5MDHA

Crystal structure of ternary complex of porcine cytoplasmic malate dehydrogenase alpha-ketomalonate and tnad at 2.4 angstroms resolution
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
333
structure length
333
Chain Sequence
SEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEEIAFKDLDVAILVGSMPRRDGMERKDLLKANVKIFKCQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTSDDVKNVIIWGNHSSTQYPDVNHAKVKLQAKEVGVYEAVKDDSWLKGEFITTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGIISDGNSYGVPDDLLYSFPVTIKDKTWKIVEGLPINDFSREKMDLTAKELAEEKETAFEFLSSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MALATE DEHYDROGENASE
publication title Structural basis of substrate specificity in malate dehydrogenases: crystal structure of a ternary complex of porcine cytoplasmic malate dehydrogenase, alpha-ketomalonate and tetrahydoNAD.
pubmed doi rcsb
source organism Sus scrofa
total genus 109
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 1998-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5mdhA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5mdhA02
4GMFA 3RBVA 1QLJA 1XDWA 3TZKA 1UAGA 2HLPA 1WDMA 1EVJA 3NDJA 4UEKA 3VAZA 3CMMA 4BO4A 1GYPA 1H2BA 3PEFA 1V3VA 5L51A 1WNTA 3WQSB 3GVCA 1DOHA 1KC3A 4MVJE 2E49A 3JQ7A 1QKIA 3E8XA 3QW2A 1VL6A 4XGIA 2HK8A 3KSZO 4GPD1 2B4RO 1VJTA 4RL6A 4RPJA 4E4YA 2JHFA 3F5SA 4DUPA 1JA9A 3BMQB 1EBFA 3E03A 1EQ2A 4YAJA 4OQYA 1DRWA 4CM4A 3I4FA 1ZCJA 4D7AA 2HK7A 1OFGA 1ULSA 4GBJA 3QVOA 4CLXA 3DZKA 4NFYA 1ML3A 3ZU4A 1NPYA 1ZFNA 4DLLA 4N5LA 3PHLA 3RUHA 1MXFA 2I6TA 2GRAA 1XG5A 4Y6RA 4E12A 3QRWA 3JQCA 4N54A 5DP2A 4J43A 4C4OA 1BMDA 4OH1A 3RVDA 4E2ZA 2AXQA 1NBOA 5L3ZA 2VN8A 2QRJA 4JN6B 4S3MA 1C1DB 1B8VA 1YKFA 1ZBQA 3L6DA 4R5MA 1AHIA 4OAQA 4YJGB 2EJWA 4XR4A 5JY1A 3AUAA 5TS3A 3LSYA 3PWKA 5LCXA 1WZEA 1P44A 4OM8A 4TKLA 4LVUA 4CMEC 3TN7A 2FZEA 3ZWOA 1EK5A 4CM7A 1T1RA 1O6ZA 1XSEA 1HE5A 2EW8A 3ZV6A 3ASVA 4TZTA 1P1RA 4J0EA 1IB6A 5AYVA 3GG2A 3VH2A 3R3SA 1J6UA 1ZK3A 4GWKA 2D1YA 1DIRA 1EVZA 1LU9A 1JKFA 3TOZA 1B2LA 1GL3A 4MJLA 1XWFA 2W90A 1A7KA 3MJSA 2BD0A 1LRJA 2V6BA 4FCCA 1JAYA 3IDSA 4M86A 1ZO8A 5JCJD 2NVWA 3HNPA 2ZJ1A 3WYCA 1Q0HA 5LDHA 4B3IA 2EWMA 2AQKA 4P4NA 1KVQA 1JN0A 2GUGA 1YJ8A 2B5VA 4DRYA 2NADA 5GZ6A 4BB5A 2OP1A 1ZNQO 2WYUA 3ZHZA 2P5YA 3H8VA 4Z9FA 2ZB7A 5CDUA 1UDBA 4YWJA 4OO3A 3VC7A 1LX6A 4ZQBA 4AJNA 3ASUA 3H9JA 4BHTA 1XELA 1MXHA 1Y6JA 3U4DA 5ILGA 1NWCA 2PY6A 4JP3A 3DB2A 4XJSA 1PWZA 2C59A 3I9NA 4BMNA 1JDJA 3F4LA 4K1LA 5TLSA 3OQ6A 4HBGA 2QW8A 4B7XA 1E3SA 3AM4A 3OA0A 4E13A 4E5MA 3PZRA 4BNIA 5KJ1A 1XIVA 1I3NA 1R66A 2VOJA 1ZEMA 1I30A 3I6QA 4AJIA 2CDAA 4PG7A 2J3JA 3L07A 2H6EA 4RPKA 3D3WB 4AJKA 4PLZA 5BSFA 4M8SA 4XYLA 3I9LA 4JIGA 4RVDA 5IDQA 1JLLA 1NVMB 4N5MA 5C7LO 5EN4A 4CM3A 5I9MA 3G3EA 3WSWA 4E2YA 4H7PA 1U2DA 3D1LA 1ZSYA 1ONPA 5G4LA 3AUTA 3LQFA 3Q2IA 1U1IA 3IQDB 3R6DA 2H9IA 3PWSA 2G17A 1MB4A 1T2EA 1NAHA 5IG2A 5DCYA 1O95A 2HJSA 4PN3A 4WCDA 5JBIA 4PGFA 1BGVA 2X0NA 2X86A 4DIOA 4P38A 3PK0A 4QX6A 4E5YA 3L77A 4UVEA 2Q46A 4IIUA 3ZU2A 2YDYA 4JP2A 1LEHA 4IGFA 4YAEA 1WZIA 3FNHA 5F5NA 3RU7A 1X7GA 3ZWVA 4D46A 3GNTA 3ZWNA 4E3ZA 1Z45A 1E5LA 1N7HA 2VWGA 1IPEA 2YW9A 4J7XA 3RCBA 3ZN2A 5ER6A 4NPCA 3JQGB 3S2FA 2F1KA 3WYBA 4OIMA 3OHSX 5ICMA 1F14A 2PZJA 2C7GA 3GN1A 3ONEA 3MWDB 5IZCC 3QWFA 4FOSA 3W4KA 1ZIDA 1NHGA 2OORA 1NX6A 4L8VA 4GX5A 4R3NA 4AG3A 1GEGA 1YB1A 1MFZA 2GCGA 1ISIA 1R12A 3HSKA 4HFMA 3ROMA 4UAGA 1E7WA 4AL4A 1UJMA 2JAHA 3BA1A 1P45A 4GKBA 2PD3A 3GR6A 1K6XA 4PZDA 1H6AA 4WK6A 2VHWA 1ULUA 4HWKA 3DXFA 1QYWA 1N9GA 5ES3A 3C8MA 1ZMOA 4W82A 2X58A 3B20A 4CLHA 3HDJA 3HQ4O 4YVFA 3FBTA 3CPSA 1RJWA 2ZIZA 3DMYA 4OOFA 5EQDA 3I23A 3PRJA 1IULA 3GHYA 5KJCA 3O9ZA 4BNLA 5K6AC 1P1HA 3F5QA 4BMSA 1M2WA 3JQ8B 1ONOA 3WTBA 3DHYA 3N7UA 1R4NB 4FFLA 2NM0A 1EEHA 3OEWA 1E3EA 3ST7A 4CMBA 3Q9UA 1I2ZA 4W99A 4NR0A 1JKIA 2DTDA 3NJ4A 4FW8A 3P5SA 1YRLA 4O59O 2D4AA 2QYTA 1C1XA 2EP7A 4MVJI 4A73A 4BV8A 1UXHA 4TROA 2W2KA 3PJEA 4UUMA 4CUKA 4RO0A 3M1LA 1LSUA 4GLOA 3QE3A 1IL0A 3NAQA 4CM6A 4K6CA 4A10A 3DR3A 3K92A 4BS9A 3I52A 3H5RA 4CMGA 3WBBA 3OF2A 4CLOB 1BXGA 1MUUA 4BKRA 3JYLA 5TX7A 1ISJA 4BKQA 5JNLA 1WW8A 4WLFA 3ZHXA 2O7SA 4FSHA 4R1UA 3DBLA 4EUHA 4YAGA 5JMPA 1NPDA 2AEFA 3PQDA 3STHA 3DBVO 3KYDB 4CV1A 1PZGA 3OJLA 5EESA 2Q1SA 3WOHA 2Z1MA 3EHEA 4II2A 4RF4A 1O89A 1SOWA 4U6QA 3K5PA 2AE2A 1I10A 4UULA 2C5EA 1CIVA 4MVJP 4DC1A 3LC2O 3PFFA 5L40A 5COAA 3M1AA 4JLWA 2Z95A 4B4UA 4DPMA 1Q7BA 2Q45A 4J1QA 3GUYA 4KWIA 2VHZA 2DUWA 4IDCA 3OM9A 4DA9A 3D4PA 4HY3A 2Y66A 3WLFA 1HDOA 4HADA 5HWSA 1CQIA 3PLRA 5A3JA 3CUKA 4UVGA 4CQLA 3EVTA 3GAZA 3GGOA 3FHLA 1JTVA 3QWAA 1DFHA 2V65A 4ALIA 5TIIA 3WQRA 2O3RA 1G0OA 3MOGA 4Q3EA 4L75A 3TZ6A 3E18A 2IRWA 1SZJG 1ZK0A 2GO1A 2PGJA 4D0RA 2E4AA 5B4VA 5BR7A 1BVRA 3RC1A 3K96A 3BMNA 3C85A 1LDBA 2LDBA 3L6OO 4OSOA 1GPJA 2BFOA 3EW7A 2Y0EA 1LDEA 1EUCA 1BTOA 2JFFA 3KB6A 2WE8A 2TMDA 4BGIA 2GF2A 3K2EA 1KVRA 1E7MA 3GF4A 2Y1FA 4IXTA 3VPHA 4AVYA 2OP0A 1U8XX 1LBEA 2C54A 3MWEB 4HFNA 3S1LA 3UCEA 4CQMD 4DIFA 5HRUA 5THQA 3QWHA 1F0YA 5T8KC 1XEAA 4FB5A 4XYGA 1PGPA 1Q2XA 3Q3CA 4NK4A 3GEGA 1PJSA 3VTFA 4DXHA 4EDFA 3AW9A 2DFVA 4FC6A 2A9FA 4RCVA 4A0SA 1K89A 1YDEA 5AXDA 2OZPA 3G79A 4PG8A 2DTXA 4YT8A 1OC4A 1I3KA 4CV0A 5JAIA 1CWUA 1I3MA 4HXYA 4W6ZA 4FN4A 5JY6A 2VHXA 2DBQA 4XA8A 2YHIA 4F3YA 3X2FA 4N5NA 4U5QA 5IDXA 3NEPX 3QJ5A 2ZTLA 1KBZA 2B4TO 3IP1A 3VZRA 3ZWBA 3WFIA 3BTSA 3QQPA 5A02A 2O48X 4HP8A 4J7CA 4OJNA 2FPPA 3BTUA 3AFNA 4CPDA 1YXMA 3DMTC 1M6WA 3AI3A 3ICPA 2FY8A 3RUEA 2VT2A 4J4BA 5G0VA 1E7SA 2P4HX 4FBGA 3U62A 2O2YA 3JTMA 3WGHA 4EUFA 4TRMA 4RDHA 4YEDA 3HWRA 1P9LA 1YOVB 1Y8RA 1VL8A 2EF1A 2W8ZA 3NTRA 3E5MA 1H5QA 1SEPA 3KYCA 3T7CA 3ENKA 3LLSA 2P91A 3UGKA 1E3WB 3ZHBA 1EE2A 3G17A 1VKNA 3DAGA 3H2SA 5JLAA 4B4VA 3M2PA 1DHRA 3KTDA 3E48A 5TC4A 1ORRA 4MIEA 3X2EA 1E6WA 4HFJA 1YGYA 4YRAA 4WUVA 2PD4A 2Z5LA 3RBXA 3ROQA 1XU9A 2X5KO 2YQ5A 4X54A 5K9ZA 4IBOA 4A2CA 4GX1A 5CPFA 3PQEA 1U4SA 2W4QA 2PKQP 1IHXA 1DIGA 1KERA 3RU9A 3TWOA 1SAYA 3LC7O 3SX2A 4QUKA 3WSVA 5F1KA 1E77A 4ZJUA 4QECA 5DNAA 3Q9NA 1PGJA 3QIVA 5KWEA 4WCFA 3RFTA 4M49A 2Y93A 3SVTA 4YJFA 4CL8A 2PTGA 3O8QA 3ZU3A 4M55A 2X5JO 5A5EA 2OHXA 2D5AA 3PGJA 3TRIA 1HLPA 2IEBA 2GN9A 3B1JA 3F6YA 2PGLA 5HS6A 4BOYA 2GN6A 4KP7A 4E5NA 2HMWA 1ZKMA 5A03A 3H9QA 3S2EA 4FOOA 3MTJA 2IYOA 1PS0A 3PYLA 1DFIA 3PDJA 1PJ2A 1M66A 2H5LA 5JO0A 2PH3A 3D4OA 5T67A 1A5ZA 5BNFA 3QVTA 1P3DA 2WD7A 2X1HA 1DRVA 2QX7A 4KUGA 5DOZA 3JQBA 4LK3A 4BGUA 4CL3A 1PWXA 2IYPA 3WWYA 1N8KA 2BLLA 3OEYA 2X9GA 4U6SA 4YXFA 4CM9D 1V35A 4BNGA 3NYWA 1P77A 4E30A 3R3JA 4RDIA 3EUWA 3BZUA 4FS3A 4BGVA 1P0FA 2VYNA 1HDZA 4Z9YA 3EYWA 3UH1A 1B8PA 4YJHB 5JCXA 2ET6A 1E1KA 5B1YA 4BKUA 2BGLA 3VH1A 2Q4BA 3L0DA 2AQIA 3E9NA 3GDOA 4BO9A 3EC7A 3A4VA 4J9VA 1G6KA 3G1UA 4MIOA 3DZIA 1PSDA 2AHRA 2Q2WA 1I0ZA 4J1TA 2RAFA 3DDNA 2A35A 4OHUA 3SJ7A 4OMUA 1CRWG 2Y67A 3K30A 3D0OA 4NU6A 4XRGA 3U09A 4F6CA 4UREA 5FWNA 4I08A 4IPTA 3LT1A 4YACA 3RD5A 2FP4A 2C29D 3KZVA 2FSVA 4AJPA 1RM3A 1W4ZA 4GX0A 3H4VA 1WP4A 2Z1NA 3L9XA 1KVSA 4RF2A 1EK6A 2YZ7A 3EAGA 3TZQA 2X23A 2NU8A 5C37A 5HM8A 3ITKA 5LDGA 2WSBA 2FWMX 2UDPA 3LVFO 5TQVA 5G4KA 4NJOA 1HXHA 3JYPA 2NTJA 2J3IA 1PIWA 2ZATA 3MOIA 3OMLA 4IQ0A 1N1EA 3OJEA 1CJCA 1NVGA 4YQZA 3ZW9A 3GAFA 4EZBA 1YS4A 1UH5A 1QXSA 1UP4A 2HQ1A 1JWAB 2X5OA 3FNGA 4J4TA 1RKXA 1ISFA 5IDYA 3VDRA 2WDZA 4HX5A 3WR5A 1XGKA 3HDHA 3L4BC 5IDWA 2O23A 1U3UA 4BO3A 3OIDA 4WECA 4PZCA 2FMUA 4GVXA 3DONA 1E1LA 1P1FA 2CF6A 3PJGA 2BI8A 3WNQA 3RAJA 1T2DA 3ZWXA 2BI7A 2FPGA 2DPGA 5JW6A 5JE8A 5A3VA 3OIFA 1E1MA 3P2OA 1WVGA 3KOUA 1V3UA 2O4CA 2XXBA 2NVUB 2YY7A 4FFOA 4YAIA 3BHIA 1R4MA 1TT5B 5I9NA 1PZFA 5L53A 5KJEA 1QRRA 3ULKA 3NKLA 4RORA 4DMLA 2I65A 3UXYA 1Z82A 4NFHA 4IY1A 1E0DA 2VHVA 4U7WA 3DZHA 1XKQA 1PGOA 5A9SB 5I8WA 2V6MA 2LDXA 1DDOA 4QFCA 3S8MA 3KBOA 4DYDA 3JQFA 3TDKA 1UZLA 3V2UA 4U8GA 2B4QA 2DAPA 1WDKA 2R00A 2B0JA 3FR7A 3TFQA 1HWYA 4CR6A 1HDGO 2DVMA 3HUDA 3OFSA 1ISMA 2P9EA 3RIHA 1G0NA 1JVSA 2NU7A 2EHDA 3COSA 3AM5A 2EEZA 3H6KA 1SNYA 2DFDA 4J7UA 4KQXA 2PD6A 2DBVO 1ZXLA 3FF4A 4RZIA 2QRLA 3HB5X 3NDRA 5JXWA 3WS7A 5KJ6A 3WMXA 2EERA 4DQVA 4XRRA 4MVJG 1D1SA 3UOGA 3AOEA 1EFLA 4UVHA 1VE9A 3RKRA 3OICA 3I5MA 3H3FA 1E3LA 4CMIB 1X7DA 4W7HA 4LW8A 4FD3A 5L4NA 4XB2A 4K28A 3D5TA 4B3JA 3ROKA 2VNAA 4W9NA 2ZTUA 4MKXA 2P2SA 4DGSA 3D7LA 4IDAA 4MVJH 3T7EA 4IDEA 2V6FA 1ISGA 2HAEA 4RPLA 3PFWO 1GUZA 1PZEA 3VVCA 3JCZA 5K0ZA 3JYOA 4DTIA 3ITDA 5FI3A 1W6UA 2DT5A 3GLQA 5A9RA 4RGBA 4RF3A 3RUIA 1C0IA 4QSMA 3U3XA 3ZWYA 1T4DA 4O1MA 4R3WA 4WLNA 2JD0A 4B7UA 4BNXA 1EVIA 1KETA 1OZAA 4WNCA 5THKA 4YBZA 4ZVVA 1HSOA 2W2LA 3KUXA 4J90A 2AG8A 4R41A 1A7AA 1GV1A 2JFHA 3L6EA 4B8ZA 4PLVA 2DTEA 4MO2A 1DHTA 2WMDA 3N58A 4IS3A 4I5FA 2JAPA 4BGEA 1O8CA 4FFPA 1SCUA 1ZW1A 3ZW8A 1Y8QA 2HRZA 4I9HA 1XQ6A 4IQ8A 1M75A 2GN8A 2Y1OA 1XHLA 4KTTE 1HDXA 3H9UA 1J0XO 5DBGA 2WEKA 4RLHA 4L4RA 3U9LA 1IZ9A 4I9UA 6ADHA 1BW9B 1VRWA 4WPGA 3ADPA 1X15A 3TL3A 6LDHA 5L7TA 2EW2A 4ZHSA 2Y0CA 3M6IA 4HV4A 3B1KA 9LDBA 2PWZA 2Q2QA 2G82A 4WKGA 1S7CA 4OKIA 4CQMA 3F46A 1I33A 1FK8A 1BDBA 3EDMA 2ZYGA 4NIMA 3RI3A 4XYBA 2NTVA 3VZPA 1C0KA 3RC2A 4XQEA 5JDIA 3FN4A 4E5PA 2F00A 4BNYA 5J23A 4I8XA 4G65A 3RC7A 2EKPA 1E92A 1PS8A 3ZNPA 2B36A 1PJCA 1DPGA 5DCWA 4PLGA 4NJMA 2Q1UA 4RLSA 1Q0QA 3C1AA 4XIYA 3CKYA 3RBZA 2GPTA 1BVUA 5G4KB 3BMCA 1NNUA 3VZSA 3V1UA 5JMWA 2CVQA 5EL0A 5A05A 2PGDA 2G76A 4MP8A 4BVAA 3ZNNA 4WNIA 2EG9A 3FBGA 4FJ0A 2GZ3A 3CIFA 4NK5A 3ANLA 1H6CA 2C07A 4CLRB 4F45A 5GZ3A 1UDCA 4BV9A 4EW6A 3WGIA 4Q3BA 2CF5A 3GN2A 1QP8A 5DP1A 1O5IA 2OMEA 3LDHA 1FDUA 1GUYA 1OMOA 2AE1A 3KSDO 4TRJA 1GQQA 3JQAB 2G5CA 1GR0A 2FSSA 5IZ4A 3BTVA 2Q49A 5DBIA 4L9RA 4WJZA 5CP8A 3FWNA 4E2XA 5ITWA 3IOYA 1R0LA 4ND5A 4CJXA 1LA2A 2XXJA 2GN4A 1GY8A 4J2HA 2ZTVA 4WOJA 4QT0A 3ETDA 2VQ3A 2YFQA 4ALJA 4CUZA 1ADCA 3QWIA 2IXAA 5JPIA 4CR7A 3PYMA 1ADBA 1SB9A 4PVCA 4DQXA 1NQTA 1F8FA 3K2BA 5I7FA 3GMDA 3HN2A 2YHUA 2G1UA 4GAEA 4NBTA 4J49A 5JC1A 2BHLA 2J5KA 4YA6A 4XGKA 3ZV5A 1T2CA 3FWZA 5TGDA 3CINA 4EEXA 2BGMA 3LT2A 1FMCA 4F6LA 4E31A 3ZGYA 3Q11A 2DBZA 3H9GA 5DF1A 4JQCA 1WDLA 1ADFA 4GKVA 2JL1A 4HKTA 4R54A 3VZQA 3LT4A 1KVUA 4ALKA 2UUOA 3AI1A 3D4NA 1HLDA 5CEFA 2QRKA 4R9RA 5F3RA 3TJRA 5JSFA 4TQGA 4DVJA 1R6DA 1X0VA 3F3SA 5A9TA 4ALMA 2AQHA 3JQ7B 1LDYA 3QP9A 5FFFA 4E5KA 5GZ1A 4FGSA 1CYDA 2VZ9A 1UXGA 5EQFA 5G2OA 4YQYA 2Q1TA 4PG6A 1RM5A 4YRDA 5G0TA 2NV6A 4BB6A 4DYVA 4CMHA 2GDZA 1FDTA 4KQWA 1N7GA 2IZ1A 1ID1A 1H2HA 3GMSA 3DO5A 4CM4B 1QYCA 1C0LA 1GQ2A 1WMBA 1Z75A 3W8FA 3QLJA 2BKAA 5CFZA 2Q3EA 1U4OA 5FYDA 5DULA 2D59A 2WE7A 3C1OA 4ZRMA 2HJRA 3JQAD 4Y67A 2P68A 1Q7GA 4G81A 3P19A 4WLUA 3RWBA 3SLGA 3ZDFA 1J49A 3V5NA 3QV1A 1ZJZA 2CZCA 1YB4A 4NZ9A 1P1JA 2PA3A 1A4IA 1TVEA 4L0QA 1JW9B 4TRNA 4NBRA 3O26A 1FF9A 4JK3A 1AUPA 3R1IA 1HRDA 4LVCA 1I01A 3LU1A 2HU2A 4BNFA 4UEOA 1E7RA 4C7KA 4IZIA 2NUAA 5BT9A 4I5GA 4PLFA 1HE2A 4II3A 3P2YA 1LI4A 3WWZA 4L4XA 5A1TA 2A94A 1H93A 1I3LA 3KLPX 1CF2O 1PEDA 4WLEA 2AG5A 3E82A 1CERA 4IJVA 3SEFA 1PL8A 4ONEA 4U0KA 4BNNA 2BFMA 4OGWA 1YL5A 2VUSA 2OBYA 1K2WA 4BNTA 2AEMA 4XQGA 3LK7A 1DRUA 3OECA 3V2HA 2RBEA 3GY0A 3L9WA 5EPOA 4BNZA 5IN4A 4XKJA 5JO9A 5IF3A 4IIVA 2NACA 5JDCA 1ZK1A 3ORFA 3INRA 3IC5A 3SLKA 5KJFA 2UYYA 5KKAA 2AQ8A 4XYEA 3PPIA 4ILKA 1NYTA 1U7HA 4DBVO 1Y5RA 1NFRA 3GPDG 1A9ZA 1UZMA 1JU9A 3DFUA 3PHJA 3KEOA 1U5CA 4NMHA 1UUFA 2CUKA 4Y6PA 1ZZEA 5A5FA 1EZ4A 1GZ6A 3KETA 1B14A 5I7VA 1HF3A 1PS9A 2QHXA 2Y1DA 3O38A 4XQ9A 3PIDA 3CEAA 3NV9A 4MVJA 1H0KA 2X6TA 5C7OO 1E6EA 2A4KA 2VOEA 3KSUA 1MV8A 4FFMA 2Y1GA 4ZU3A 2YJZA 3OQ1A 2WM3A 3GVHA 1PL6A 2FR0A 1DJQA 1EDOA 1X1TA 2BGKA 2CDCA 1K5HA 3NGLA 4R9SA 5CDSA 3QA9A 3BHJA 1DC3A 3QSGA 3AM3A 3JQEA 4N18A 1SEVA 1M6HA 3FTNA 3Q1LA 4P4GA 1SBYA 2NSDA 2VWHA 4QO8A 1U5AA 3RFXA 1PJ4A 4WASA 3F9IA 4MVJF 4U0JA 5L45A 4OXYA 4KWHA 3DZFA 3F4BA 4BO5A 5T5QA 3PXXA 3AY3A 1G1AA 2CY0A 4JXKA 1T25A 1WXDA 2DBRA 2H63A 2PKRA 4O6VA 3DEYX 3WQQA 1RWBA 3OJFA 3GEDA 3PLNA 1CETA 1EVYA 3FNFA 2FZWA 2OXIA 5U1PA 2O7QA 3SXPA 1GD1O 5EINA 5KTKA 4Y6SA 3UW3A 5IJZA 4AJ4A 2EV9A 3E6AA 1WAMA 2BH9A 2AW5A 5H82A 3ZI0A 3JYNA 3CTMA 3WNVA 4EBFA 2BFAA 3DBRA 3GDGA 3M2TA 4I9NA 2D5CA 4FR5A 4CUJA 1Y5MA 3WJAA 5EERA 3LT0A 2JCXA 4BNMA 1FXSA 1PQWA 1B26A 3ZV4A 3W8EA 2HRBA 4KTVE 3MJEA 3HDYA 4XEHA 2BELA 4XGNA 2GYYA 2PZLA 1KIFA 1YQGA 1AHHA 1X14A 4IDGA 7ADHA 4JBIA 2CD9A 3W6ZA 5TNXA 2BMAA 5I7SA 3ZV3A 1LDMA 3I3OA 1N2SA 4E32A 4DMMA 5ILOA 3SC6A 1LLCA 3FTPA 1PL7A 3W4JA 3WTCA 4OXKA 1TB4A 1HYEA 1HDYA 4RV9A 3NT5A 2H1SA 4RVHA 1N9GB 1PZHA 5DDIP 1VKOA 4ESOA 3CH6A 2IE0A 4AJLA 3GZNA 4RF5A 4R69A 4ZICA 2HKIA 1GZ3A 3GG9A 3N74A 4E6PA 4FGWA 5IFLA 3K8ZA 3ZWWA 1LQTA 1QMGA 5KVVA 3U5TA 2WJPA 4MKZA 4JJFA 4PIVA 4DPKA 4B8WA 1N5DA 1U9JA 5C7IO 2DLDA 3GUCA 4LMRA 1L1FA 4ROSA 1GUFA 3ABIA 1HETA 2PLAA 3HJAA 1ARZA 3A28A 3VDQA 3WGTA 2O3JA 1C1XB 3OP4A 4JBHA 4URFA 1R37A 5CPBA 1PX0A 2I76A 1U3TA 2VRBA 2W2KB 1SPXA 3OJ0A 4TVOA 1K3TA 1DLIA 1Q0LA 1KC1A 1TLTA 4DBZA 5EJ2A 1UXIA 3WGZA 5CG2A 5DOVA 3RSHA 1YJQA 4I5EA 4Z0HO 3NX4A 3W4IA 3ZU5A 5AQ1A 4KMSA 3EY4A 1BXGB 1EMDA 3PQFA 3U4IA 2UVDA 3DHEA 1DIHA 2OUIA 4PLWA 2PH5A 5HA5A 3A1NA 2QZZA 3NT4A 3DBLB 1D1TA 1QYVA 3RUFA 1DO8A 2UAGA 3HFGA 5G0SA 3DC2A 4BIIA 3VHRA 1VLLA 2JFGA 4K9DA 5F1OA 1QYDA 3EMKA 5JCJA 4K6FA 3UN1A 4J4HA 3RFVA 4YYZA 3WFJA 3OETA 4DIBA 2P5UA 4R1TA 4CMCA 2CVOA 1D4FA 4EJ0A 2NTNA 2ZB8A 3BMQA 3JD0A 4AJ1A 1OAAA 1LLUA 4LSMA 4AJEA 1C14A 2FOIA 1MG0A 2IEDA 5MGBA 2IDZA 1V6AA 2VUUA 3MTGA 1B16A 3KVOA 1OOEA 4GI2A 4DC0A 4IINA 4J16A 4CQLB 3JQ9A 5LC1A 4MPDA 3HADA 3GVIA 2V7PA 3H5NA 1ZJYA 3OH8A 4O5OA 2NWQA 2J3HA 3UCXA 5KKCA 2P9GA 4RVUA 3TQHA 4RPGA 4ZN6A 1EDZA 1U3VA 4TRRA 1LNQA 9LDTA 3NJ8A 1PR3A 2PKQO 1IY8A 4YJGA 4CM8A 1LUAA 4Y8VA 3BMNB 2J8ZA 2B5WA 2OFPA 1J5PA 1LDGA 1YBAA 2ZKLA 1AGNA 3K73O 1WWKA 3VVBA 2ZYDA 1BSVA 4O0LA 4DLAA 1PQUA 3T4EA 1LSJA 1NAIA 4LSWA 3W1VA 1NVTA 2EGHA 1YDWA 3OBBA 2DQ4A 4OSPA 3ZWAA 1HEUA 3TOXA 1FDVA 1PJBA 3TPCA 1E3JA 4E2WA 1YB5A 2O50A 3BMOA 1V3TA 1UZNA 3RQSA 1ZXBA 3RJ9A 1PJTA 3TF5A 5DCUA 4JJIA 1LXCA 3DZGA 2IODA 1RPNA 2R6JA 4WCFC 5GY7A 2HMSA 4LMPA 5CDGA 3PVZA 2OOSA 2OGUA 3G0OA 1YONA 3PHHA 1NWHA 5FI5A 1YO6A 3V1YA 2RH8A 2EXXA 2J3KA 1DIAA 4B7CA 1KS9A 2V6GA 5CDYA 2CMDA 1AN9A 3FRJA 5A4DA 4FC7A 1GDHA 2YHIB 1TA4A 5JYEA 3ETGA 4IZHA 5AXCA 1PJ3A 1I36A 3E1KA 4DPLA 3UCFA 4Z3KA 1DXYA 4J0FA 3BIOA 3MZ0A 2C2YA 2BRUA 4ZQEA 3PGXA 4R51A 4GSKA 3FR8A 5CEJA 3ZNOA 1T2FA 4XD2A 3QWBA 3VH3A 5JAZA 2YUTA 2QG4A 4YR9A 3S55A 3JQBC 2ZQYA 4JJGA 4PZEA 2I67A 3MJ4A 2VZ0A 3KO8A 3INGA 2CDBA 3PJFA 3R0IA 5A04A 2Y0DA 2JCYA 4UEJA 3PHGA 4HFRA 2Y68A 3HDQA 4FJ1A 4PFJA 4GLLA 3GC6A 1Y8RB 1Y81A 3WYEA 4BMVA 1Q7CA 1F17A 4D3FA 3ZH2A 4D3DA 3KYCB 4M1QA 3C7AA 3WMWA 2X0RA 3GK3A 1SMKA 3RASA 2GD1O 1T24A 2JD1A 2QQ5A 5COQA 1DJNA 2RIRA 3HN7A 1QSGA 4P4LA 1C0PA 3GVXA 2VTDA 4KUHA 3PHIA 3RUCA 5FF9A 5U4QA 4CODB 1DSSG 5BSEA 1S6YA 1U7TA 3V2GA 4CMEA 4IGEA 3FPLA 2X9NA 2C7VA 3JQ6A 3DTYA 2PR2A 3KV3O 3O03A 1HT0A 3GEMA 5TT1A 1MX3A 3GGGA 3ONDA 5H83A 4CMKA 1Z6ZA 1Q1NA 3ICCA 1N1GA 5HS4A 3B70A 1HE3A 4NDNE 1EFKA 3H9EO 4TSKA 2RH4A 2CNBA 4MDHA 2B69A 1K6IA 3GH3A 4BNWA 3ROPA 1O9BA 4LGVA 1PTJA 2J5QA 3IUSA 5JAMA 3JYQA 1KEPA 4WCFB 3PWZA 3VTZA 1Y1PA 3PTZA 4AJHA 5IXSA 1HKUA 1SB8A 2JHGA 4IJUA 4KDEA 3O8QB 4YJFB 1WLYA 4J6FA 2X7HA 3JQGA 4IQGA 2IZZA 4WEQA 4M87A 3Q2KA 1KEUA 1P1KA 4YAKA 1ZVMA 2CFCA 1XA0A 1GV0A 1ZEJA 2O3QA 4LCEA 1D3AA 4XIJA 1Z7EA 4A26A 4BO7A 3LC1O 1XQ1A 3KM0A 4NNJA 4BKPA 4YPOA 2AEJA 5JS6A 1ZMTA 1VL0A 1GTMA 3QVWA 3D5QA 2A92A 5GMOA 3U4HA 1UXJA 3ZWMA 1EE9A 1TI7A 5EIOA 4CMJA 4UVIA 1ENZA 3I9MA 5TJ9A 4QO7A 4BO0A 3SBOA 2FPIA 3ZNQA 4CM5A 3AU9A 3E9MA 4AJ2A 1YQXA 1I5RA 1BRMA 2Y1EA 1M76A 2WD7B 3F1LA 4ND4A 5B12A 2C2XA 3RROA 3WJ7A 5ADHA 1X7HA 1Y7TA 5AXAA 2ZB4A 3I83A 2ZCVA 1X0XA 4IXWA 3WIDA 3JQ8A 4D41A 3EGOA 1R4NA 3GT0A 2EP5A 4R1NA 4Z0TA 4UUPA 4RVFA 4R4JA 3QVSA 5MDHA 2WTBA 1HSZA 4GSLA 3LF1A 3DWFA 4IMRA 3AWDA 4KOAA 1R15A 2D8AA 2O3UA 5JAQA 5KVSA 4RVSA 3WGOA 1IPFA 1CDOA 4D79A 3H3JA 3HZZA 4HUJA 3WGGA 3JD4A 4OQZA 3KYBA 4MIYA 1Y9AA 2VUTA 4CLDA 1PJQA 4NQZA 2HO5A 3DL2A 5BSHA 4YJDA 4XCVA 4JGBA 4RZHA 2VYVD 2QZ9A 3JQFC 3AU8A 4HNHA 4LRTB 2VRCD 4XB1A 3FNEA 2R00C 4EITA 1SC6A 2HMVA 2BF7A 3NT2A 4CLOA 2VHYA 1W0CA 1YBVA 2OO5A 3G1TA 4GMGA 1H6DA 2C20A 3BMOB 1EQUA 4INAA 1MGOA 1GCOA 3KYDA 1T2AA 1UDAA 2PZMA 3RUDA 1B8UA 1N92A 1NQ5A 1E6UA 3BHMA 3AOEC 3VPGA 3BXXA 2JKVA 1LLQA 2Q50A 3VPFA 5IZCA 1DEHA 1HYHA 2X8LA 3ADOA 1E1NA 5TF4A 1DAPA 1Z7BA 3A9WA 1M67A 1R0SA 1UAYA 4W9NC 1MG5A 2B37A 4C7JA 1GYRA 2O3SA 4G2NA 1UP7A 4YTEA 2GLXA 1DB3A 2NU9A 4DQUA 4ZQHA 4B4OA 4Z0PA 3D64A 3VPSA 1ONNA 4NHEA 2B35A 4D3SA 2VTEA 3UF0A 1HL3A 3NTQA 3ANMA 4E33A 3I9KA 3ETEA 3GGPA 3KHUA 5CDTA 1MC5A 3KXDA 2Q1WA 4H3VA 4CMAA 2VYND 5KCZA 3I1JA 4FJ2A 1LJ8A 4PRKA 4R1SA 3RKUA 3BTOA 1NPTO 5K6AA 4PLCA 1P1IA 4Q3DA 2WYVA 3IL2A 3TSCA 3C1TA 1NP3A 4IMPA 2YQ4A 5KOIA 3F47A 1C3VA 1R4MB 4EI2A 5BNTA 4XJTA 4ALNA 2J6IA 1XCBA 2XPCA 1NQAO 1GAEO 3HFSA 1DFGA 4XR9A 3DFZA 3FD8A 4A27A 1O94A 5L4SA 3W8DA 3JQDA 3DOJA 4DWVA 2POQX 1MLDA 4NU5A 1IUKA 4DL9A 4EGFA 1P74A 1KOLA 4MP6A 3DBHA 4Q3AA 3A14A 4TZKA 1PGQA 1FDWA 2C0CA 2UV8A 2VT3A 1E5QA 4Q3CA 5I8ZA 1YL7A 5H81A 4FIZA 3QVXA 4TMFA 2O2SA 3IMFA 2DC1A 4IDFA 1H94A 2XAAA 3PZBA 3AFMA 2IZ0A 2UUPA 3ANNA 1T1SA 5IAAA 1ENYA 1VI2A 2PV7A 2VCYA 5JDIC 1ENPA 4P8RA 4ZGWA 1NM5A 3WIEA 4KUEA 4PG5A 3C7CB 4E0BA 3TZCA 1MC4A 1NQOA 3DOOA 4BNHA 1U2GA 4Z6KA 2WYWA 3C7DB 4CR8A 3AOGA 3AY6A 1RYDA 4BO6A 1V9LA 3NTOA 4FPXA 4NBWA 3UUWA 4L74A 5DBFA 5AVOA 3OIGA 2ZB3A 1YE3A 1U3WA 4NBVA 4NBUA 1P0CA 1U8FO 1VPDA 4OKNA 3H7AA 3G49A 2C82A 4ZA2A 1DC5A 3FPCA 2I66A 3AJRA 1X13A 3ZHYA 1YOVA 1CQJA 1XLTA 5F1PA 2VWPA 1BDMA 3I9OA 1O0SA 3EVNA 4CM8B 5B4UA 1E3WA 3TL2A 3GRPA 4J1SA 1OBFO 1GEEA 1YWGO 5DZSA 2QIOA 3IP3A 5ITVA 1LSSA 4FFNA 2YFHA 2O4UX 3FI9A 4M89A 1NR7A 2PZKA 4CM9A 2HUNA 1QG6A 4P22A 1K6JA 1LC3A 4S1VA 5U9CA 3ZCXA 1L7EA 2YYYA 1PGNA 4BL5A 4PG4A 4IDDA 4E21A 4GVLA 4XX0A 2GNAA 1Y8QB 4ID9A 3AY7A 5T6BA 4D42A 2DPHA 3IKVA 4J3FA 3AK4A 1I2CA 3GFBA 3HE3A 3Q0EA 4DLBA 5B4TA 3GPIA 1HDCA 1VM6A 3JD1A 5T8KA 1I8TA 1FDSA 3D3EA 3I6IA 4RVGA 3EK2A 4W4TA 4A5OA 3PDUA 4TVBA 4PVDA 2NVBA 2GR9A 4BUCA 4JCOA 5COBA 5JFOA 4M54A 2SCUA 2BFPA 2D0IA 4Y9DA 1H9AA 1QYXA 2DUUA 2NLOA 3LYLA 4L4SA 4NI5A 4CQMB 3PYXA 2E48A 3GVPA 4JNKA 4ITUA 2CVZA 4MOWA 2I3GA 4EJMA 1V0JA 2OL4A 2Y05A 4J1NA 1MFPA 4WLOA 1PU2A 3U49A 3ONFA 2C5AA 2PNFA 4CV2A 1IE3A 4G5HA 1KYQA 1OC2A 3S2IA 1QLHA 3GNSA 3L4SO 1E7YA 1DC4A 1R16A 4NJMB 2XF8A 1HYGA 4IS2A 4CV3A 3E9QA 3JD2A 1HDRA 3I4CA 3GFGA 4MKRA 1R0KA 3DMTA 3GNQA 3PJDA 1D8AA 3BMCB 2ILTA 3P7MA 1TXGA 3IIEA 2R2GA 1F12A 4BNUA 4Y98A 1ZSVA 1DAOA 8LDHA 1VJ0A 3CSDA 4BO1A 1UP6A 1LRKA 2YV2A 1XR3A 5L7YA 2W2LD 5C3MA 4NFSA 4QXMA 1PJLA 2Y99A 3GHHA 4IJWA 2XOXA 2VZ8A 1NTOA 1Y9EA 4WE3A 3ON5A 1BXKA 3LLVA 4WOKA 4QQRA 4IM7A 4XWYA 4AFNA 4YJHA 1UR5A 2FRDA 3WGQA 3UFXA 4GQAA 3E5RA 2W98A 3WG9A 3WX0A 2E6UX 4QTZA 3EZYA 1W8DA 1Z73A 1TEHA 5FEUA 4UUNA 1QV7A 1GADO 1XU7A 4XZ3A 2NQ8A 4LN1A 4WEOA 2X0IA 5BQFA 4XQCA 3VH4A 2D2IA 2FN7A 4TKMA 2HMTA 3U0BA 4B3HA 4ND2A 4FQ8A 1RYEA 1EUDA 1KVTA 1B7GO 2JJYA 4UVDA 2O3TA 1LLDA 3VOSA 1YQDA 4EYEA 5L7WA 3GRKA 2WWRA 5I7EA 1DIBA 3KLMX 4YT4A 1XYGA 1CEQA 4YCAA 5IN5A 3O4RA 4ND3A 4MP3A 4AJOA 1FJHA 5TT0A 2RHRA 1UXKA 3DBHB 5TRTA 4EJ6A 1H6BA 3IS3A 5A06A 3GZ4A 1LQUA 5CEEA 4I1IA 1I32A 3BYZA 3QY9A 5ER9A 5G0WA 1ZUD1 1ZK4A 3HHPA 4RQTA 4GH5A 1IHYA 4OYRA 4PLTA 4XYMA 5JDCC 1ZK2A 3DQPA 5BNIA 3RJ5A 2NQTA 4CM1A 1F06A 5HTOA 1LRLA 4OXNA 2IXBA 3V8BA 3ZZNA 2D3TA 5T64A 3TFOA 4O63O 2VNSA 3B1FA 3NDIA 2ZYAA 3VKUA 5B37A 2YV1A 2WD8A 2FR1A 4YDRA 1YVEI 3UHAA 1ISHA 5C5IA 4MINA 1HZJA 4Q39A 5KVQA 4ZD6A 3JD3A 7MDHA 2DM6A 3IAHA 5TSDA 4ZQGA 3K9QO 4YB8A 2CSUA 1KY5A 4PLYA 5CG1A 2NVUA 2HMUA 3DAPA 1TT5A 3GOHA 4R01A 4I5DA 2OBNA 1IZ0A 4R16A 3NUGA 3WICA 5IXYA 1KY4A 1IYZA 3CZRA 4FDAA 3AUUA 4J9UE 2I9PA 4ALLA 1B15A 3C24A 4PCVA 4PLHA 1A9YA 3OSUA 4UUOA 4D43A 5A9SA 1AE1A 4BO2A 3Q6IA 5EMHA 5ENDA 3GQVA 1BXZA 1QV6A 3JV7A 1YL6A 1GQYA 4BNVA 1A72A 4MVJM 1GFSA 3MEQA 4LRSB 1D7OA 2NU6A 4D0SA 3SJUA 2EKQA 3UKOA 1QR6A 2RHCA 2NNLD 1PQPA 4FFRA 4N7RA 5DN9A 1B0AA 4BKOA 1SOVA 1E7QA 1NR1A 1JAXA 1T26A 3A06A 2YV3A 1WPQA 1GU7A 4H15A 4R5HA 2VYVA 1GPDG 3BAZA 4Q9NA 2HK9A 4J2OA 3SC4A 4IJKA 1JKJA 2VRCA 3IJPA 2EGGA 4XDZA 4CMIA 1DC6A 1GZ4A 4GGPA 2PK3A 1NHWA 4L76A 4NG5A 3IUPA 4W7IA 3LF2A 4RQUA 5AOVA 3VKVA 4GWGA 4OOEA 1MA0A 1AXEA 4XDYA 2GZ2A 2VWQA 1YBMA 3WBFA 3MJTA 4PLPA 1BHSA 4DREA 5L4LA 4F46A 3DZBA 4RJTA 4AJJA 4D45A 3RUAA 4NH4A 4Z3DA 5HBRA 3CE6A 3I9JA 3AUSA 3OA2A 3B6ZA 2HSDA 2DU8A 5TJHA 4YRBA 3S2GA 4H16A 4YT2A 3L4BA 2EIHA 2E37A 2B83A 3VPXA 5JYDA 1L7DA 3CXRA 3H5AA 1C1DA 1W73A 1EBUA 2JD2A 1TT7A 3ENNA 4ZQFA 4A7PA 2P9CA 4BNKA 1RM4A 3U4CA 2FHSA 3HB4X 1A71A 2TMGA 3FCOA 2Q4EA 1MP0A 4IDBA 4QEDA 1JQBA 3PIIA 2FR8A 3QHAA 5L9AA 1LC0A 1DLJA 2ZCUA 4BQPA 5KVCA 4EEZA 1I2BA 3LZ6A 3KRTA 5KIAA 8ADHA 1B3RA 1BWSA 1HTBA 1YH3A 4Q3NA 3WGYA 2Q99A 4JROA 3RC9A 3T4XA 1QORA 2GERA 1A27A 4QFDA 3K31A 1BW9A 3GA0A 2GGSA 2YDXA 1I24A 4BO8A 5CAEA 4HNGA 1LSOA 4EUEA 1KEVA 2AMFA 1KEWA 2HCTA 1X1EA 4TWRA 3OQBA 1PR9A 1WMAA 2ZJ0A 2P4QA 2GASA 2ZK7A 3IJRA 3INTA 1V8BA 1JVBA 3UAGA 1F8GA 3OJOA 1NXQA 5F5LA 2JCVA 3WLEA 4IUYA 3EZLA 5T57A 3UICA 3MJCA 3DBRB 5L95A 2EJVA 1GCUA 1E3IA 2Q2VA 4LISA 2GSDA 3UVEA 3DZJA 3WDSA 1ZSNA 1LDNA 2DKNA 1SO8A 5AXBA 3MJVA 1B3BA 1VSVA 3IKTA 4GGOA 1Z74A 1J4AA 2X9VA 1ZH8A 1H9BA 4JBGA 3W6UA 3H65A 5DT9A 1A4UA 4L73A 3CMCO 4Z9XA 4MVJD 2I3AA 3WXBA 4B4WA 3F1KA 4R68A 5ICSA 2I99A 2E82A 3DTTA 1GYQA 1ENOA 3HG7A 1HE4A 4GL4A 3D3WA 4AICA 4YT5A 2HDHA 4CLRA 1NASA 3ZWPA 2GZ1A 2ZTMA 3C3XA 2PFGA 3NGXA 3JQ9C 3DHNA 3CZMA 4OL9A 4JX8A 3AI2A 2X4GA 1LTHR 1T4BA 2I5PO 1K0UA 4ND1A 4WLVA 2G0TA 3FSRA 3JQAA 3MCVA 3GZNB 2EKLA 3K6JA 3PI7A 3KEQA 3GDFA 2ZQZA 2X22A 4ZRNA 5F21A 1P33A 1VSUA 4CLEA 4KZPA 5JC8A 2J5RA 1HZZA 4LCJA 4A03A 1BG6A 3WB9A 3PP8A 3TZHA 3V1TC 1IOLA 4GX2A 5KNLA 3DOCA 2RCYA 5ENVA 2Y1CA 5I9LA 5BSGA 4BQRA 3JSAA 1DBVO 2X0JA 1P31A 4RPHA 4BNJA 2QYSA 3H2ZA 5G0UA 3ZWCA 1OI7A 1ADGA 1VC2A 4B79A 1VJ1A 4K26A 5CHEA 1AXGA 4KDFA 1U28A 1JWBB 1EUZA 4J91A 2AA3A 4WGGA 4PRLA 3DAFA 4D44A 1NFQA 1NFFA 3NRCA 3TNLA 1RM0A
chains in the Genus database with same CATH superfamily
4KO1S 3RBVA 1QLJA 5DTRA 1UAGA 4O33A 4UEKA 1EVJA 4B3TB 3VAZA 3CMMA 5C3UA 1O97C 2HTFA 1GYPA 2VF5X 3OLZA 1A76A 2XQVA 1V3VA 1V4NA 4ZEXA 5HQ3A 4JVSB 5L51A 1M74A 1NI5A 3WZMA 2FFQA 1EK1A 1V1RA 1KC3A 2EL9A 2XVYA 2C00A 1G2PA 2CB9A 3GVCA 2E3JA 2LP4Y 1EBBA 3WV4A 5GJBA 4DC9A 1QKIA 4PC2A 1S8FA 2HU5A 2C31A 2FG7C 3A10A 3KIPA 1T6NA 2P4UA 1F51E 4LNHA 4ESHA 3EQ2A 4D9KA 3GFVA 3AIOA 3PUZA 2B4RO 2HPZA 1VJTA 3CHYA 3KR0A 1T3HA 4E4YA 1N2HA 3F5SA 4QDOA 3BMQB 1UPCA 1EBFA 3L7AA 4YAJA 4CM4A 3I4FA 2JC3A 2GHRA 2VP3A 1M8KA 1ZCJA 3GFOA 3KDAA 4FOTA 4MQUA 4RAQA 3RBAA 5FD8A 2G28A 4CLXA 2BRUC 2WW8A 1J39A 2YHSA 3QVOA 4GBJA 3DZKA 4N0DA 5T4BA 1OXMA 4L5IA 3U3OA 3WLQA 5MFZA 3ZU4A 5BNWA 4HYYA 3FPBA 4N7MA 4FHGA 2E1PA 5HPYB 1U7XA 3IT0A 2GTIA 4R1MA 2Z2XA 1VMAA 1W93A 2OB2A 1F2TB 3RUHA 3FDIA 4IOKA 4Y6RA 2YX1A 3EFEA 3HSYA 4QLBA 5DP2A 1IQUA 5EUMA 1IOWA 4J43A 2V45A 5AK6A 4C4OA 1QZZA 4OH1A 2ZJ2A 2AR0A 2WA2A 3RVDA 2F1OA 4TT8A 1X1RA 1W87A 2VN8A 3SX4A 1L7QA 4MWOA 5F77A 4KC0A 1PK9A 1B8VA 1ZBQA 1P4JA 3OX2A 1FU4A 1OQAA 1T6ZA 4PE5B 4R5MA 5ALXA 1JJVA 1POWA 5T3YA 3DL7A 3S70A 2CMHA 3B5EA 1KQFA 4Y2QA 5BN4A 3R7BA 2W70A 1EGHA 3AUAA 1IN5A 3LSYA 3P9KA 5TS3A 3GP8A 3N6RA 4WXRA 5KYNA 4TKLA 4LVUA 4BV2A 3BE5A 3BGDA 3VKHA 3D6FA 3IIJA 2OXEA 3I2GA 4B17A 4E94A 1CQZA 4LF8B 2DQSA 2EW8A 1T5LA 2J4DA 2PT6A 3PGKA 4IL5A 3WP0A 2DH5A 2JLXA 2PZEA 2VZEA 1IB6A 1AT1A 4GKAA 5CM9C 2PMEA 4JEMA 1SCKA 1ZISA 5DLYA 1J6UA 3FGOA 2OLKA 3HM9A 2D1YA 4YUXA 3HU1A 5IXJA 1EUQA 3ZD7A 5EUQB 1DXQA 1KHHA 1B2LA 3G0DA 3LXUX 1GL3A 4RD3A 4XQ0A 4KPGA 2B94A 3JWPA 4X90A 3T54A 2WABA 2BD0A 3QOXA 4LNAA 3RVOA 3N86A 1LRJA 3N2EA 1M1ZA 4EO9A 4CCAA 1WOYA 5SV2A 1NSYA 1C7FA 2YIDA 4MV8A 3V33A 1VMIA 1Q3HA 3EGDB 3RUAA 4UE2A 2B1IA 3B60A 2AOTB 2BR4A 3HB0A 3I2KA 4NEGA 4PQFA 3X1DA 3ZOZA 4Z4CA 2AQKA 2OQVA 4HSEA 1MCZA 3CYFA 2E5FA 5DWQA 3II6X 3DTVD 4KWTA 2HL6A 5TMEA 1UBUS 3BRSA 4DRYA 4LJSA 5GZ6A 5K0SA 4X66B 1ZAYA 3ZHZA 3EQZA 2P5YA 3O8OA 4ZMSA 1X7WA 2OV3A 2WSSA 3H8VA 1D1PA 1FVFA 4Z9FA 3G88A 1JHDA 4YWJA 4CKWB 4IEEA 5CDUA 2P7HA 4IFBA 3GMTA 5IYZB 1L7XA 3ASUA 3H9JA 1XELA 3SKYA 1Y6JA 3NASA 3W3AD 3IOBA 1XALA 4JP3A 5CITA 4NZOA 2WT4A 1M83A 3QXHA 2E4VA 1UMBB 4HXGA 4ZU6X 4ZVMA 2D6FA 4EGCB 4P81A 1AUQA 2FLKA 1JDJA 2OV2A 4KQKA 4Q9KA 2M32A 3F4LA 3PU6A 4LHXA 5TLSA 3OQ6A 2ATCA 1VSTA 2FI1A 2QW8A 2XB8A 2OM2A 5KQPA 4ROTA 1QGYA 4E13A 3GEEA 4E5MA 4TYYA 1WEHA 2QMHA 3PZRA 3RARA 3P2KA 4Q82A 5KJ1A 1XIVA 2VOJA 3VUFA 1CY2A 1I30A 1QHYA 3WNCA 2CDAA 4EAQA 3TW8B 1YZVA 2H6EA 3BKXA 3O6VA 1J2EA 5EE1A 4AJKA 5EXXA 3KJFA 2Z09A 1JVNA 1T8WA 2ZR0A 4M8SA 2D7DA 3K70C 5ALGA 1NVMB 4N5MA 1WVIA 5I9MA 4QGGA 3SR0A 4ENVA 4TQUS 3SAJA 3DHVA 3PNPA 3G3EA 1ML4A 4HDQB 5AHXA 3THRA 4HGNA 3GZJA 3OAAD 3TI7A 3W79A 4FDTA 1NSTA 1VHWA 1ONPA 3EVEA 4L85A 3V7FA 2FW9A 2CJXA 3LQFA 3E3OA 1ZR2A 4MVWA 3U60B 3QUBA 1AKWA 3IFSA 3WWPA 1L5LA 3WLHA 3PWSA 4CI9A 2G17A 1T2EA 2PPVA 1JL3A 1K5DA 2O2DA 3V4SA 5IG2A 3H1TA 5JBIA 1MQ8B 2R8YA 4PGFA 5BYJA 1KEKA 2D0DA 5CT6A 5LZ9A 4YRRA 4DIOA 2XYGA 1BX3A 3PK0A 5A4MS 5AW3A 3GJXC 4C9BA 1WXGA 3H5WA 1C4WA 3DR5A 1IVNA 1LFDB 3QKSB 4BATA 2ZI7A 2HV8A 4O2AF 5AKZA 3B48A 4JP2A 4YAEA 4OHVA 1MC8A 2BVNA 2IPLA 3JY6A 3H8SA 3RU7A 3FCSB 3GNTA 4DR4B 3WB2A 5HJ2A 3ESQA 1Q0ZA 5FQNA 2V8BA 1C3EA 2VWGA 1N7HA 3A4LA 3F74A 2ERXA 4QJ4A 1COWD 4E3ZA 5ER6A 3O74A 4NPCA 2WZQA 1TA9A 3LUKA 3WYBA 4OIMA 5KEIA 5ICMA 2H51A 2G40A 4KO4S 3JU3A 5GGXA 3S5JA 4IG9A 3V7UA 4BVFA 5IZCC 3W4KA 1ZIDA 2OQRA 3WKBA 3OWOA 1G41A 1BJKA 3OZIA 1K4MA 4Q4AB 1I7QB 1IDN1 1RAAA 2ZDGA 3R5SA 4JODA 2JH3A 3DDZX 4Y2PA 1R12A 3DM9B 4TVKA 2CNOA 1CV2A 3HJFA 2PU5A 3VNRA 2CJPA 1SBTA 3NIDB 4OHMA 2REBA 1TTPB 1SHKA 1AUXA 2QF7A 3H6GA 3LX5A 4OP2A 4PZDA 1H6AA 1P91A 1E5XA 1R1DA 1K7EB 3STUA 4YAFA 3AM1A 1QYWA 1RBMA 1ZESA 3SHOA 2X58A 2COEA 1IEQA 5JS8A 2YBDA 4OOFA 1AUOA 1X9HA 3QLUC 4PCAA 5WRFA 1XWWA 1NUAA 4M83A 4Z51A 5AVYA 5LQMA 3DMDA 4Z54A 5EG5A 3VPBA 2WHPB 4IH4A 2Q9CA 3I23A 3AUFA 1IULA 1Z4PX 1J06A 3GHYA 3HZRA 4L1KA 1RI1A 3F5QA 5AK5A 5I5EA 1GQOA 3JQ8B 3VPCA 5HQJA 3VRHA 3WTBA 5BVGB 5BMVB 1RXEA 1XRQA 1RFGE 2QY6A 3NYIA 4HJXA 2GA8A 3SNKA 2NM0A 2YJGA 3OEWA 4NOLA 5CU7A 3ZBTA 4AMUA 3K70B 4KRXA 2HXSA 1JEEA 4NR0A 4W99A 2I8AA 2IYFA 3QKTA 5DK6A 3CQ9A 3DMHA 4LS3A 4P58A 1NUPA 2I4RA 3B9RA 3IPRA 1KO7A 1YRLA 4FW8A 4WKOA 1MJHA 3TQQA 4NQRA 1SG9A 1KI6B 4F86A 2WI8A 2ASEA 4O4HF 4GYYA 3L7NA 4NG4A 1KH2A 2J9ZB 4RO0A 4KR2A 5DYNA 1OZGA 3TQSA 1WW2A 1P6QA 1DX4A 4JC8A 2OV8A 4CM6A 2CMFA 1JUDA 2ABWA 3DR3A 1DQPA 5KQRA 4BS9A 2O0MA 3X1MA 4K9LA 1NU8A 4OLBA 1SC9A 4MTCA 1D9XA 3L7LA 1XUOA 3WBBA 2VQFB 3ZGZA 4X3OA 4OFXA 4F60A 4FGUA 4CLOB 4BKRA 3WLPA 4UARA 1ISJA 2OK8A 4A3SA 3CO0S 2QD4A 2QRUA 3NOQA 4IDNA 4ZKEA 4DG5A 3VUEA 3G8CA 2VH1A 5JNLA 3OE7A 1TCUA 4EUHA 2ES4A 3PQDA 3STHA 2I6SA 4N0PA 1SUCA 2XYVA 3R5JA 3PUIA 1E2HA 2X4IA 4WKPA 1QU3A 1GOTA 4II2A 1PLLA 3LBHA 5JZSA 2ZIXB 1I10A 4QYSA 5JCOA 2R96A 2C5EA 4QDXA 5T41A 1CP3A 2D2EA 1JIKA 4AROA 1BIFA 4DC1A 5HJEA 5JATA 2DWOA 4I55A 4K88A 4ARIA 2FOXA 2PVCA 1TUGA 2X5XA 3ODPA 3KLBA 1UIMA 3OQIA 1ZGJA 5EKDA 2VAMA 4ZVNA 3ILVA 4HY3A 4JZKA 2Y66A 5JTUA 3ZLJA 3GLIB 2JJMA 1A5AB 1USKA 1WRBA 1XEWY 2J3MA 5ALIA 5LBIA 4EW2A 1OH5A 1RZRA 1TMGE 3O1JC 2C5LA 4MZXA 1JA1A 2HZBA 5CH8A 3CUKA 4RH0A 3OQMA 1JEYA 2TECE 2HBYA 5I9SA 3TB4A 4MDFA 3WWEA 3BXHA 2FEMA 3TTVA 3K0AB 4NOJA 3TEMA 1NLFA 4HS4A 3WQRA 5TIIA 4E6EA 3THWB 1G0OA 2WVHA 4L75A 5DHQA 4PHHA 3GRRA 1UBHS 4MMYB 1AA9A 4Q1AA 3TJMA 4A6DA 4C2AA 1ORTA 2Q9AA 4G1CA 4D0RA 4YIKA 5B4VA 2VATA 5JJIA 2PA0A 2VP5A 3DF9A 3DNPA 3MWYW 3R09A 1JFRA 4RD2A 3L6OO 4OSOA 3WIUA 1GPJA 2H1LA 3ZCQA 4PX3A 2FEPA 5TR9A 2EAUA 4F1KA 1EUCA 1UMDA 3JZAA 1FLDA 2JFFA 4H0NA 3UJ9A 2BH2A 2QAIA 3V4FA 1Y7PA 2AZDA 3LHSA 3DDHA 4MR8A 2GF2A 1GGMA 3M8KA 3UY4A 2H59A 2PRYA 4GRDA 1QFMA 1UWCA 2O8NA 1FFXA 4RU1A 4Z1MA 4A6PA 3VPHA 4AVYA 2OP0A 2FW8A 2C54A 1ZNXA 3D2BA 3R3UA 4RZQA 3W5UA 1IK6A 3GEHA 3ZW7A 3QX9A 4HVCA 4RHEA 2XA1A 2QP3A 4M9QA 3JX9A 3C5HA 1JZQA 4HUQA 1IG3A 4FB5A 5LP1A 4XYGA 1N6IA 1NUHA 1PGPA 3Q3CA 4BQNA 3ENWA 3K6RA 2V3WA 4DSTA 4NK4A 1PJSA 3GLHA 3UK1A 1WO8A 4EDFA 1SVOA 1ETHA 2AUMA 2HPVA 1RRCA 1U0FA 1K89A 1YDEA 3NH6A 2DTXA 2HZ7A 2GBPA 3BH0A 2BV3A 1A9QA 3DPUA 5FNVB 5LLSA 3SY8A 4YT8A 5JAHA 1BEZA 4CV0A 3G9ZA 2Z4TA 2JZNA 3AR7A 1KJ9A 2C98A 3C14C 3TD9A 2PTHA 5D5QA 1CWUA 1OF1A 1QFZA 1VG1A 1SXJC 1G64A 3A1FA 5HHTA 2VVTA 3L46A 1CR6A 2DBQA 4HZGA 5BORA 4F84A 3IEMA 3H2KA 4N5NA 5IDXA 5BPFA 2IHKA 1CRLA 4G4IA 1O6CA 1G9XA 2FPRA 3NEPX 4WXEA 4B6SA 3QJ5A 5DHFA 1LQ2A 1KBZA 5J59A 4EECA 1YI1A 5TQ0A 3T9EA 3AW8A 4A0RA 3MG9A 4DDWA 1UC9A 4G09A 3UHAA 3X44A 5SY6A 2CFRA 4GGMX 4F71A 1XRRA 1UJCA 2F3QA 4EA8A 1UK6A 4J76A 4OJNA 3IR5A 3F9CA 3ICPA 1OAKA 2IUEA 4GR4A 1RMYA 3ZE6A 4RK1A 4J4BA 4V0OA 5G0VA 4EY6A 1CY1A 3AHHA 3U62A 1EDEA 4Y1RA 1BFKA 5KOJB 4JI4B 1FSPA 2O2YA 3LO5A 3JQRA 3WGHA 4RFSB 4TRMA 4PYRA 3AB3A 3KWJA 4GUAA 2HBRA 1GRVA 1XD2B 2CJYA 4YEDA 5JZMA 3EOAI 4BYMA 2W8ZA 4BBZA 1ZD2P 4P33A 4CEIA 3E5MA 1QQBA 1SEPA 3JR7A 1CUSA 3D8RA 4RADA 1RACA 1S89A 2AEEA 1AB5A 2XGSA 3A70A 3WRYC 1QAQA 2ATIA 4FCVA 4PBSA 4ZT3A 1BQ3A 4W1QA 2DERA 4WUTA 5JLAA 2FRDC 3BE6A 1VGRA 2QVCA 2C2OA 2WKPA 3E48A 3GFTA 4IDHA 4UM5A 2VDWB 1HH4A 3IOCA 3L8ZA 5L3SB 1YGYA 4B84A 2W5UA 1OLXB 3TLCA 4YRAA 2RKBA 4WUVA 5HIJA 1L6IA 3WLMA 1XDUA 3DCNA 3NHZA 5KSOA 2YQ5A 4XJVA 1JDNA 1GO2A 1WUYA 5I7WA 4XX0B 1PVOA 4L78A 4MJ7A 5LJLA 2FN9A 1T2UA 2RK4A 1NOJA 5D2CA 5TE9A 3DUFA 2W4QA 5BYBA 2HWWA 3LY5A 5C1IA 1KERA 4DFDA 4M7RA 5ICEA 5G53C 4QUKA 3WSVA 3EMDA 2JAOA 1UJNA 5F1KA 1E77A 1TZKA 2GZDA 3EAFA 5LXTF 5FUYA 3PT5A 4M7OA 3U44B 4GQIA 5DNAA 4QBKA 1LTQA 4RQAA 4YYEA 4WCFA 3WGVA 4ECEA 4N6GA 4EWLA 4H1UA 4CL8A 2PTGA 4MW7A 4ISCA 3TLJA 3GLIE 3A6GA 1DKNA 4B74A 5HIAA 2X0FA 1SHZA 2J3LA 2IEBA 3K1ZA 2FG5A 4HDNB 2ONZA 1CJVC 4MCIA 4BCDA 2JG3A 4JEHA 2BZ0A 2H5EA 1MKYA 1NG1A 1PZNA 3PCTA 4CVNA 1J07A 4OX9Y 4ZOLB 4I46A 3FSJX 4V0SA 3N0VA 3EGCA 3U4AA 2ZYTX 1Y1LA 5AMXA 1ZR4A 2FX3A 1DJMA 2LRHA 5B7NA 1SUEA 2Z6UA 1IM5A 2YOHA 1QPGA 4TUYB 5AKLA 2K4MA 5LNK1 1PJ2A 3W5DA 1FJXA 3WMGA 3ZG6A 5J3JA 2BJVA 2X1MA 3AESB 1ELOA 1Y8CA 5T67A 4EFLA 4EATA 3IUNA 5JADA 3L1JA 2H0RA 2WD7A 2QX7A 3ZJTA 2C0PA 4IOJA 2QLBA 1JG4A 2YN2A 4TWIA 3GQBA 5ERYA 5I51A 4BMDA 3QKRB 4FR2A 2Q9BA 4UZEA 1N6RA 4JT2A 1NBIA 4TMTA 4RVCA 2IYPA 3QHPA 3WWYA 2X9GA 4WAUA 3UOWA 3H4MA 4LSGA 4DMFA 1ZJJA 4AZ3A 3GX1A 4BNGA 5KC9A 1T5SA 3WHIA 3HXLA 4DILA 4KFSA 1X70A 4EMSA 4RSRA 2PSEA 2R751 4B1FA 4BEBA 3EYWA 3ADDA 2E18A 1O6GA 1WB6A 5CT4A 4BLVA 5JG7A 4YJHB 4UOZA 2HQRA 1E1KA 1R9NA 4KVAA 1ECFA 3R77A 3DWIA 3VH1A 2BFDA 3UFXB 1NJ2A 2AQIA 2ZIFA 2O2GA 4D81A 2VJOA 1YV9A 4LAFA 2VPZA 1Q95A 1DAFA 2CJWA 2Y2UA 4J9VA 3INYA 3SYKA 1KK2A 3T7DA 3EB9A 4TMYA 3WL5A 3S1AB 1IZ8A 3GEIA 1PSDA 2Q2WA 3A9TA 1TTHA 3IPYA 4DQKA 3HU5A 1IATA 1ESNA 3AETB 1BNCA 1Z4KA 2V4UA 3SJ7A 2FUEA 1TADA 5CFPA 1CRWG 3TAXA 3K30A 4L8GA 5HFJA 1ZRMA 1PFGA 1Q7RA 3B7PA 4FZJA 4UZSA 3OZWA 4UREA 1QO9A 4KOEC 4XRGA 4N76A 4DEVA 1JQAA 4AJPA 2Y9PB 4MW4A 3IHLA 3H4VA 4M21A 3OO1A 4KITB 3IQWA 5AUOB 2XMDA 1M1UA 1Q5PA 2PIDA 3TZQA 3JYHA 1QK3A 2NU8A 1J56A 1S1CA 1ZITA 3WL7A 1HO3A 2XMZA 2WSBA 4V0MA 1EUYA 3W5CA 5G4KA 4UM8B 5DYTA 3VZDA 4AF7A 3ZXSA 3PSHA 4G86A 3I28A 3MOIA 3OMLA 3P9IA 3GXBA 3HL0A 4Z2AA 5A1JA 1N1EA 4YQZA 3NORA 1U7OA 2WG2A 1FMLA 1SHUX 3B82A 3GH1A 5EKUA 4DTCA 2HQ1A 4C3OB 2IHNA 3DPIA 3I2JA 3FNGA 3T1NA 3CCCA 1WL8A 2KYRA 3QW4B 3WZLA 3TKLA 2V6IA 4PFSA 5IDYA 4A2PA 3PVCA 1RXYA 4ZDWA 3IUMA 1PVVA 1FFEA 2KI5A 1N5LA 4J6EA 4MQEA 3BIJA 3LDFA 3BH6A 4YK7A 5EJ7A 3LP8A 3TEFA 3I05A 3DEJA 3U61B 3AVXA 1BOOA 4GVXA 2JA1A 2CL7X 3LWBA 1SVIA 2UVPB 3L1IA 3WNQA 3IDAA 4FGLA 1EIWA 4RKQA 1GKUB 1Y5NA 1C9DB 2D1FA 1K7CA 2DPGA 2XDQA 4H35A 4ZP1A 3NH9A 5AVJA 5A3VA 3ZKWB 3GT4A 3JAKA 5JV5A 3PNQA 5B1DA 4OREX 3AR5A 2P11A 5KYYB 1BJRE 2O4CA 1Q84A 1Z35A 3O3OB 5FR1A 3LAWA 4QBGB 2OBMA 1TT5B 4I4TA 1PZFA 2Z08A 5L53A 3WK4A 3A1UA 5FA6A 2ODPA 4FMDF 4GPEA 2R97A 5E6RA 4E14A 2P62A 4B3FX 1K8QA 2PJZA 3E7PA 5K3FB 2PJRA 1F1BA 1Z82A 2JRLA 2ECOA 3BSWA 4ZAWA 4U7WA 3TW6A 5BY2A 1ZNZA 1PGOA 6REQB 1XNGA 3E3NA 3LVRE 2V6MA 2W6IA 3MUOA 1DDOA 5CFMA 1SXJE 4JYAB 1UZLA 3PQ4A 1Q11A 2JGIA 4U8GA 2R00A 2B0JA 3T1OA 1HWYA 3T1TA 1HDGO 2O59A 4QUEA 2NAPA 1ISMA 4Q16A 1T9BA 5DTEA 4EK9A 1CJBA 4K9NA 5BSRA 4F3NA 3H6KA 4RHXA 4QU5A 4I5IA 4RZIA 1Q7EA 4ZVRA 2QRLA 3UG6A 3HB5X 5AJYA 1W2HA 2IVZA 1W1IA 1D4AA 2HNAA 1K4YA 2ZIAA 5FBRB 5B1HA 5BWCA 3PNLA 3VR6A 5KJ6A 2Z8YA 2ZXEA 5AJZA 5IC4A 3UOGA 1ZICA 2FUNB 3BD7A 3DE3X 4R2XA 1EXDA 1VE9A 2IEZA 3RKRA 3T9AA 1AH2A 3UKDA 1Q44A 3PICA 5M2QA 4M6WB 3L93A 3N05A 4W7HA 3L92A 4XUEA 4HDAA 4XB2A 5F76A 5IVDA 2QN3A 3D5TA 3G7UA 3DDUA 3ROKA 4BKMA 4BVGA 4MKXA 3UBTA 4QQFA 2PLWA 2AXEA 4NCIA 2J5BA 2YZGA 4R1QA 2R66A 4IDAA 4RY9A 5GV8A 1HE8B 1FFHA 1Y6QA 4X61A 1BFDA 5BSMA 3QMWA 2XZLA 2VQSA 2B8WA 4F5YA 3LVQE 1UM9A 4MUKA 1EK2A 1B6GA 5DV9A 3NI2A 1WU7A 4O29A 1N7IA 1Y3IA 1NF2A 2VHUA 2W6JD 1DUVG 1Z47A 2Q6KA 1PR1A 2WHEA 1N8NA 3FDJA 4R1OA 4RF3A 4CTKA 2ZCJA 4QSMA 3U3XA 4LJRA 1T4DA 1PX2A 1G20A 4R40A 4UPDA 4AIRA 2FH5B 4O1MA 4B7UA 5DW0A 1OZAA 3A2NA 3NHMA 2EBHX 5EP2A 3ORSA 2D4HA 1U3FA 2ID8A 4BN0A 4R41A 1Y7LA 1A7AA 3L6EA 1DBWA 2WJ3A 4JUBA 4JV5B 3CT4A 4B8ZA 2Q5QA 4S12A 2PXCA 1E9CA 2IF2A 5ERGB 4YUWA 4DKJA 2WMDA 4UE6A 1Y8ZA 4W1SA 4QLOA 3F2VA 4XLLA 1TVCA 2JAPA 3LLCA 4RPIA 1V41E 3D2CA 3R74A 3V9PA 2G9ZA 1OLUA 2WUVA 2XWJI 3S6JA 1JA0A 2HRZA 1JDVA 2RK6A 3CLRC 4IQ8A 4X8LA 2BTQB 1T6YA 2IZ7A 4P31A 1YQ9A 3W9UA 3ZYZA 4BY9E 3U3KA 5J2TF 3LCUA 1AA6A 1GSIA 5FXMA 5DBGA 1YF3A 3GJYA 2WHXA 3WWDA 1FTQA 2OQIA 1IZ9A 3QXSA 4MQFB 4FFSA 1BN7A 2QMEA 1IIRA 4LOHA 4TN5A 5F9HA 3ZDRA 6LDHA 4LMAA 2EW2A 4LYDA 4MUHA 1SELA 4R2JA 5DI3A 3ZE8A 4ZHSA 2Y0CA 3VR0A 4HV4A 2VSXA 3B1KA 3BCRA 9LDBA 5GOTA 1QHHB 2Q2QA 4CQNA 2HFJA 2ZJFA 1QF9A 1S7CA 3SIWA 4CQMA 1MH9A 1RBQA 1Q83A 2C1ZA 5AM0A 1FK8A 3KZ1E 1K6MA 2XEDA 3L1HA 6CHYA 1E1QA 2C83A 1XF1A 1G5IA 4PR0A 2J48A 3B38A 4XQEA 1MNAA 3ZTWA 4URVR 3FN4A 2VP2A 3NNDA 5B36A 3CNEA 1EM8A 1EDDA 3BPSA 3NBYC 4J07A 1WCYA 2JIDA 3KOOA 4ER6A 1ND5A 4D4IA 5AVVA 4G65A 4QTUB 3RH0A 1E92A 1NZFA 2J33A 1L8OA 1PS8A 2Y1LA 1KAOA 1DPGA 1PJCA 1XZQA 2PWYA 3IH5A 3L0IB 2Q1UA 4I3HA 3WVNA 2Q5FA 3O5AA 1BWPA 3CKYA 4C1BA 3OUTA 3W5AA 3OZCA 1WP9A 1E6CA 4C0AC 2GPTA 5D7NA 1P2VA 2IUSA 1QVRA 4YV0A 3BOSA 3T3HA 3CX3A 1ZDMA 3V1UA 3AVOA 4N39A 3VAAA 4DV2B 3FHTA 5BQ5A 3S2ZA 1UPXA 2ZB2A 3H8JA 5EL0A 3SOZA 3LH5A 5LIPA 2GZRA 4MCJA 3ADCA 3O90A 2ZE8A 3ZNNA 4WNIA 1E2JA 5FAXA 2DFPA 1YJAA 3FBGA 2FNAA 3Q3IA 4WDRA 1YQQA 2PAFA 1Q91A 5F9MA 4DDMA 5L4NA 1ZJWA 1FA9A 4EKYA 3M1YA 2Y4NA 5DGHA 2C07A 4CLRB 2M1XA 4DY4A 2ZS9A 1V5EA 4IIJA 1AZLA 1CUIA 4C7MA 4BV9A 4DGQA 4EW6A 4BN4A 2J1LA 4JB0A 3GN2A 3IUJA 4PZ0A 3WP1B 3PB3A 1MF7A 5DP1A 4UQLA 2GBFA 2OXFA 2IWRA 1SC3A 2A5YB 1X7ZA 2D1QA 5I5GA 1EP3B 1OVGA 1DIOB 4UMEA 1UBKS 3F6SA 3NETA 3MD0A 2Q49A 1NDQA 3NANA 3WAGA 4WK2B 4WJZA 3F0TA 3FWNA 4TS4A 2AH5A 5CGZA 2ZYIA 3VO1A 2ODEA 3JATB 4LJ9A 4E2XA 5ITWA 1BJTA 1LA2A 4M0LA 4W5TA 2XXJA 2GN4A 3BICA 1GY8A 1RJEA 3FKSA 3UHFA 2ZTVA 5B2FA 1V7CA 2A1IA 3MIIA 3W05A 3MGAA 2Q28A 1G3QA 4ALJA 2XNDA 3CB4A 1T9ZA 3QWIA 1HOXA 1J20A 3PYMA 2VPPA 2UZ1B 3R44A 4OLHA 3CNBA 4PVCA 3MQ4A 3VC1A 1K98A 1NQTA 3K2BA 2CLIB 2H1RA 3BKWA 1FQKA 1G5HA 2G1UA 1WQ3A 1GT6A 3BDVA 4M1TA 4J3JA 4B4DA 2BHLA 4X1OA 4FFWA 1SUDA 3R7SA 3WHLA 3YASA 4EEXA 2CMGA 3CINA 5G3YA 4BRUA 2XQKA 2NO7A 5F73A 4BYGA 4GS5A 2VF4X 3Q7RA 2H7YA 4C3UA 5CDFE 1D2GA 4ZPJA 3EYAA 3ZGYA 4DJ5X 4JJ4A 1KK1A 3H9GA 4JSTA 3ZHOA 3CVYA 3DLHA 4JQCA 5E1MA 2R6CA 3DULA 3VZQA 5DM2A 1U04A 4ALKA 4FDMA 4D9BA 2UUOA 1EJBA 3D4NA 1HLDA 1XQVA 5JSFA 5F3RA 2XA9A 4QDTA 2NXCA 1DAGA 1IN1A 4QNMA 2YWFA 2JFWA 1SVNA 1QVVA 4PNHA 4ALMA 4E5KA 5DRYA 1TTQB 3OZSA 5CCBA 4YREA 2WSMA 1UBTS 3MJDA 1L1EA 1CR4A 1I5EA 3W3AH 4E51A 2QN2A 4HXEB 5I4BA 1KK0A 2NV6A 5NLLA 4K8OA 4CMHA 5EXPA 5ALPA 5GINE 1WD7A 3TH5A 4KQWA 3GMSA 1H2HA 5HCNA 2HX1A 3DCYA 4H60A 1OYYA 1C0LA 1WMBA 1Z75A 1BOFA 1T0UA 2BKAA 3FJOA 1GGFA 1DCKA 4QUJA 1U4OA 3R3YA 2JVJA 2QW0X 2JHPA 1UWKA 2HJRA 3OCUA 4LZAA 4Y67A 1Q7GA 1WHTA 4FYPA 4JC5A 1LWNA 2XT6A 3P19A 3Q6NA 2XB6A 1RYHA 4BJ3A 4GUDA 3U48A 2IYXA 4FN5A 1VTKA 2L82A 1NXVA 3KXPA 3LPMA 3QV1A 3ZDCA 4Q4LA 4D1YA 4W5RA 1YB4A 2K2WA 4BAZA 4CNQA 3QSYA 1MDBA 3KJQA 1KPHA 2C58A 1AZSC 3K32A 1P1JA 4TMVA 2AK2A 2PA3A 3D4LA 4L0QA 1UKVY 4B8YA 4NBRA 3MGGA 5EXTA 5BWOA 3O26A 1TGVA 1NMQA 1OI2A 4QGHA 5KYWA 3K8QA 1AUPA 4OAPA 3C4QA 1QG2A 2QN1A 4MGKR 1BN6A 4KE8A 1I01A 3LU1A 3TIIA 3A9RA 2VDLB 1WMEA 4UEOA 1H42A 4C1NA 3UPTA 3L6UA 2R8PA 1YQWA 2FZCA 3T7IA 1HE2A 3AEKB 1ZCFA 4II3A 5D3KA 1X3SA 3IP8A 5FOSA 4HEJA 1HA3A 4MCAA 3IPXA 4KGVA 2CYAA 2X3FA 3ZGNA 1CF2O 1N0UA 2X4DA 4WLEA 1XMOB 4M8KA 4BUJA 2NT3A 5I9IA 1EVEA 2C03A 5CB4F 1H3EA 3EMBA 2OZKA 3FUWA 1BS9A 3VFDA 1Y3HA 2OESA 1NBHA 2A5LA 2OZLB 4P36A 4EG1A 2HGSA 4POAA 3BDIA 4LOJA 1GPMA 2NZJA 1CVIA 3NEYA 4NYMQ 1KGSA 3V2HA 4XB6B 5IN4A 2I1LA 3FVWA 4MUJA 2CV1A 4A15A 3UMJA 5KBYA 4Q03A 2PFKA 1FXUA 1T8RA 2GJKA 2M9MA 5IF3A 1NL3A 5JDCA 5TPZA 3CLSD 2O1EA 1SQ6A 4ZYZA 4LOKA 1XYVA 5IBRA 3FCCA 3INRA 4KBFA 4OQEA 3SLKA 5C80A 1X7XB 4XYEA 2OORC 3EC1A 5IAJA 3KBBA 1E3DA 5CBPA 1JU9A 3PHJA 5AD1A 3GEPA 2WB4A 3KEOA 4NMHA 2Z8ZA 5EGSA 3NXKA 3R8CA 4AKSA 3JALB 4PANA 3Q8MA 4G0WA 1PS9A 2QHXA 3VSAA 5F7XA 2Y1DA 1Z5PA 2ZJOA 5F2OA 3UENA 4CDNA 3NV9A 4DLPA 1J9EA 1H0KA 1X9GA 9GPBA 2RH9B 2C3MA 3N0TA 1NVDA 4EQ6B 2XIQA 2YWRA 4ZOEA 2XCUA 3E0QA 1HLGA 2CXQA 2Y1GA 2YJZA 5E8RA 5KU1A 2WM3A 3EIOA 1GXSB 1TLFA 4B82A 2BCJQ 2JANA 4Q7QA 1P1BA 2WPDA 4R9SA 2X8BA 3BHJA 3QA9A 3TVYA 3EXEB 3TQTA 4HDMB 4N65A 3O7MA 4N18A 3QHQA 1M33A 4OYYA 1XA3A 2QM8A 3FTNA 1MPXA 1SBYA 2VWHA 5LU8A 1NIPA 5A3SA 2YNMD 4F91B 1XDBA 2JJ8A 4U0JA 1KU0A 4XOUA 3H7IA 3TUZC 1QQ7A 4ZAVA 4KWHA 1LBSA 1WXQA 3C8HA 3HDTA 4UNSA 3DZFA 3L0ZA 4MEBA 3DMGA 4O4LF 3MWJA 1BMFD 3F4BA 4QFMA 4CG3A 1G1AA 2LPMA 2CY0A 3HN6A 3OVMA 4Y0AA 3U17A 4EGSA 3I37X 4HEQA 3L49A 4NBKA 3P0RA 2IZOA 4ZQIA 4Y9SA 3CH7A 2W8BB 3C70A 3O9VA 1FX0A 2FUG1 4OBXA 1XKTA 1Z25A 3O73A 4KAFA 4KQHA 1K3UB 4EBBA 1JHOA 2I3BA 1J1ZA 1RWQA 1TPZA 3I9V1 4FLEA 4TV8B 4DY6A 5JH7B 2XGMA 2L69A 3CBQA 4G0QA 4AJ4A 2EV9A 2BH9A 4RYLA 3ZI0A 3A3PA 4KE6A 3LECA 4N5IX 3UMBA 2XITA 2J07A 2BFAA 4EBFA 4R8MA 5CLFA 5KOYA 3GDGA 1EPUA 4C29A 1SRQA 2VAXA 3PR1A 3SC2A 4ENPA 2D5CA 3IAM6 2B82A 3T38A 3TMYA 1A3CA 2UXCB 4ZZ2A 2J7PD 3H2HA 4PR3A 4UAVA 4MUAA 4NFLA 1II8A 2ZWAA 4BNMA 3E84A 1PQWA 3ELDA 3HCRA 4D8XA 5IH7A 4YY3B 1TECE 3MJEA 2JF0A 1SVMA 2ZR8A 2XXAB 2BELA 1H5NA 2Q8QA 5CH5A 2PZLA 1PD1A 1ZC3A 4OI4A 4DDHA 2BM0A 5SYNA 3E7FA 4LEIA 3ND9A 4LV5B 4RK7A 4AUMA 3FUXA 3IOEA 4Q02A 2ZUWA 2QENA 1XAHA 3KJIA 5J4YA 3D6UA 3W9SA 3ZV3A 4BFYA 2NZUG 3TTWA 2Z3ZA 4E32A 4R71A 2DHDA 4S1WA 3FTPA 3ROTA 1VKJA 2F2TA 1PL7A 1N34B 4BX0A 8GPBA 13PKA 1ZU4A 2GVZC 1Y7HA 5EZ5A 3TG8A 3FB4A 3AVPA 4NJEB 4BQSA 2CE7A 1N9GB 4BP8A 1U0OC 3L8MA 1WTCA 1N6LA 1OYOA 1F20A 3EG5A 3GZNA 1WQ1R 3HKCB 3PUWA 2RJ3A 1T1JA 4BX8A 3T5PA 1KO4A 2RGXA 3DH0A 3G8BA 2J08A 3HJHA 4FE7A 2HKIA 4EG6A 3KPYA 4BECA 1KFCB 3GG9A 2QMUA 3RK0A 3THOA 1Q12A 3UAZA 4FGWA 5IFLA 3AC0A 2Q3HA 3DDSA 3BGOS 2KBFA 3S68A 4JJFA 1OU0A 1L5FA 1ZLYA 4B8WA 5BYAA 4YJ2A 1XMSA 2P2CA 4MAMA 2EF0A 4LMRA 2DR2A 2GPSA 3D31A 3EXAA 3K2IA 4HATA 4RMGA 4MI9A 1HETA 4TSFD 1E2KA 1U7DA 3O9MA 1OXTA 2RCNA 3A28A 2J9XB 2O3JA 3EFOB 4FYMA 4K40A 4KPFC 3V1NA 1Y34E 5JNVA 5EJGA 2QAGA 3EZ2A 3OP4A 1MTOA 2I76A 1U3TA 1QIFA 1EJ6A 2VRBA 2GD6A 2W2KB 5F51A 5K45A 3I92A 3OJ0A 3E3LA 4TVOA 2BEVB 4U7FA 3PRYA 1A0OA 2PHZA 3NB0A 1TLTA 1NNEA 4ITVA 2WF6A 1UXIA 4C88A 3MS7A 3PPXA 1XRMA 4TLAA 2XMGA 4I5EA 5DOVA 3W4IA 3WIBA 3DE4X 2HO4A 5IM4F 2Q07A 2XGOA 4W1RA 3OE5A 4XIFA 1QHNA 1BXGB 3PQFA 1UADA 5IT0A 3EF1A 2HA0A 4ZYUA 4RAOA 1LLFA 1JSXA 1Z4LA 2R6FA 2H2GA 3HCCA 3V8QA 4BQEA 3A1NA 1W7AA 2QZZA 3NCTA 3RUFA 3ZJVA 3G9QA 2GO7A 4F0JA 1RDFA 4MX8A 5LM3A 4FFBB 1HTWA 4MKFA 2XWSA 4P7JA 5FJJA 2C42A 1EDBA 2DSTA 4K9DA 4BIIA 1QYDA 3TKAA 1ZM3A 1QNFA 4YYZA 3M33A 3Q5GA 3OETA 4P3XA 4ZV7A 4DIBA 5EHXA 4P53A 1G4HA 3UO8B 4CMCA 1D4FA 2X19A 2AWOA 3BXGA 4EJ0A 3BMQA 4RJJA 3W9YA 1HT2E 1FP1D 1A04A 2B21A 4OU4A 1L3CA 2AJ8A 2DWPA 1YZNA 3SQOA 1H4VB 4AN4A 5MGBA 3I76A 5FTKA 4C3VA 5KDLA 3BF8A 1TF5A 1Y80A 2XECA 3MTGA 3DJFA 3G9XA 4TTAA 3REGA 5CLJA 4MVCA 2UVQA 1WU8A 4QGSA 4GI2A 1DXHA 1CQIB 1F2TA 3RG2A 3L8HA 3ONNA 4IINA 4IDPA 1U63A 3OOSA 4J16A 4BMCA 4Y6GB 4PTYA 3AUKA 5LC1A 1YQUA 3EEIA 3KEMA 4CQLB 1JDTA 1U8CB 2V7PA 4I2NA 4LGCA 3H5NA 7REQB 5HK9A 2EQ5A 4CCYB 5LKRA 4RVUA 3SR4A 3SVLA 1LNQA 2ATXA 9LDTA 4U7TB 4DA7A 1IY8A 4EKNB 1LUAA 4G0MA 1MO3A 1EIZA 4JBLA 4ZTBA 3M81A 3BMNB 3THYA 4LXTA 4US0R 3KPJA 1OWOA 3C8UA 4H1HA 5FUMA 4OUKX 2A2ZA 1TW2A 2ZKLA 4FD2A 3Q8XB 5IM5A 1TYEB 3NAMA 1G9TA 1SCIA 1SU7A 2DHCA 1GKKA 2C5GA 1NAIA 3OTWA 3QI7A 5B58T 4IIDA 4ZI7B 3W1VA 1MT0A 1MT3A 2EGHA 5K0CA 4K9MA 3PHBE 4B9AA 1I7PA 1HEUA 2CNWD 3TPCA 4HLDA 1PJBA 1RI2A 1E3JA 4Z9BA 3V6LA 4E2WA 1OBHA 1U2EA 1RZ3A 2O50A 3IIKA 3SI7A 8OHMA 1E3MA 3PBKA 3HVRA 2LV8A 2Q6OA 3N8GA 4TLLB 3LTEA 1OR8A 3RJ9A 2K2QB 4JJIA 1JS1X 1LXCA 1UFRA 2X3UA 3WB0A 1X8KA 2R6JA 5FRDA 3G59A 4O4IF 3DW1X 1H5UA 3GJZA 1EQAA 3U56A 1WB9A 4LMPA 1G8MA 3EGDA 2PUDA 3UC9A 2G9UA 2AOTA 1TQ4A 3K1AB 4HLQB 5YASA 3TRFA 3NXSA 1BEEA 3PGMA 1NWHA 5HX7A 1PT8A 1E89A 1YO6A 1XTRA 2QU7A 3IAS1 3WO0A 1KS9A 5CDYA 3HS3A 1SIBE 2F8LA 4GXTA 4KIUA 3IX7A 4J0HA 5AW2A 1X77A 1SCQA 1J21A 4CKWA 5K8VA 3U3ZA 4NNOA 5IYZA 1PJ3A 4UBJA 3WK7A 4EHNA 3CKMA 2XH8A 1F2VA 1DXYA 3ICVA 1UMBA 3RRMA 4L6CA 5JQWA 3MZ0A 2YZMA 3G9UA 1QVZA 2GPNA 1L5HB