 3BMCA 1CF2O 2PZJA 1C0LA 5HTOA 3G1TA 5JMWA 1H9AA 4RV9A 1DRVA 3GY0A 1BSVA 4PG4A 3S2EA 3AI3A 3WX0A 5L53A 3OA2A 1DLJA 3GDOA 2Y0EA 3K6JA 4H3VA 2AHRA 4DPLA 4BNWA 2WDZA 4M1QA 4FJ2A 4FD3A 1UXJA 1EZ4A 1ISGA 3ONEA 4IUYA 4UVGA 4OOFA 4IGEA 3KETA 5AXCA 3JQAA 3D3EA 3VAZA 4RF5A 5THKA 3BHJA 2H5LA 1GQ2A 5TF4A 2VYNA 3WSWA 3WWZA 4CLHA 2PKQO 3NDIA 1LTHR 4IY1A 1U2DA 1GD1O 3DTYA 4KQXA 4CMAA 2P5UA 4LVCA 2IZ1A 4BNXA 1CIVA 4N5LA 2Q49A 3GGPA 1X0VA 2W90A 3ZU5A 4WK6A 4XYGA 1NTOA 1P1JA 1YOVB 4ZQGA 5KVSA 3KOUA 4MO2A 1X14A 2GERA 3HDYA 4ALNA 2NTVA 4MIOA 4NZ9A 1I24A 2Y66A 1NWHA 2CDCA 4ZQFA 3TQHA 1SOWA 1OC4A 1PSDA 4QECA 2ZATA 1Z7EA 1R4MA 3GFBA 4CM1A 1SEVA 4JJFA 4R69A 1HTBA 2WEKA 3LU1A 3E8XA 3H9GA 3ADOA 4GVLA 3VTZA 5BSFA 3ABIA 1DFHA 4FOSA 4OOEA 3GDGA 5ER9A 2VHZA 1VL0A 3ETEA 4L4SA 2IZZA 5A9RA 4XDYA 5F1KA 1OZAA 3PZBA 4RVDA 1HETA 2BFAA 3EZLA 1T24A 3ICPA 3UUWA 3VZSA 5CEEA 1NAHA 2Y67A 3H4VA 1KY5A 4IIUA 4CMBA 3E18A 3GAFA 3PYLA 1E3WB 2W2KB 4LVUA 4O1MA 2X9GA 2ZK7A 1DIAA 1P9LA 1DLIA 3A06A 3RVDA 5CAEA 2ZB7A 5CDSA 2FHSA 2B5VA 1ORRA 3ZWNA 5IN5A 4M55A 1Q0QA 5B4TA 4J16A 4EJ6A 1FDSA 2QYTA 1YVEI 4L0QA 4Y6RA 4MVJE 2PA3A 1ZXBA 3AM3A 3ENNA 3E9NA 4FJ1A 1JKFA 4M54A 1LI4A 4RLSA 4YVFA 2WMDA 3W8DA 4PLGA 1A4IA 3ORFA 1LSJA 2FRDA 1DIHA 4J0EA 2GZ2A 2VWHA 2E4AA 4PLZA 2BI7A 4RZIA 2NVUB 4E13A 4PLTA 4BNYA 2ZTLA 1E6EA 1HYHA 3ITKA 3C3XA 4Y6SA 1UDBA 2CUKA 4OM8A 5JAQA 4TZKA 2G5CA 4D3SA 3H3FA 1A9ZA 3LF1A 1WP4A 4EEZA 2D8AA 1LSUA 1HDGO 1WPQA 2J3KA 1YQGA 1ZZEA 3GFGA 4TSKA 4N7RA 4PZCA 4WLVA 2JCYA 4YB8A 3FD8A 2GLXA 4WECA 3QWIA 1GY8A 1M67A 2DU8A 5C37A 1N9GB 4J1TA 2C7VA 1BXGB 4EZBA 3L4SO 3CMMA 3I23A 4R16A 4XIYA 1D4FA 3KM0A 1YB4A 2PD6A 3NUGA 3GMDA 4PLFA 4IZHA 2GNAA 1N7GA 1K6JA 3O26A 2A35A 1B8UA 4MVJA 3O03A 4BGEA 4BOYA 5HM8A 2G82A 1PJ2A 5I7EA 3DBRA 2JCXA 1OOEA 2Y0CA 3FPCA 3SLKA 4CMCA 3PGXA 1DIGA 1B8VA 5KJFA 2NLOA 2R2GA 4OQZA 1GV0A 1PGJA 1A7AA 3D0OA 5A4DA 5F3RA 4NDNE 1SB9A 3O4RA 3OICA 3RUFA 2GCGA 3PLNA 3A9WA 3UHAA 4J2HA 3DOCA 2OBYA 4N54A 3RIHA 1DIRA 4AG3A 1GEEA 2XXJA 3DC2A 3JQAB 1GU7A 4Z3KA 1ULSA 3EUWA 5FWNA 4CR8A 4D0RA 1SC6A 3UH1A 1H6CA 2WYUA 4TZTA 4BKPA 2YHIA 1XA0A 5I9NA 3RD5A 1JTVA 3D4OA 3I83A 5TGDA 1HYEA 5TJHA 3TNLA 5C7LO 3PRJA 2OFPA 1XU9A 1ZIDA 4R51A 3DAFA 4PN3A 2B36A 4QSMA 1EDZA 1ZVMA 4CLRA 3WJ7A 4IXWA 4RF4A 3GN1A 4FN4A 1KVSA 4E5KA 3V5NA 5F21A 1GFSA 4YAIA 1LEHA 3Q2IA 3QY9A 3RUHA 1VL6A 4NFYA 1ZJYA 1WZEA 3I5MA 2OGUA 3NRCA 2VN8A 1P0CA 5EPOA 1JVSA 1XGKA 2HRZA 3JYQA 3TFQA 2VRCD 4K6FA 1I2BA 4XDZA 3GN2A 3WIEA 1LBEA 4AJ4A 1SOVA 1P1KA 4GWGA 5DBGA 2ZYAA 2DM6A 1PU2A 4ND1A 3U4DA 4BNMA 1NAIA 2W8ZA 4LSMA 1EQ2A 3WYEA 4J6FA 4D45A 1ADFA 1U3TA 3BMQA 3AUAA 1MFZA 2IZ0A 4GI2A 4KZPA 4L9RA 1ISFA 4XYEA 3WWYA 4I9UA 2YZ7A 5GY7A 3ASUA 5T5QA 1ZMOA 1PWZA 1JKJA 3VH4A 4BQRA 4YJFB 2NUAA 1U3WA 3GUCA 2UVDA 4ZQEA 1Y8RB 3PWSA 1N2SA 3WXBA 3OEWA 1VPDA 4IS2A 4RVGA 3U4CA 5IJZA 3L6DA 4F3YA 1LSOA 3JYOA 2O4UX 4L75A 3VOSA 1ADBA 4ALMA 2DC1A 3WGZA 4BNIA 2X86A 3D4NA 1PL6A 1E3EA 5G0TA 4IDDA 5A06A 3PVZA 3JTMA 1CETA 2WSBA 3I9JA 4GWKA 1LRJA 4JBIA 1U4OA 4OJNA 4XQEA 2HMSA 1G0OA 2AG8A 2Q50A 4YXFA 3VPGA 4OQYA 3ZWPA 3GG2A 3KLPX 2NTNA 3H9UA 4WCFB 2QX7A 1X1TA 1NFRA 3OJ0A 5EERA 1ZK0A 3KXDA 1A27A 1HZJA 4ALIA 2YQ5A 4CV0A 2UYYA 3ROPA 4RCVA 3PWZA 1N1EA 4FGSA 4Q3BA 3F1LA 4DVJA 2P9GA 1ZSNA 4LK3A 1BDBA 4NMHA 4WLUA 2PZMA 1UP4A 3UW3A 2X9VA 3KHUA 4FQ8A 4CV1A 3QWFA 4E4YA 2VZ9A 1FDUA 2EKPA 2YV3A 2Q4EA 3Q9UA 1C1DA 4R3NA 4IPTA 5K0ZA 3KYCB 4XEHA 1BRMA 1DXYA 1PZEA 3V2HA 5DP1A 5B1YA 2PKQP 4R5HA 3I9OA 1HLPA 4BKOA 3QVWA 4O6VA 1ONPA 2V6FA 3OECA
chains in the Genus database with same CATH superfamily
3ZIAD 4AN1A 1XRNA 4MICA 3V7FA 2DTXA 4U0KA 2X3FA 1QGYA 3DHWC 2I1QA 3L8GA 3PV0A 5DK6A 3I1JA 1OBVA 3MJEA 1BWPA 3NORA 5IXSA 1NBIA 4FB4A 2UUPA 1DWOA 3I05A 5EWMB 1P2BA 3AVQA 3H97A 4D4GA 1Y81A 4N5MA 1PFQA 5B1HA 1FW6A 2PSFA 3K16A 1WPRA 4KZKA 1H4QA 3AC0A 4UOZA 4BO8A 3TUIC 4G4IA 4CM5A 3SZGA 5KYXA 4TT3A 1W1IA 5KSWB 1W5SA 2W2NA 2XGOA 2YX1A 1XMXA 2ZJAA 3IHLA 3OD5A 4NX2A 3SYRA 3AIMA 4D9KA 2QE7A 1W25A 2P68A 2NP6A 4YUAA 3JQ8B 5IZ4A 1MAVA 3A3KA 1TM3E 4TTTS 1EXNA 2NU6A 1IZ9A 5CVEA 3VR6H 1Z4QA 5FPHA 3ESYA 3U4QA 1RXUA 1A5ZA 1JGTA 2Q6VA 2VJCA 2VRBA 5EN4A 4PN7A 4UBKA 1V5WA 3C7CB 4X9XA 1I7SB 1RWMA 4M0LA 1M1YB 3N86A 1JG2A 1DCFA 2QRMA 4Q1CA 3GUUA 2A5YB 2A3NA 2J7KA 5DB4A 3ZNNA 4DMRA 1PLLA 2Y1FA 3NGXA 1XU7A 3LXXA 1GQQA 1MLDA 1RAGA 1UFVA 3U4GA 4D9HA 1PYDA 3IA2A 3UT0A 2Y71A 4RV5A 3IQXA 3VYVA 5CDHA 2GCPA 2WJJA 5JJCA 2I2BA 1DADA 1B15A 1YR8A 3ZYZA 4NPCA 1LQTA 2CCKA 1Y3IA 2JVKA 3Q8WA 1QIIA 1IRIA 5T6BA 2IRWA 4ND3A 4NBTA 1V0JA 3UWMA 4QAQA 3GOHA 4C0WA 3G5UA 1J25A 4E31A 4UFNA 1ZK1A 3LHIA 3QLVA 4M8KA 4BP9A 4R0MA 1IOZA 4E5DA 5JU6A 4KWTA 3MINB 4MYRA 2Y6VA 1M0SA 1TKBA 3K0AA 3QLJA 4ZOLA 1QVRA 1X2EA 2WC1A 3L7IA 1XTRA 3PS9A 4MRSA 2BGJA 2WHRA 2P1ZA 3IO5A 4GT1A 4MS3A 1QUFA 3URKA 3I62A 3BERA 2XB4A 1OVMA 2IPNA 3K94A 5AKHA 2F3RA 2HIGA 2UYOA 3FFWA 4FEEA 2B8EA 2HOQA 1BO6A 3HGQA 5KQLA 2IH4A 1NRJB 3CNEA 1Q3KA 4CIYA 5BOSB 3F0TA 2AYXA 3GCGA 3MJCA 2VYFA 3PUIA 3H1FA 3ZXYA 3BTVA 1MAAA 3WRXC 1L7BA 5A03A 2ODTX 2C7OA 1DSSG 1KJIA 1L4YA 1NI3A 1UQRA 2J08A 3UB3A 1IYZA 4XWGA 3F2IA 3FNIA 1KZ6A 1NX6A 2ES4A 3FZQA 4MVJP 1H3NA 1HE2A 3TDMA 3SSOA 1QYVA 2ZW9A 2RGRA 4PAMA 2A84A 3LYLA 3FN4A 2C4WA 2GBFA 2RI6A 1V2GA 4HEA6 3V6LA 2Q5FA 3QPCA 3A27A 2JIZA 4HLUA 5ES3A 4DWOA 3QA3E 3N0VA 1R0KA 1Q1EA 1SBHA 2YCLA 2CGEA 5CLGA 2Y68A 1E1MA 2Y99A 3MBOA 3W5DA 5CM8B 2CD7A 4C78A 1SXPA 2R00C 2V03A 1CNFA 3W5IA 1BU8A 4EBFA 5CK5A 1J0BA 1O94A 5LQRA 1JAYA 4PYMA 2FYTA 4FB5A 1E5DA 3KEMA 2PMBA 2G4VA 1XZPA 3DE2X 4BV2A 5JFOA 4BX3A 3RLIA 3ILXA 1XKXA 4PS1A 5BORA 1GFIA 3AY7A 2JGDA 4DLVA 5CURA 1L7VC 3EGDA 5E2AA 1W73A 2TMDA 1ZZGA 1GIAA 5J1SB 2KMLA 3IBCA 3A2KA 5ALPA 5ILQA 3E9RA 4K6KA 4AWAA 4QASA 4CU5A 4EEKA 1IH8A 4KLCA 3HK2A 3C24A 4EUKA 2Y6UA 1FPMA 1B6SA 3QKIA 4HTFB 4RYLA 3HL0A 1NE7A 1TPZA 4DABA 4IWNA 2GM3A 5KB3A 3UA3A 1E7QA 2WP0A 1FQOA 1W76A 1TLLA 1UJCA 1VM6A 2D1FA 2EJVA 3E8SA 1KXJA 2KI5A 1EWVA 3M8KA 1BDHA 1Z4NA 2UYGA 3N0TA 5B1SA 2DH6A 4OX9Y 3IDOA 3D8HA 1JPUA 4IZOA 5HFJA 5I7HA 3AKZA 3HXOA 2BI4A 2I2WA 2GVNA 5E1MA 4D97A 3A9VA 1MHPA 4YI3A 3NIDB 1SR8A 2KJQA 2XRFA 3UWOA 3DV0B 3EVTA 1XLVA 1ZO8A 2WAAA 2Q2NA 1C8LA 3IODA 5ERYA 3WKBA 2DPGA 2I4OA 4HNAB 2QL5A 3W77A 1O0SA 3GARA 5EIBD 1D5WA 4BJ3A 4PLHA 2IEBA 4N3GA 1OX6A 5KTYA 1WCXA 2UUBB 1WMBA 2E87A 2XOEA 2HSGA 3S2SA 3HWX1 4HFMA 3N3AC 2D3TA 5EMMA 4AY3A 4JCCA 4OU4A 2ACKA 2CYCA 1CQJB 1R5BA 3GVHA 4IX9A 2XQFA 5H81A 2GM5A 1RW4A 3FCEA 3WB9A 2GT1A 1ESEA 1KORA 1L8OA 3AMVA 3DOOA 3U7QA 4C5BA 4EHIA 1IM8A 1EGAA 5EIWA 5HIIA 3HRIA 4AYXA 1V6SA 1VL1A 1CERA 1LZLA 3O8LA 5J4YA 3L82B 2IHBA 5GP1A 3KAJA 3OQPA 2HMVA 5H02A 4KH0A 1Y5LA 2J3QA 4LOKA 1FQKA 3LECA 4FFOA 4UE3S 1YQXA 3M5WA 1IJBA 1Y1PA 4YXWA 1W48A 1QS0A 1N5LA 2I71A 3MK31 3NHSA 4K9OA 1J6UA 3CUKA 1AXRA 2BL4A 2XE8A 3W3AD 2VJOA 3JQBC 2XEXA 3ZGNA 3CSUA 3EZNA 1DT5A 3AR9A 3DBHB 5HX7A 4WOKA 1U5BB 1ZCBA 1QSGA 1OC2A 4MIYA 1RRGA 5F51A 2OK7A 3EH2A 3Q7SA 4Q12A 4XRGA 4ZDJA 2NXCA 4KXUA 5T67A 1FB5A 1YR1A 1K2VN 1NW6A 2WKPA 2X8AA 2XVMA 1T9DA 2GPTA 1VMKA 1WDWB 2PV0A 3UT5B 4E1AA 5LQDA 2FVYA 1YACA 4CMEA 3T5CA 1HT3A 2BGMA 3DJYA 3DPIA 3FHLA 3NBMA 5H59A 4XEUA 2WD9A 5HBGA 3FYUA 5MDHA 4GH5A 5EMHA 1YVRA 1E3TA 2B61A 3G1UA 2WD8A 4C22A 1M2HA 3ZNOA 3RYHA 2XT9A 4CKWA 1C9NA 2W43A 5TVGA 1OGJA 2OYCA 1SZPA 2JJ2A 4ND8A 4MWCA 3M2PA 1SBIA 2NPIA 3ZE9A 4CPDA 4EH1A 4PWYA 2XGGA 1JAHA 3QU2A 4IKPA 5JSYA 1YJQA 2WRZA 4IV5A 2HF2A 1X7WB 3EA4A 5F2EA 5JQGB 3TF5A 2GD1O 1E94E 3KVNA 4HRYA 4ZREA 3RASA 4ZGWA 1GU0A 2Y0PA 2JGKA 5I8PA 5I7UA 4CEJA 2PZFA 2AR7A 2X0RA 5A2QA 5JBIA 4WOBA 1E9BA 1IBRA 4HXYA 4OI4A 4RSRA 2HA3A 2Q3EA 3OFND 4NESA 4HWPA 2VAPA 3K92A 1I2ZA 1OASA 2WFZA 4DMLA 4WZBA 3E23A 4D42A 1MJFA 2JZCA 2BFBA 3TRFA 1PSZA 2GPAA 1N8TA 4GYYA 3U7RA 2P9ZA 3A1UA 4HYYA 4L5YA 1FYEA 4FKBA 1YZNA 5TPZD 4CFYA 4JOCA 4K86A 3L1IA 1MTOA 1QWOA 3T7TA 5K20A 2J09A 4CF4A 2ZYWX 2JB9A 4GI5A 4P4TA 5EKTA 1O7JA 5CFOA 2I78A 5GV8A 4KAJA 4N5NA 5WRFA 3QU4A 1ZRNA 4YHBA 4GLJA 4CCAA 3AT1A 3B3QA 3C3JA 4LOLA 3BXEA 3NAZA 1N8SA 4KFRA 4BO0A 1SU7A 1IXSB 5DNDA 1W9HA 2ZJ8A 4N82A 1T43A 2QSZA 2ON6A 5DYWA 1YS7A 2QTVA 3G5LA 2AK2A 1Q0RA 2NQ8A 3DEHA 3OEHD 1Z5ZA 2VDQB 3RSOA 5J4LA 3I04M 1X6VA 3KBOA 1NBWB 1N6PA 5D6OA 3TD9A 5BMOA 1I7QB 1JAXA 2O8EB 3ESBA 4IRMA 4WOPA 2PGIA 2RHDA 4I4NA 4W1SA 4WVFA 4HEHA 4Y7DA 3RVSA 3VHRA 1FFEA 1WSDA 3ER6A 2E7ZA 3O8OB 2JJYA 3AERB 4IWXA 4RY0A 4KN5A 5EXPA 1K9SA 1Z2PX 4ENTA 1SUSA 5HWSA 4L15A 2VTBA 3UBTA 5BQ3A 5G2OA 4ESOA 3LHFA 3VC2A 4AU1A 1XEWX 3C1OA 3GEHA 3HEAA 3QV2A 3CUYA 4KXQA 4D3YA 5A04A 1Q3HA 4MP6A 1SB8A 5MGNA 1L1RA 2ZAOA 4KR6A 2HT1A 4IDCA 1OTYA 1SWWA 5F64A 3WO0A 3WLSA 5IBCA 5CP8A 4OUKX 1NWCA 1DZ3A 4C3VA 1OWOA 1N33B 1PJLA 2VDMB 3UEOA 4P2BA 1T3LA 3F9RA 3UJHA 4ASUA 2OO5A 5JLAA 3JR3A 2Y9PB 3C3AA 4TVBA 3SVZA 5HDQA 4DUPA 4UARA 1U7ZA 2F67A 4Q9NA 4R4JA 3WAKA 5KYTA 1TQ2A 2HCRA 1XI2A 2UYQA 3C4QA 3NNDA 1BCRB 4M6WB 3IJRA 4R7ZA 5AJXA 2WUEA 2MCFA 5KREA 1AK9A 2G06A 3OLQA 1IN5A 1HL3A 4G23A 4AKTA 1U3DA 1VRWA 1ZK2A 3FKSD 4PPGA 4QGBA 4XM2A 5EMKA 1AY0A 4TV8B 5MHTA 1DGQA 1J2TA 1ULTA 4M4SA 1K5PA 2Q5OA 1TZMA 2XECA 3PGA1 1QDEA 4RMJA 4A0FA 1WBBA 1NOIA 1QO0D 3HYLA 2HIAA 2QW1A 3I30X 3MWYW 4UFPA 3B1YA 3LW8A 4WZZA 3ORHA 2B4TO 4QYIB 1PVVA 1NPTO 2J9XB 4GL4A 4CL3A 2PX6A 3EARA 5K03A 2QG9A 4EX6A 1MIOA 3D6JA 1DBWA 4RD3A 4YCBA 3W8EA 5HKKA 2JVJA 4NOLA 4UNPA 5DGTA 1AUOA 1JSLA 1YRYE 5EJEA 3H83A 3PPVA 4CEIB 3GQBB 3V32A 2GN6A 4ARZB 3A04A 2J9ZB 2JLAA 1PV2A 3IO3A 3B20A 4L51A 4Z1MA 3GPBA 1SKBA 2VUTA 1TIPA 1KEZA 3HBAA 4HXGA 2X3YA 3OC0A 3FWNA 3T34A 2DFPA 2WKSA 4DCGA 4LY0A 4ABYA 5CEFA 1FQWA 4YQYA 5KWEA 3HGTA 3E70C 3ZQ4A 1WLSA 4PX5A 4RTOA 3CLUC 1EINA 4FWBA 2ANBA 1F2UB 1FFYA 2PGOA 1ML4A 3A9TA 2EQAA 2PUWA 3HR4A 3PQ6A 4XFKA 3OMLA 4QJ3A 1PK8A 1L5RA 4WZAE 3SJBA 2OCXA 4JUAA 1CDDA 1ABEA 1GU1A 3KZCA 5KX5F 2ZCVA 5LU9A 2IWHA 2GH1A 5BP7A 3CWCA 1BROA 1GUDA 5B6IA 1LS6A 1EM8A 3D8RA 4O0LA 5FL7D 3O8RA 1MPXA 2HHHB 1IY8A 3OOHA 4G0MA 1UMDA 3PUXA 1I30A 3B5EA 2ZRGA 2VNJA 5CNMA 1FRZA 4Z4IA 1CS0A 1NVBA 2VBIA 3HI4A 5MFPA 3Q3GE 1TUBA 2VF5X 2UUAB 1U8UA 2ZAYA 2FFHA 5C1OA 3FH0A 1TMYA 4H08A 3FG9A 4ND2A 4DLZA 3IDZA 1FBNA 1UFOA 4JEUA 1LNSA 4PG6A 2RGNC 4P0QB 3CWZA 3V4LA 1V8PA 1XDZA 4WK0B 3RVOA 1PQUA 1SXJE 2XUOA 1M34B 3GGOA 3FOBA 4N6NA 4XPZA 4ZARA 5B4VA 5I4KA 2BLLA 3EMKA 4KFUA 4FTWA 4OQ4A 2KE5A 3MTGA 4GXQA 3G0IA 2JJMA 4NMMA 5T57A 1D1PA 1GTSA 3M9WA 4D98A 3V3KA 4M8IA 2RH4A 1ONNA 4F6CA 2ORWA 5AW3A 3W2FA 3EC1A 1LGYA 3CH7A 1OXKB 4K0KB 4HJXA 5I5GA 2GZAA 5TQ0B 1Z5WA 1T4MA 1L5LA 4EELA 1BH2A 2APJA 1VE5A 3IIJA 1E1KA 4ZDWA 1UFQA 5AM0A 1NVTA 1IHUA 1RZUA 5E9JA 4BFXA 1WR8A 4G86A 3W1VA 1HTTA 1OR8A 1FFSA 3PDHA 3EYWA 3LCUA 3FNHA 2H57A 3GUYA 2QRGA 1BMQA 3AEQB 3CZ9A 3G88A 2VP6A 3K9QO 3MGBA 5TVKA 1Z6ZA 5IG2A 4CN9A 1GL7A 3C98A 4GLOA 4Y6PA 4FOTA 1JEQA 3O0DA 2OENG 2BBTA 1LWNA 1PL7A 3DR3A 2IODA 3K6KA 4YT8A 1FDRA 1X13A 1BE1A 1O8BA 3SICE 2IV3A 2VEOA 4DLSA 1TVCA 2WWXA 3UV7A 3FTNA 2O1WA 1XWFA 3JRNA 3AVOA 2R1TA 3B1KA 3OPXA 4MRVA 5ELXA 4S1OA 2QUIA 1F2TA 1R9MA 5F5XA 5ICGA 1LX6A 5SYNA 3OJXA 2XA2A 4C6TA 2JDIA 3N8DA 1GPLA 1A4UA 3K31A 3HFSA 2OP0A 5IH7A 1Y7PA 2NZXA 3PGJA 2ZULA 1DC3A 4IBOA 1SKQA 3QLUA 4K3VA 1T15A 1GRQA 3CV3A 3CZQA 4NYMR 3U16A 3BDIA 3NTQA 2EFJA 4TRJA 3BHIA 4UMDA 4D0NA 3IUJA 4I8DA 4XB2A 4Z53A 2HFKA 1DKNA 2HWUA 1C3EA 1ORTA 3HWWA 2DKNA 1J21A 2VBCA 1XAJA 4EPRA 4HQNA 4AM8A 1RACA 4Q15A 3CH4B 3GLFE 4JKIA 1EP9A 5AVQA 3RUAA 1LDMA 4X7BA 3KLMX 2VYVA 4XQGA 5EJFA 3V8VA 3EVCA 1E7WA 3R77A 4MWDA 4Q3AA 5GONB 4UVIA 1AN9A 3P0FA 1HQCA 1FFAA 1HBJA 1UDCA 3OPYA 5FPYA 3HNRA 1EUQA 2FUCA 4GOOD 3WJAA 2CFSA 2R9VA 3IXMA 3KYDA 4S35A 5K8LA 4XDHA 3TZ6A 1CQWA 2IYQA 2WJ4A 2YZGA 4LXHA 4XVRA 2WVHA 3QYAA 1ZI6A 1NONA 3LKVA 3B1JA 2O2ZA 3OZVA 1S2LA 2PZLA 2JFZA 2B4RO 4CKEB 1AKUA 2XIQA 1QFSA 3BZBA 2K7ZA 4L7VA 3LKBA 4RKEA 5KPDA 1JA1A 1FQJA 3OQVA 5KOHA 1SK8A 1DG1G 1MDBA 2G71A 3X1WA 1EK6A 5IJ9B 1W8DA 1E9AA 3MUEA 1JZQA 4AZVA 1EZ1A 1SXIA 4J7UA 2QMUA 1ZAYA 2G9UA 4Y6GB 4EDHA 2XI4A 1EFUA 5GGYA 2V0NA 4L22A 5IDYA 4F3CA 2O8BB 3H9QA 2O2EA 5FLXA 1X7ZA 2QN3A 3OQNA 5IAAA 4KQWA 1JLMA 2J8ZA 3M6MD 3PHHA 4FZVA 1TC2A 2GLTA 3DVQX 4GOXA 4TN1A 3W5HA 4BNKA 4D79A 2PO5A 4OLHA 4I4TF 1FFXA 3LBNA 2VNKA 3LOUA 1N2BA 3T1HB 2XRZA 4ZVUA 3ZHTA 2WE8A 4Z6KA 3VPBA 4HGNA 1LCIA 3H8SA 3BUSA 1I33A 4B6QA 1FTNA 1UKVY 3WWDA 3GI1A 3QP9A 2WYOA 4E07A 1KYTA 4W1PA 3B1ZA 4F11A 3B6ZA 1IK6A 3VYTB 1KQGA 3PXEA 4BNZA 3I2JA 1PIWA 4NK4A 5HFAA 2PZ8A 2FPRA 1Q5PA 2IHYA 3GZ4A 5KNDD 2WIDA 4P8RA 1G3RA 3WDKA 3K6SB 4NRDA 1X1CA 2QMEA 1N2ZA 1W4LA 2HK7A 3R3HA 1Z18A 1VCMA 4DNOA 5L9AA 5I47A 2PFKA 3LIIA 3PIIA 5KAPA 3AXSA 4DEYA 2QL9A 2WIAA 2XCSB 3KJNA 3EPLA 1MEEA 2BOVA 3NAMA 1Q7TA 1NURA 2ENUA 4QGGA 3AEUB 3GRFA 2OCDA 1YWGO 1B2LA 2AR9A 3MTBA 3OPMA 4FEYA 2WWWA 1SY7A 1KAQA 2PN1A 5DGXA 1GM5A 2OPHA 3V3TA 3L7YA 4G5RA 1DIOB 2O06A 3JXEA 4B17A 4AULA 4DDTA 4HQ6A 5LMNB 4PTZA 3VXKA 2BF7A 4TMYA 2YWJA 3EEIA 4LGCA 1HMYA 2HU7A 1JR3D 3H1GA 4F5WA 5I4BA 3RSZA 1DUSA 4ZYZA 1SBZA 1Z0AA 2QV7A 5E4TA 3IUPA 4M9UA 1DAMA 3ZCXA 5ALSA 1XDGA 3IHTA 5KMGA 4BFZA 4G1VA 1INLA 5CA0B 2RARA 4RA9A 9ABPA 3CJTA 4MRAA 2YHAA 2H52A 5FIUA 3GRAA 4XIFA 5EIOA 5K0LA 3DDZX 1PI3A 2ISCA 5FAXA 1JHYA 1E3JA 2O1EA 4M9QA 4GKJB 3RKSA 3LHKA 2QTLA 2ZBPA 3IPAA 4PZZA 1ARZA 2PIDA 1LXCA 2C54A 1V6AA 2DSTA 2ZSKA 3DEKA 4LZOA 4IXDA 4OYHA 1X1AA 2B1GA 3WK8A 4DW8A 4B3MB 3PPXA 3IAXA 2VPPA 2ZDQA 3CG4A 4FBGA 2J4FA 4Q1EA 5A5GA 4LC9A 1P45A 1HI9A 2AXQA 5AJHA 1L7PA 5FT9A 5IF3A 3U61B 1GRVA 1U4SA 1U0BB 2P9YA 2GAOA 3IUMA 3V4FA 5DI9A 1WQ1R 3EFBA 2OE2A 2ZANA 3HRHA 1H2HA 1R5OA 1KVQA 2G09A 2IYYA 2UDPA 3MTQA 4BVKA 3OD1A 2R7NA 3HCCA 1KEEB 4Y2UA 2ORIA 4Q0MA 1VCHA 1NHGA 2YJNA 3ELBA 3E5MA 1TVKA 5CLIA 4AMZA 2R4QA 4FSXA 1P44A 3T5BA 1VRCA 1P9WA 3A6FA 3JQ6A 5AVSA 2UVQA 3K4HA 1AA6A 2NNLD 3AFNA 1I0IA 4QDZA 4U9HS 2QOEA 1DG9A 4MJXA 4WKGA 4KI7A 4AKIA 1CR2A 2WI8A 3AUKA 4NHEA 5B3JC 3T8YA 1JXMA 4YMHA 1XTTA 1W5TA 1UODA 4J8PA 4QVGA 5D5PA 3TECE 1UEIA 1G2QA 1KS9A 1G41A 3TJZA 4B31A 5JSKA 4DUYB 1RCFA 3SR3A 2VT6A 1JV2B 2I03A 4WN9B 1KYQA 2HA6A 4EECA 1N2CE 4EYSA 4F86A 3VZQA 2HTFA 1L5ZA 3CZMA 1ZESA 2D4HA 3AUSA 1UOOA 2R86A 2EFCB 1QANA 5LD2C 2C2GA 4X71A 3OA0A 4DXAA 2CNNA 3HS3A 2PM8A 4D8XA 5SZHB 3C16C 2P6OA 1KYVA 4DZRA 4E7OA 1SVNA 3C6MA 3WNCA 1REQA 3GXOA 1E1RD 4RCZA 4ID9A 5K3FB 2ZJ6A 4YP0A 2EVWX 4D9JA 3EXAA 4D9IA 2JFFA 2WUVA 4X8HA 2BTOA 3FDJA 3R8CA 4AJKA 1XELA 1X7XA 1D2GA 4QUBA 4UHKA 5ERGB 4C4TA 1GQRA 1CF4A 1EE1A 1OA1A 2ZJBA 1KJQA 2FWPA 3FROA 3OG9A 2BGIA 1XTUA 2P77A 4IZ6A 4Q39A 2VOJA 3TD6A 3UN1A 1U8ZA 1QE3A 3OJLA 4P33A 5HCNA 4URVR 2EC5A 3PFWO 1U8EA 2EW2A 2XLCA 3RQIA 5IF9A 4C2TA 1KQPA 4DG5A 5JZOA 3BMQB 2QHXA 3BAFA 3ON5A 5B3LA 3D59A 2I3GA 4RPCA 4HXFB 1XZGA 2NVOA 1KYZA 4I5EA 3QX3A 3UC5A 4RIHA 4JFAA 4G1MB 3K70B 2OB2A 1R6TA 1S3FA 2REOA 1SCKA 5K09A 3R5FA 4FR2A 3RJ9A 2I6SA 4DLWA 3JQQA 4DDHA 4JL5A 3NPMA 3GA7A 4ZU3A 3D54D 4A7PA 4QPJC 4J0FA 4DA9A 1HT1E 3NKVA 2KHZA 1ODLA 3SFTA 2NUAB 3L6RA 4X54A 3ZV6A 4B2PA 2YXBA 2IUSA 1P7PA 5E6RB 1DG3A 2QAGB 3PWKA 3ECAA 4WEQA 3ACBA 1EBUA 4ZOCA 3EXG2 4EUNA 4AL4A 1A71A 5JR3A 2B83A 3KEGA 4PGGA 1ISMA 2H2GA 2RH5A 4KLAA 1LK7A 2CFIA 1M2GA 1Q17A 3FUXA 2NM0A 3RBVA 3UA4A 3VSCA 4U2EA 1JJAA 1TRKA 1LK5A 2X13A 1AHIA 4IYJA 4US0R 1JIXA 1UBGA 2XZPA 4HDKA 3W2TA 1I36A 5DKFA 3GGSA 3PTZA 2GM4A 1XLWA 5LJLA 2NXNA 2WUFA 3OZ7A 1NW3A 2AFIE 5L3QA 5LMUB 2V9ZA 2VNSA 3KUCA 4KPUB 3QE3A 4E1VA 1OKKA 3PYXA 4LFCB 3Q4GA 4E5PA 1QGAA 1W88A 3DCNA 5DDIP 2CNDA 3UF0A 3WGGA 1Y6GA 4OMUA 1X39A 3ISJA 1K63A 3TAUA 4C4PA 5A05A 3EDOA 3GHHA 5JFTA 1PL8A 5KVAA 3BIXA 2EDAA 3TRIA 4YFVA 1KGDA 5IW8A 1PDWA 1HE5A 3HI6A 4V0RA 5FQOA 4CG3A 4JP2A 3ODPA 4MYHA 4UHFA 4WJLA 4QUIA 2QIOA 2XMCA 1AV7A 3WQRA 1UMKA 3VYUB 3FA2A 1LRLA 3AO0B 3BTUA 4KQ6A 2ZJ0A 1Q15A 4E3WA 1YCFA 4C3UA 2Y1CA 1JNXX 3ZLVA 1WDMA 4ZOEA 3QELB 3ASYA 1VPWA 5AKXA 4C0LA 5FV4A 1PNRA 3MOGA 3L8MA 2RMKA 4KIJA 1UT8A 3I3OA 5J4HA 2A30A 4M60A 1JSRA 1LI5A 4I6JA 3O9ZA 5BR7A 4A73A 4WACA 1OVGA 4KMOA 2ZKIA 1ZOOA 1QLJA 4MS1B 1K5DA 4FYKA 4LC1A 5EMLA 4AY4A 4GLLA 4HDOB 4U8HA 2GXQA 2C07A 4PS0A 1RYYA 4BU0A 2XCQA 3C85A 1USIA 3EUEA 1GCIA 1NUHA 2OZLA 2ZE8A 1GL9B 3NXSA 3OZWA 4WN3A 2BYTA 1N4DA 2OG1A 1ZXXA 2J9FA 1CUHA 2FGKA 4I50B 2MOKA 2Z30A 3SLGA 1XCBA 4CXMA 3N7UA 1LDBA 2GF2A 3BK1A 4HH4A 2XGMA 4B80A 3NHUA 2WY2D 3EPHA 1QIHA 4PLYA 1DC4A 1XXLA 2OV4A 1A2BA 1A8UA 2BJWA 3ZHRA 3OM8A 1Q1NA 2BJHA 2H7CA 1W2WB 4J49A 1GV1A 2JD2A 3QBVA 4QOHA 3SQWA 3HNOA 4QNRA 4GDFA 3GGJA 2LZ0A 3QA9A 4IMPA 3LC1O 1IUOA 2ZJFA 2EIXA 3EFOB 4P7GA 3N70A 5FOTA 3V7YA 1MG5A 4DCCA 4QM6A 1I6WA 3HCNA 2IXTA 3R24A 4LJ9A 2Z6AA 5ECDA 1J8VA 3A2LA 1QP4A 2VP9A 1H3FA 4ZYXA 4QELA 4CMHA 5J47A 1FUEA 4B7CA 3JYNA 3OOSA 3ONFA 4EW6A 1EP2B 3K2EA 2EXXA 1LC3A 3V4RA 2FRVA 2VDLB 1BQEA 1Q20A 3P0RA 3L02A 4R2XA 4UREA 4HV4A 1WSWA 3DZKA 2D0OB 3WIVA 5GINE 1DKPA 1NX9A 2GN4A 4B3DA 2KBEA 1FUYB 1KK3A 5HE9A 2QSYA 3QV1A 4LF9B 2BGKA 3JQGB 2I4MA 3I2IA 4CQMD 4U00A 2O6HA 2FUNB 1TAHA 2C4KA 1DARA 3UJ8A 1CUEA 2CLEB 2R6JA 4QGFA 2HBRA 3TZQA 1H0HA 3KL4A 1AMNA 2PSSA 1M8JA 1R66A 3TR6A 1XNRB 1JBQA 1P0MA 2P1DA 4K6GA 5K3AA 3HO8A 2I6TA 4PSCA 5TPWA 2MR6A 2EERA 4NJOA 4BFSA 4BUZA 3GPDG 6PFKA 4HZIA 3MS4A 3UK6A 1T6XA 3K8YA 4ALKA 1WW2A 2YHUA 3UPUA 5FUBA 2PVSA 3UJDA 3ROXA 4CWAA 2J7PD 4F3RA 1VJRA 2AOUA 4Y2YA 1M6NA 2V3WA 1MMFB 1QAQA 3DWFA 1OFUA 3AJ9A 3ENVA 3RFVA 4AX4A 1YBFA 3S2GA 4IG4A 3TOSA 3PXCX 1MTZA 2PT9A 3GC6A 3KJFA 4GPTA 1T5OA 5TC4A 4WPGA 3UCFA 5FI1B 1EAYA 2J5KA 3FHJA 1R0WA 3RS7A 5AI5A 5GAJA 1OFHA 3ABQB 2BMDA 1C0EA 3DBIA 4NBVA 3DE5X 1E3WA 2W2KA 3OTQA 1AUPA 2C5HA 4B6EA 3MBIA 3UMYA 1CJMA 4X7MA 5T64A 2QRZA 2HQ1A 2JI4A 4K88A 1XAHA 4QPCA 1UEJA 4TMZA 1E32A 1JH9A 2YWDA 3FSEA 3ICQB 5L40A 2NU9B 1S8FA 1B93A 1FFCA 1WF6A 1H4TA 3CLKA 3KR0A 5CDFA 1YE3A 2W70A 2IW1A 3G5TA 5FPKA 5KC9A 4B6FA 5T7BA 1LLCA 3P45A 2EYUA 3ZG6A 2E0IA 2ZSHA 1SHUX 1HFKA 1FDTA 2A9FA 1TCAA 1XYGA 3N9IA 1ZUIA 1XMIA 2VTEA 3ZS8A 2A6PA 2C84A 4Q4JA 4IQGA 2NVUA 5EHXA 3A3OA 4YMTA 2VR1A 3BEDA 4WERA 3KJQA 1PHPA 3QH4A 1SCIA 1JI3A 3SQOA 2Q9AA 3RK0A 3LLVA 4DLRA 2QD4A 3GRVA 3HA5A 1BHO1 1CHNA 2BE7A 1BNCA 5AUQA 1BEUB 5CT8A 1KWGA 4G5SA 2CMDA 3PNVA 1NXWA 3CNLA 1VFNA 4K9QA 4FI3C 1QZZA 2JANA 1NR7A 2CXHA 3VU3A 4DIBA 5LP6B 3CGGA 2A4KA 3DBVO 3ZR4B 1R10A 3OTHA 5H4GA 4H3KB 1KZ7B 1CUUA 4YRBA 2CJWA 3RK1A 2JI8A 3ZK7A 5BN3B 3PL5A 3W8FA 4LKRA 5JYBA 1I4DD 1M9NA 4MGYR 4OI0A 3PJDA 5LXTA 2W6MA 3OIYA 1YDMA 3ZH2A 2HA4A 2XAAA 2PKYX 4UEKA 5EZ5A 4MRRA 1IM5A 1RM0A 1XXHB 2GBIA 3VOTA 2QQ5A 5C5IA 1MHTA 5CCDA 3C15C 2CVQA 2NO5A 4GI3A 4M0KA 1JEOA 3W6NA 4C6SA 4PHCA 4BYMA 3DKRA 2QDKA 3HKDB 1A9YA 1GA1A 1TYBE 1UBJS 4H1TA 1YK1A 4LYAA 4YUXA 2GASA 3BWEA 2GHIA 4AUEA 4R2WA 1VJDA 1F0NA 1N9KA 2HSEA 1TD1A 3B1WA 5JNLA 4MR8A 1THZA 3O1HB 4Y67A 3SMVA 4JGBA 4YEDA 1UJ5A 1EGMB 5JNWA 5DP2A 2D2EA 3B6EA 2R8PA 5BW8A 2PVPA 4MVJH 2A7QA 3CLSC 4MB2A 3D3WB 1DKRA 1N0UA 3R3XA 4R6WA 3RVJA 2POQX 3H7AA 3MMNA 1KYYA 4O8ZA 4BKUA 1U1EA 1HDEA 3KJIA 3MCVA 5TV2A 3OUUA 5LQAA 1Z2NX 2E49A 4H9GA 1IC6A 1OFIA 5TR9A 3TPCA 2Y0BA 3DO8A 4WFKA 3BWXA 3W7VA 5ALEA 1L4KA 2WYWA 4JOBA 3PQDA 3VISA 2QT1A 2GI4A 1L1EA 3GUVA 4HAIA 4BNTA 1IPFA 1CT9A 1Z0KA 4BP1A 3OAAA 3CRMA 1FOEB 4OHKA 3VKUA 4BUJA 5ICFA 2QIPA 2XTZA 3DMHA 5B1IA 1UM9A 4DGSA 3KOXA 1X8KA 3PUWA 3EGOA 4JUIA 1O97C 5AQEA 3T4EA 1MORA 4J0DA 4RA6A 2VPZA 5F73A 2OC4A 3RANA 1V5IA 1XLTC 2Q4DA 1JHOA 3ETJA 2PSDA 2ZBFA 4C7OB 4R3WA 4YACA 3MUFA 1Z5PA 2X9LA 5HXAA 2D00A 3GJ4A 5ARBA 5DHPA 5CB8A 5DWVA 2WAXA 1MW8X 4JSTA 1HDZA 1P31A 4P3NA 2JIQA 2NOAA 1TJ5A 2DY0A 2ZYVX 2G0AA 1DV1A 4OI2A 4WNYA 3V4VB 1LBQA 2B78A 4MWGA 1QF7A 1BMFA 3DFKA 1A0OA 4HN4B 1HDRA 4P22A 1KTIA 4DBZA 1S89A 4FW8A 3CA8A 4WCVA 4C4SA 5IDQA 4F8YA 1ND5A 1PFKA 2IHTA 2DPMA 4IGAA 3B60A 3H04A 3KSBC 1H1TA 1T2EA 2ZB4A 2ZUSA 3ZHYA 1U4NA 2P0EA 3COPA 5I8ZA 4AMBA 3KVRA 5G3YA 2Q46A 2FQQA 1BHJA 4MQMA 1Y1LA 2WLSA 2IU0A 4Z5XA 1ZVQA 3EFEA 3Q6NA 5DGHA 1OBOA 2MJLA 3AESA 2AFRA 2P8JA 3GLQA 3V8QA 2PZAA 1J2JA 2PTGA 3MVEA 3VDXA 3D6HA 5LZ8A 4JXKA 4AP6A 1ZD8A 2HX1A 2Q5IA 2W2MA 1I3MA 3HDQA 3IV9A 3KU1A 1WCWA 4EO9A 2ZIZA 2H4WA 1Y6RA 4H16A 4LDRA 4GSYA 4ESEA 4E5SA 1WMAA 5BN1A 3WLPA 2VQ6A 5H3CA 1ZPDA 3WQBA 2IE0A 1BWRA 1Y98A 3UMMA 5JJKA 4GW3A 4AF7A 4Z7QB 4RK0A 3CR8A 1DAHA 1KJNA 3T3NA 3BRWD 1OLXA 5AH0A 1GZ6A 3USCS 1P6UA 4CM7A 1GP2A 1VMEA 2OV2A 4XM0A 4M1OA 4DJEC 1XKTA 4FPXA 3EQ7A 2IOFK 4GPBA 4IDEA 3RARA 3P71T 4C4XA 4ZDKA 3C3MA 2Q7OE 2B69A 4WWHA 3ZZ1A 2E4WA 1UBCA 1A5TA 2FN3A 4ZHQA 1YVUA 1KJZA 2O0HA 4Q03A 3L06A 4HB3A 4LSZA 2VTVA 1Z15A 4OKSA 4NE9A 4LJYA 3GDHA 3H0KA 3EDRA 1JG6A 3VDQA 2XGSA 1XJCA 4HGZA 2BBWA 2BTQA 4I6GA 4RBNA 1ULAA 2EL7A 4NU5A 4M9XA 3GZJA 1MC5A 2DEUA 3WLRA 1T4GA 1Z83A 2R1VA 4I46A 2B0JA 1O5OA 5KU7A 5CNIA 2G9VA 2OA0A 2Z98A 1EFPA 2IE8A 5SYAA 1IQRA 4O0MA 2PXHA 2IXFA 2TSYB 3ABSB 5L8VA 2W42A 1B1AA 3AFMA 1XJ0A 1MB3A 2RK3A 2WHQA 3AY0A 2AG6A 3H3XA 1PKEA 2QM3A 4I9HA 1KPGA 4HRAA 3R3VA 3GLGA 4PIPA 2GEFA 1XMJA 1E3SA 4IDBA 2XNDD 1G6KA 1OZGA 4ONEA 5AHRA 1W6RA 3EGIA 3OTWA 3ETHA 4KQKA 3ZCQA 3PUZA 2PJZA 5A1TA 4RPLA 1XCPA 3CUSA 1XDUA 3KJXA 3KT8A 3ZLBA 5T3YA 1XTPA 2B0CA 4I19A 2XBMA 1QIEA 3FPFA 1IDN1 1NVKA 1PW7A 5BNTA 2EARA 4AW9A 3PGVA 4HMOA 3FWHA 8GPBA 3IP8A 5TGTA 4ZIRB 3CE6A 4M1EA 2BMAA 1WW8A 3HUTA 4DQ0A 3CZ5A 1RMTA 1JN0A 1UKCA 2FFBA 4FEAA 3N05A 2C4VA 5B7QA 1M1YE 4WRRA 1HKHA 1R0RE 3S55A 3CU5A 1R4NB 1RBZA 2ZKLA 4Z1OA 5KSZA 1KA9H 1F3OA 4NCIA 1AUVA 3WLEA 1EMDA 4A6XA 1ZJ6A 2IS4A 4LHSA 2BEVA 2DUWA 3GK3A 1BN7A 2SCUA 1E2QA 4EGCB 1MCZA 2ONYA 1QVVA 3TZHA 2D74A 3KZVA 3AQ4A 3UCEA 5DF1A 1F7VA 1ZMBA 3T7AA 5BUCA 1C5KA 4OHUA 2EX4A 3C3BA 4J4BA 1NNLA 2M6LA 1KI6B 4PINA 4UNNA 4X61A 1NN5A 3BE6A 4GX5A 4ZVVA 3SNHA 2DCUA 5M29A 1S9DA 5BNZA 1PAUA 4ZEVA 4HQLA 2QT0A 2WHXA 3GJYA 5EKSA 5C7IO 5B5SA 5JI3E 3V1LA 4BQOA 3ZDFA 3ER8A 3OKFA 4XGRA 4EGJA 4QO8A 3ICEA 3CZPA 1Q0LA 3M5CA 4QUJA 4QBHA 3FSJX 2ZR0A 3DL0A 3HPQA 1U94A 2BGLA 5IZCA 1TO2E 1RHRA 5F5LA 1I6KA 3OZSA 3TGWA 3VR5D 1TO6A 4JLSA 5BQOA 5AW6A 1QF6A 3UC9A 4YJDA 1G3IA 1I7NA 2R87A 3BD9A 1US8A 4YJ3A 2O48X 1YKSA 1HXHA 1OZHA 5EJAA 3MRVA 3PDJA 5AXBA 3K0BA 2DE0X 3L0YA 4Y9RA 3NTLA 1D2CA 2YWFA 4IXNA 2Z08A 4YUWA 3A9RA 1E2DA 4IMRA 1CEQA 5UKDA 3WGNA 4DEVA 1XWWA 2G70A 1P6QA 3UOAB 1ADCA 1GZDA 3N2NA 4RK4A 1J1ZA 5DTIA 5D84A 3RS2A 2XQIA 1X9GA 3WLTA 4C4RA 5FULA 4DDWA 4FNMA 1VKOA 3BVPA 3RT1A 3AUYA 4FUQA 3FCOA 4E22A 4NAVA 1NY6A 2HYDA 4LUCA 4Q4HB 1L5NA 4OX9B 1ZWKA 1YS1X 4J75A 2BZ1A 2O6LA 5GZ1A 1ODIA 3ADPA 3P27A 1DC5A 3ONVA 3O8BA 1IVSA 1E9VA 2FWAA 3ZNPA 2UYCA 5AK5A 1Z3CA 1DX6A 1FSGA 2LXNA 3LO5A 4NZZA 4LF4B 4ZV9A 1M6EX 1JWAB 1IPHA 2I80A 3D5TA 4L3OA 3I9KA 3K2BA 1LZKA 2E4UA 4CTOA 1NF8A 3KQUA 3LUJA 3DEZA 5BV1A 3BK2A 5DTEA 2FMUA 2E4ZA 2O05A 2QTGA 2XYVA 3O2SB 3WMXA 4C2AA 4CM9D 4Z7JA 1ECBA 3QK7A 1S8NA 1DJQA 1F14A 1G8MA 1XU4A 2QG6A 4FEGA 1T4CB 4LISA 1SKYB 4PBRA 4Q3DA 4ZZIA 4EPWA 1GADO 4RHTA 4MVJM 1ST2A 2HLDA 3PE3A 4JB8A 4CT4B 5LKRA 4S05A 4S1NA 1AO0A 1YQTA 1K66A 4HNSA 5DOVA 3IHWA 1YU9A 1JZSA 1MW9X 1QHGA 4LI0A 2D1QA 4ERXA 4F7DA 2QVZX 1IEXA 1RAEA 4EB6B 1E2PA 2H51A 3WP0A 1A88A 3VZPA