6LDHA

Refined crystal structure of dogfish m4 apo-lactate dehydrogenase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
329
structure length
329
Chain Sequence
ATLKDKLIGHLATSQEPRSYNKITVVGVGAVGMACAISILMKDLADEVALVDVMEDKLKGEMMDLQHGSLFLHTAKIVSGKDYSVSAGSKLVVITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKHSPDCIILVVSNPVDVLTYVAWKLSGLPMHRIIGSGCNLDSARFRYLMGERLGVHSCSCHGWVIGEHGDSVPSVWSGMNVASIKLHPLDGTNKDKQDWKKLHKDVVDSAYEVIKLKGYTSWAIGLSVADLAETIMKNLCRVHPVSTMVKDFYGIKDNVFLSLPCVLNDHGISNIVKMKLKPNEEQQLQKSATTLWDIQKDLKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase(choh(d)-nad(a))
molecule keywords M4 APO-LACTATE DEHYDROGENASE
publication title Refined crystal structure of dogfish M4 apo-lactate dehydrogenase.
pubmed doi rcsb
source organism Squalus acanthias
total genus 100
structure length 329
sequence length 329
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1987-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 6ldhA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 6ldhA02
2EEZA 3E03A 1QORA 2Z1NA 1NP3A 4HX5A 4P8RA 4A73A 1OC4A 4I1IA 3OQ1A 3SEFA 1GV1A 5DCUA 3PXXA 2WM3A 1ZK2A 4EEXA 2HSDA 2XF8A 4DLBA 3WLFA 2Q1WA 3Q6IA 1H94A 5BQFA 2FWMX 4QSMA 4DIOA 4PLTA 1Z73A 4QUKA 2BFPA 1NASA 3ZU2A 2HDHA 3MTJA 1UUFA 1R4NB 4B7UA 4EUHA 1C14A 2CDCA 1EK6A 4R1UA 1LA2A 5F5NA 5JXWA 3QW2A 4BNXA 3H7AA 4F6CA 2DBRA 3QHAA 4J9VA 3KTDA 3PHGA 3AI3A 5JAQA 3JQAD 2EKQA 3TFQA 1M67A 2FR0A 3IUSA 1E0DA 1WXDA 4AG3A 4O0LA 3WFJA 1P77A 1VJTA 1I3LA 1ZZEA 2E6UX 3WYBA 5BNTA 2NNLD 4XGKA 4CM8B 5GZ1A 4HBGA 1HZZA 2VYND 4R1TA 2EHDA 4ZICA 2FRDA 1LRLA 2GPTA 3UUWA 4CR6A 4FC7A 4WASA 1E6WA 3GOHA 1YOVA 3GMDA 5F1OA 1A27A 1GEEA 4MP3A 4YAKA 4MVJM 1PQPA 2ZB8A 1R4MB 1E5QA 4HKTA 5BNIA 4XB1A 5CEEA 4XIJA 3K73O 4DBVO 5CEJA 1E5LA 4J4HA 3JYLA 1CETA 1Z45A 3I9NA 1GY8A 1C1DB 4BGEA 4EYEA 3TDKA 4JX8A 2VHVA 2D2IA 5DN9A 4RJTA 4R54A 4E12A 3QSGA 3O8QB 4W82A 5HS6A 1L1FA 3LLSA 2BI7A 2J5KA 4FPXA 2PD4A 4BNKA 1I2CA 1YBVA 2F1KA 1E92A 4E2WA 2X9VA 1UP7A 3ZV6A 1K0UA 5AXDA 4BNHA 2GGSA 2JAHA 3GHHA 4CV3A 2YY7A 4I9UA 5A5FA 3KXDA 4LCEA 5DCWA 1N1EA 4JXKA 4EDFA 2O3UA 3G49A 3W4KA 4IZIA 1Y81A 3JYPA 4GVLA 3ANNA 3BA1A 4QEDA 3VZSA 4ROSA 2IDZA 5L7YA 5C7LO 3Q0EA 4YAJA 3VZPA 1T2DA 4AICA 4BO7A 2BGLA 1OZAA 1WDKA 3GHYA 3F5QA 2Y68A 4RVFA 3LC2O 5A05A 3PFWO 2AXQA 5IDYA 2XAAA 3LF1A 3GN2A 1BW9A 3AU8A 2QZZA 4CQLB 1C1XA 1DOHA 1HE5A 1YB4A 1IPEA 4J49A 4LCJA 4R9SA 3TOZA 3UAGA 2Q2QA 2NVBA 3SX2A 4CQMD 4DREA 4YCAA 3K5PA 3RU7A 1DC5A 3JQBC 3GGOA 5KVSA 3SC4A 4D3DA 1WNTA 3UXYA 3ZZNA 1P1IA 1PQUA 3OBBA 5JLAA 2A4KA 4W9NA 5FWNA 4MVJA 5IDQA 3K8ZA 1QLJA 1QYXA 3AUUA 4RZIA 3QVTA 1OI7A 4E32A 2DT5A 2HUNA 4JBIA 4M89A 3JQ6A 4B4WA 3VOSA 4BO9A 2H6EA 4OJNA 2G76A 1PGOA 4WKGA 4MOWA 3HN7A 1HYGA 2Q1SA 4OQZA 4YJDA 4CV1A 1P9LA 4BNLA 4CM1A 4IDEA 2PTGA 3RVDA 5TQVA 2V6FA 4ZHSA 3UW3A 1Y8RA 2ZTMA 2GASA 3RUAA 2Y93A 2Y0EA 2NUAA 4R1NA 1K6IA 4D0SA 1SC6A 4JJIA 3LQFA 1LSJA 1NAHA 3FR8A 1VM6A 3R1IA 3FTNA 4IGEA 1NYTA 1U4SA 3W8FA 3X2EA 5DP1A 1ONPA 3IIEA 4DA9A 1PJLA 1QSGA 2OMEA 1A71A 3LT2A 5ENVA 3TOXA 4BMNA 3DZKA 3OIDA 4BGIA 2B5WA 3PWZA 2NWQA 3RC2A 1EDOA 3IC5A 5LDHA 5BSEA 1AHIA 3PDUA 2I9PA 5CDUA 2NVUA 3CKYA 4IZHA 5I9NA 3TJRA 3RASA 4OKIA 2Y05A 3ULKA 1R0SA 3DBHA 1MB4A 4OO3A 4K28A 3HDHA 2V7PA 3VAZA 4WPGA 4J6FA 2NM0A 4GBJA 1LXCA 3LT4A 1AN9A 5IAAA 5DT9A 4CPDA 2NU9A 1KEVA 4LMPA 4BNMA 3I9JA 1WMBA 3M6IA 4JP2A 4W6ZA 1E6EA 1KY5A 4BOYA 1U9JA 4MJLA 2OBNA 4QECA 1NHWA 2YFQA 2IODA 2DC1A 1Y6JA 4O59O 2HK7A 2CFCA 3G1UA 4L74A 2G82A 2PZLA 4TRJA 5DF1A 1DLIA 1PL7A 1MXHA 1VL0A 3HFSA 2A94A 5F5LA 1P33A 3WGHA 5MDHA 6ADHA 1MP0A 1S7CA 5KJCA 3KEQA 1J5PA 1X7GA 5JSFA 2YYYA 3TSCA 1MUUA 5DNAA 3MJ4A 3K31A 1MA0A 1I3KA 1ZBQA 2C2XA 2WD7B 5KJ6A 4U6SA 3ROQA 4CL3A 2VUUA 3DBRA 3ASVA 3WMWA 3EZYA 1DHRA 1GAEO 1YB1A 1ZNQO 2D3TA 4D46A 3WB9A 2IRWA 2O2YA 2X58A 4NJMA 5JO0A 2VRCA 4WE3A 2IZ1A 3BTVA 3L4SO 3PYXA 4IGFA 1ADFA 3WWYA 1XU9A 4YDRA 3UICA 1PQWA 3WDSA 5JDCA 4YTEA 2Q2VA 4ID9A 1VI2A 3E18A 5I8WA 4CUKA 3GDGA 1JW9B 2XPCA 1DFIA 1V9LA 3ZH2A 3ICPA 3KM0A 3GZNB 1V6AA 2Q4BA 2BFOA 3AJRA 3G0OA 4RO0A 1PEDA 3D4NA 1AXGA 4WGGA 3GR6A 5ILGA 2PD6A 3JSAA 2ZATA 1QYWA 3BXXA 1PS8A 1K89A 3I3OA 2EERA 3KSDO 3S2EA 3JQAA 1KC3A 4D3SA 3C3XA 4AJ2A 1YQDA 2NU6A 3NRCA 1KIFA 1ZW1A 4F3YA 1P0FA 1NBOA 4R01A 3DZHA 2BRUA 3BHIA 5B1YA 1E1KA 4R51A 3TQHA 4HFJA 1GD1O 3RFTA 2VYNA 2ZCVA 4TMFA 5IN5A 1U8FO 1JWAB 3ENKA 1SPXA 4CMCA 5DCYA 1O9BA 3E5MA 5ES3A 5JC8A 4L75A 1FMCA 4WNIA 5JMPA 3COSA 4AJ1A 4FQ8A 2OOSA 4C4OA 1JKIA 4C7JA 4D43A 3NDJA 4OM8A 3V1TC 2CZCA 2B69A 3AWDA 2EF1A 2JCVA 5DULA 3NGLA 2HO5A 2IZ0A 1XCBA 2GSDA 4OH1A 5IDWA 3L9WA 5CPBA 4IBOA 1S6YA 2CF6A 4YBZA 3OJ0A 4DC1A 3HADA 4BUCA 4Z3DA 2C7GA 5G0SA 3IJPA 3ICCA 1UXIA 4FDAA 3QRWA 2WE7A 4ND1A 4J4TA 1UXKA 3CEAA 1HE2A 4WLOA 1MC4A 2GNAA 3LSYA 1EUDA 4Q3AA 4U6QA 5EINA 1GDHA 3NAQA 1BXGA 1U2DA 2AG8A 3HN2A 3LK7A 4R3WA 1U8XX 2B36A 5HRUA 2VHYA 4B3HA 4NBTA 4XZ3A 1GZ4A 2O3JA 3H9UA 3OETA 1K2WA 4NR0A 4E2YA 3RC7A 4CUZA 4P4GA 4CM4B 2VZ0A 2WE8A 2NU8A 2ZJ0A 1GCUA 5COAA 2Q49A 4PRKA 3JQCA 4R41A 1Q7GA 3L77A 5TLSA 2D59A 2FR1A 3WIDA 2HKIA 3WTBA 1G1AA 3RBZA 4BKOA 2C7VA 2FZWA 4DBZA 3DAGA 2O23A 4BNUA 1YBMA 4OL9A 4CQMA 4E4YA 1WW8A 5IFLA 4BV9A 2A35A 4R3NA 3E6AA 3VPXA 2R6JA 2X4GA 1ENPA 1N9GA 2ZK7A 3DBLA 1UXHA 1SBYA 3S2GA 4KOAA 2YV1A 3MWDB 3E9NA 1PGNA 5BT9A 1CRWG 4N5MA 3ORFA 3LC1O 2NSDA 5KIAA 3WGZA 5JE8A 4HNGA 1XR3A 1E3SA 1O5IA 4WCFC 3M2TA 5LCXA 1HSZA 4IS2A 4RPLA 1GZ3A 1E3WB 2AEJA 4S3MA 4XJSA 1BSVA 2GN8A 2V6MA 4HFNA 3DXFA 1NVMB 1C0KA 2GZ3A 2C20A 3CUKA 4PG4A 1GUFA 1TA4A 4GMGA 3GDFA 4IDGA 4NQZA 2RIRA 5U9CA 4A7PA 1Q0HA 4GI2A 2JHFA 2IYOA 3HDYA 5DBFA 4KDFA 1R6DA 1HZJA 4GX1A 5I9MA 4RDIA 3S8MA 5CPFA 1TEHA 3BMCA 3IJRA 4EITA 1RPNA 4PLZA 2HK9A 3VKUA 1RM0A 2EIHA 1VPDA 3N74A 4IS3A 4HADA 3PJFA 4XRRA 4OIMA 5F21A 3ONDA 5COQA 1YBAA 3C7DB 5BSHA 1ZFNA 5ER9A 4IJUA 1I0ZA 2J3JA 2YZ7A 5JDIA 4IMPA 2C82A 4PLVA 4OAQA 3G79A 2JCYA 3PK0A 3QA9A 3T4XA 4XKJA 2DKNA 4RVGA 1KS9A 5FFFA 3GRKA 2PD3A 3LVFO 2X5JO 1SOWA 1GYPA 4BO6A 1BVUA 3SJUA 1E7RA 3ZWWA 2JD2A 2LDXA 1HF3A 1I10A 1ULSA 5IXSA 1PR3A 3M2PA 3K2EA 5TS3A 3W6UA 3GG9A 3DHNA 3HB5X 4F6LA 1WP4A 2VT2A 4UAGA 1VSVA 5EERA 3AY3A 1NPYA 3KB6A 2EJVA 2OHXA 1NWCA 2GUGA 3C24A 1BXKA 2H9IA 4I9HA 4CM5A 4CMHA 3F9IA 4UVGA 3DHEA 1ADBA 1A9YA 2BFMA 2X22A 2ZQZA 3C7AA 4WCFB 5L53A 2I66A 1U3WA 4BS9A 5I9LA 1BTOA 1H6AA 3NT4A 2AA3A 2PKQP 4UEKA 3DZBA 4YPOA 4INAA 3WXBA 3HSKA 1F12A 4JJFA 3BTOA 3H9EO 2E4AA 4MVJI 4YAIA 1D3AA 4DPMA 4P22A 1LU9A 1ZMTA 2Y1GA 1HDRA 4KTTE 1ID1A 1Y5RA 3ZCXA 3EAGA 3H5AA 3PZRA 1W4ZA 3JQ9C 5H81A 4E2XA 3N7UA 2YHIA 3VDQA 3NT5A 2OBYA 3PQDA 3AW9A 4MVJH 2WTBA 4B3JA 1J49A 4NZ9A 5B4TA 2I3AA 5IF3A 1HYEA 3NTRA 2VZ8A 1H2BA 1WWKA 3GPDG 5KJ1A 2VUTA 2VZ9A 3ENNA 3ZDFA 2CVOA 4ZQGA 2O2SA 4DC0A 3E1KA 2GN4A 3BMNB 4DL9A 4XWYA 2BHLA 4GSKA 1UDCA 1ADGA 1W0CA 4YT8A 4O5OA 1ZK1A 4Z9XA 1DC4A 1EEHA 4BNIA 3V2GA 3VDRA 3BZUA 4GKBA 2ZTLA 2PWZA 5JBIA 1P1RA 4Y6SA 4Q3BA 1TT5B 1H6BA 4RQUA 2FPGA 4JGBA 4CUJA 4YJHA 3GAFA 4DMMA 2J3IA 3PYMA 1PL8A 1I36A 3HUDA 3EVTA 5A02A 1JU9A 2HMVA 1PS9A 4ZQFA 1UAGA 4ZD6A 3WLEA 1LQUA 4BL5A 1HE4A 4XYEA 5I7SA 5JYDA 2BGKA 3K2BA 1DHTA 3RI3A 1QR6A 3VHRA 3UF0A 3ZN2A 5G4KA 1R15A 3EK2A 3PQEA 4FC6A 4M86A 4UVDA 4XQ9A 3FBGA 3G17A 4ZVVA 3VC7A 1X0XA 1JVBA 1X14A 3GA0A 3BMOB 4MINA 1MG5A 4FFPA 5DP2A 1X1TA 1MX3A 1M6HA 1E3LA 4XGNA 3IL2A 4UULA 4FR5A 2GYYA 4YRAA 2NU7A 3JQ7B 1SB9A 4HUJA 5TIIA 3KLMX 4CLOA 3IKTA 5L9AA 3HFGA 3H9JA 3DO5A 4XQGA 4L76A 1IPFA 3KYCB 4KUHA 1DJQA 4EEZA 2GZ2A 4PLYA 3I9LA 5K0ZA 5JAIA 3W6ZA 3WX0A 5FF9A 1EBFA 2Y1CA 4AJLA 1PL6A 2UYYA 3CMMA 1E7QA 3KVOA 3ZI0A 3ZHYA 3BMQA 3VKVA 2DUWA 2Z1MA 1OFGA 3OH8A 3EVNA 4IDDA 4FB5A 5IZCA 1QYCA 4ZGWA 5AQ1A 3FRJA 4QQRA 1HDCA 1SCUA 5T64A 2FY8A 5A3VA 1C3VA 1JA9A 4IXTA 1N8KA 4RF3A 3NDRA 3EC7A 2BLLA 4OSPA 2EXXA 5HS4A 3W4IA 5JW6A 1ISIA 1IHXA 3OSUA 2JAPA 3P19A 2HRBA 5TC4A 1P74A 4IQ8A 1T1RA 2VTEA 3DAFA 2Y67A 2IXAA 1LEHA 2J8ZA 3O26A 3IMFA 4LMRA 4Y8VA 5A9SB 3C1TA 1ZCJA 2YDYA 3VPSA 1YQXA 3OJLA 2VRCD 5FYDA 1E7MA 4MKZA 5I8ZA 1WZIA 1B8VA 4EUEA 2F00A 3I23A 1M75A 4Y9DA 1HKUA 4G5HA 1H9BA 4ZA2A 1EZ4A 1T25A 2QQ5A 2GLXA 1NPTO 3VTFA 3HNPA 3GRPA 5L51A 3U49A 1SOVA 4FGSA 4PZCA 2I99A 3A4VA 3AUSA 4F46A 4ALIA 3T7EA 1NM5A 1NNUA 2VWPA 5AXCA 5CDTA 6LDHA 1R4NA 3JTMA 3L07A 4PGFA 3ZWNA 3UVEA 1G0OA 1RM3A 2W2LA 2O3TA 4K9DA 3WTCA 1PJTA 3KZVA 2PKRA 1WMAA 5DBIA 2GDZA 2JD1A 4ILKA 5B37A 4M1QA 1I32A 1WLYA 4CM8A 5IZ4A 3HZZA 4XDYA 5TSDA 3SLKA 4AVYA 5T8KA 3IP3A 4II3A 5BSGA 2Y1FA 2PNFA 3CZRA 4PZDA 1V0JA 1YJQA 1YL5A 4LSWA 5KNLA 1PIWA 4IJKA 4KWHA 4XYGA 3GC6A 2DFVA 3A14A 3DMTA 5DOVA 3UCFA 1TLTA 4NH4A 1IB6A 2R00A 1R4MA 2D5CA 3F6YA 4C7KA 4R4JA 4W9NC 3CSDA 3E9QA 1LSOA 2DBQA 1ZKMA 2PLAA 3FNFA 3D7LA 1Q7CA 4XEHA 1C1DA 4TVBA 5F3RA 4YEDA 5C7IO 1C0IA 1Q2XA 2ZTUA 3DHYA 3O8QA 4XB2A 1ZK0A 3AM3A 2X8LA 3Q9UA 1ADCA 1HL3A 1L7EA 1BRMA 4KDEA 4Y67A 1DIGA 1XGKA 1KEPA 3PTZA 5L3ZA 2DQ4A 3DMYA 2BFAA 4BGUA 4E30A 1LC0A 1EVZA 4J16A 5JFOA 3RKRA 3JQEA 5EQFA 4E33A 1VRWA 1T24A 3KLPX 4A2CA 3TL2A 4GWKA 3ANLA 4NDNE 4PCVA 2HU2A 2JFHA 3PLNA 1D4FA 2EW2A 3NX4A 3WGIA 2VHXA 3H6KA 3IS3A 1LTHR 5LDGA 4I8XA 2HMWA 4FFLA 4LRTB 1LI4A 3S1LA 4E2ZA 4CM6A 4RVUA 4BO0A 1E3JA 3GEMA 4CQLA 2XOXA 3UH1A 1GPDG 4IIVA 1LRKA 3GMSA 4CMKA 3L4BA 4OHUA 2DVMA 3ZWXA 3ZU5A 5EJ2A 1DC3A 1PJQA 2CNBA 2VOEA 4XDZA 4YVFA 3ABIA 3WYEA 1IE3A 3JV7A 1VL8A 4UUNA 1T2CA 2FP4A 3GZ4A 1LJ8A 5COBA 4QFCA 3D4PA 3I4CA 4NJOA 3HG7A 2GERA 5FI5A 3ST7A 4N5NA 1ZK3A 3I83A 3RJ9A 3V1UA 1TVEA 5C3MA 1T2AA 4WLUA 1K3TA 1P0CA 3R6DA 5EESA 5JO9A 3F4BA 1U1IA 5KVCA 3VPFA 2V6BA 1P45A 2VOJA 5JYEA 4DWVA 1TI7A 2W98A 2BGMA 1H0KA 1ZEJA 3GT0A 4FIZA 3F1KA 4EZBA 3C7CB 1MXFA 3CH6A 1J0XO 4PLPA 3W4JA 3DFZA 5L95A 4P38A 4E5PA 3CMCO 2X9GA 2Q99A 3RIHA 1MFPA 2B5VA 1ZSNA 2X0IA 5JNLA 2AHRA 4W7IA 5A5EA 1B2LA 1DDOA 1ENYA 4I5EA 3AU9A 5C5IA 4E31A 1AXEA 3Q9NA 1ONOA 3JD1A 1GUZA 5MGBA 1DC6A 1YJ8A 2WSBA 4J4BA 1TXGA 4BHTA 1ZEMA 1U7TA 2ZJ1A 4U0JA 5JAZA 5BR7A 3TL3A 1PZHA 2HMUA 4XYBA 4PG6A 3KUXA 2C5EA 3AY6A 1XWFA 3D3WB 3I9MA 3FR7A 4TKMA 4BO1A 4L4SA 4PLWA 1R12A 1ENOA 2P4HX 5THKA 4GVXA 1KOLA 3AK4A 1ZVMA 2R2GA 2H1SA 4PFJA 4BIIA 1PU2A 4TRRA 1NVGA 3OA2A 1W73A 2B4TO 2I5PO 1EQ2A 1PJSA 4IMRA 1SZJG 3JQBA 1EBUA 3RD5A 4LISA 3TPCA 1J6UA 3DBVO 1LLCA 4MVJP 3D5TA 1GYQA 1WPQA 2EGHA 2O7SA 3QWAA 3FNEA 1XG5A 4J90A 1CDOA 1PR9A 4UUOA 2J5QA 4D44A 2WD7A 4NU6A 4E5MA 1WZEA 3WFIA 3KHUA 3AI1A 4CLRB 3JD3A 1MG0A 4WOJA 1UAYA 1Y8QA 2FSVA 3I9OA 2VT3A 4Y98A 3OFSA 4RVSA 4PIVA 1DJNA 1RJWA 3ITKA 1ZJZA 3VH3A 1PZGA 5AVOA 4BKUA 5K6AC 3WWZA 2RH8A 2E48A 1DB3A 3UN1A 2FSSA 7ADHA 4R16A 3AOEC 3ZNOA 4PZEA 4XCVA 5AYVA 4WLVA 4R5HA 1EDZA 3GGPA 3GZNA 2AE1A 4HY3A 3PGXA 4CV2A 3DDNA 3FWNA 3FNGA 3QQPA 1X15A 4KUEA 2VWHA 2VWGA 3NJ8A 3NTQA 1Z75A 3SBOA 4OOEA 4MVJG 3TWOA 2YFHA 4B8WA 3RUEA 2DAPA 3V2HA 1E3EA 5JC1A 4RZHA 5TGDA 3WNVA 4GX5A 1N92A 4GLOA 1VJ1A 1LDNA 1N2SA 3WJAA 4AJIA 4CR7A 3JCZA 5KVVA 4KWIA 1KVSA 5L45A 1VKNA 2GN9A 3B1FA 2PFGA 1ISHA 4B3IA 3OECA 3PJDA 1U5CA 4UVHA 4OSOA 4ND3A 1NXQA 2NQTA 4RQTA 1Q0QA 4KP7A 3U4HA 2PV7A 3KYDB 2VHWA 1I8TA 1HRDA 2EV9A 3HHPA 4B4VA 4E0BA 4UVEA 3JQFA 3ITDA 1N7GA 4J2HA 2FMUA 1U3UA 1R37A 3ROKA 4BKQA 3GUYA 3IQDB 5TT1A 1P1FA 4RL6A 1KYQA 3INRA 4JCOA 2D8AA 5JMWA 1WAMA 4ONEA 2G0TA 3INTA 2DPHA 4AJHA 4CMIB 2O48X 3AM5A 4CLXA 2NTNA 2RHRA 5EL0A 1QRRA 4FJ0A 4XQCA 1LDEA 1GYRA 2G5CA 2GF2A 2FR8A 2P9CA 3A06A 3ONEA 3RQSA 3X2FA 1P1JA 1NR1A 3D0OA 4RPKA 4ITUA 1R0LA 3DL2A 4Z6KA 1NPDA 5HTOA 3PIDA 1FDWA 3ANMA 3EGOA 3W8EA 4IM7A 5KTKA 3VVCA 4MVJF 4BMSA 5JAMA 1VKOA 2DTEA 3PDJA 3OIGA 1EMDA 4JNKA 1X1EA 2JHGA 2W4QA 3QVXA 4Q3CA 4NBUA 3D5QA 5DBGA 1SNYA 5F1PA 3ZHBA 4IDFA 2NADA 1HYHA 1CWUA 2YV2A 4N18A 3GVXA 2PR2A 3W1VA 3CE6A 3QVSA 1YL6A 3WSVA 3M1AA 4PN3A 1O6ZA 4CLDA 2QHXA 3QWFA 4IDBA 4WLEA 2VCYA 3U62A 5JCXA 1U28A 3H4VA 1K6JA 4Q3EA 3LZ6A 1EVJA 5IN4A 3QE3A 3ZWMA 4I5GA 4HP8A 1EE9A 4KQXA 5JY6A 4YT5A 3TZKA 3QLJA 1PJ2A 4BKPA 1V3UA 2EP5A 2UVDA 4GL4A 1ZSYA 3MWEB 2POQX 1LQTA 1M6WA 4CR8A 2AQKA 1DXYA 3GF4A 1SEPA 1IY8A 1MV8A 1YQGA 1ISFA 3HJAA 4K1LA 1LBEA 3IUPA 1XQ1A 2QYTA 2ET6A 4CQMB 2EW8A 1T2FA 3DR3A 1DLJA 2CUKA 4CV0A 3TRIA 5A06A 3C1AA 3IP1A 3NGXA 2W2KB 1J4AA 4H15A 1B14A 1E3WA 1V35A 3HDJA 3E9MA 4XX0A 1E1NA 1XIVA 5KVQA 1DRWA 3F47A 4RF4A 4X54A 4M54A 1SMKA 3FCOA 1P1KA 3K30A 1LNQA 1NQAO 3UHAA 3ZHXA 4AJJA 4G65A 3JD4A 2DTXA 2A92A 2X5OA 3QWHA 3UCXA 2P4QA 2P91A 3BTSA 3SVTA 2HAEA 1KVQA 3JQGB 5ITWA 3GVHA 5TJ9A 3QP9A 3LDHA 3DZIA 2BKAA 4NNJA 1EUCA 3U4IA 4BB5A 1VC2A 4WEQA 5KWEA 3AUTA 5H82A 1A72A 1P3DA 3NUGA 4I5DA 4OGWA 2W2LD 8LDHA 2C5AA 4CODB 4K26A 4O1MA 4URFA 1GZ6A 3D64A 1Q0LA 3KBOA 1XQ6A 2Q4EA 3G3EA 1NTOA 3UFXA 4DQXA 4RLHA 1VSUA 1SEVA 1Y1PA 3WICA 4L9RA 1I24A 1QMGA 4FFMA 1H93A 3K92A 4ZJUA 2CMDA 1B16A 1FDVA 1U3TA 3PVZA 2QZ9A 3NT2A 2VN8A 4UREA 2X6TA 3FPLA 1FDTA 1N1GA 2VQ3A 3SXPA 1A7AA 4I5FA 4NHEA 5TX7A 2W90A 5CG1A 1WDMA 2VYVA 2W8ZA 3BHMA 4YWJA 3ONFA 3ZV5A 3ZU3A 1Z7BA 2DUUA 3I5MA 3KYBA 1LDYA 2I3GA 5G4LA 3RC1A 4P4LA 1NWHA 3CZMA 3NYWA 1HDZA 3DAPA 3GEDA 2IXBA 3DFUA 4EJ6A 4W4TA 2C07A 1GL3A 4KUGA 3H8VA 3R3SA 3S2FA 1HT0A 4LVUA 1EK5A 2WJPA 1RYDA 2IEDA 3S55A 2O50A 3JQDA 3P5SA 2P9GA 2C2YA 2VRBA 1KY4A 3KETA 3DONA 4MO2A 3ROMA 4ESOA 1DAPA 4MVJE 4J3FA 2AE2A 1PSDA 3QWBA 1OAAA 4NIMA 4WCFA 4QO8A 2WD8A 4RVHA 1NR7A 4DTIA 1PJCA 1AUPA 2AG5A 4CMEC 9LDBA 1HXHA 2QRKA 4MP8A 4TRMA 3Q11A 1I5RA 2G17A 4YRDA 5A9TA 3K9QO 2NACA 4TROA 4B4OA 2FZEA 2QW8A 4MIYA 4A03A 3PYLA 1ISGA 1JKFA 1PZEA 1IUKA 2G1UA 3MJCA 5G0WA 5I7VA 1MC5A 1EE2A 3HB4X 4NK5A 4BNWA 1K6XA 3GNSA 3WMXA 4E5KA 4BNGA 3FTPA 1I3NA 1DFGA 3AI2A 4IUYA 1YB5A 2P2SA 4E21A 1DO8A 1W8DA 4DLLA 4CL8A 1UH5A 3DB2A 4YJGB 4ALNA 4CM9D 3UCEA 2RCYA 4GH5A 3WGGA 4R1SA 3KO8A 5T6BA 5ICMA 4XQEA 1YDEA 5CG2A 4DLAA 1AHHA 1T1SA 1F8GA 2O3QA 4BO5A 3CTMA 4UEJA 4Q9NA 5EQDA 3JQ8B 3MJVA 3U3XA 7MDHA 2DLDA 2AQ8A 1BDMA 2OZPA 1H6CA 3ZHZA 3SLGA 4RPJA 1LDBA 2ZB3A 1NAIA 2AQHA 5JCJA 2HMTA 4EJMA 1D1SA 3GQVA 2HJRA 4WEOA 4JN6B 1ENZA 3MJEA 1D8AA 1GV0A 1TT5A 4ALLA 4JQCA 3JYQA 1IZ0A 4L0QA 3RSHA 4NBVA 1M2WA 2QIOA 5A9RA 3I4FA 1H6DA 2AMFA 3FD8A 4OQYA 1XKQA 3RFXA 1GTMA 5ILOA 2D1YA 3RUCA 3HWRA 3TFOA 3O4RA 1WVGA 2BMAA 4TZKA 2JD0A 3ZWAA 1MGOA 4XD2A 4LSMA 3ETEA 4HWKA 3MOGA 1ZSVA 1DEHA 2I6TA 4J9UE 4GQAA 3ZW9A 4PG8A 3PWKA 4AFNA 3GH3A 3VH1A 1B15A 4M87A 4U8GA 2Q3EA 3BMOA 3OICA 4IPTA 4KQWA 3N58A 2C54A 3NDIA 3PWSA 1Q1NA 3O03A 5A04A 1M76A 2Y0CA 4BVAA 2Q50A 3KSUA 3OA0A 4DYVA 3H3JA 1I33A 1N5DA 1HWYA 4BV8A 3KRTA 5G2OA 3JQ7A 4LN1A 3DOOA 1ZH8A 3JQ9A 1UZLA 3KYCA 1RKXA 2JL1A 3V8BA 1XU7A 2AW5A 5GZ3A 3IOYA 5EN4A 2PZMA 3GPIA 4FGWA 3QWIA 3JYNA 1AE1A 3AFMA 1QYDA 4D45A 1YXMA 1JLLA 3AY7A 4J7CA 4B8ZA 2OO5A 3LT0A 5CP8A 1MLDA 4YJFB 2WWRA 4QTZA 4DQUA 2B37A 3M1LA 3RAJA 3ZWVA 3NEPX 5KKCA 1ZUD1 2C59A 3LC7O 4MIOA 4XR9A 3WYCA 1QYVA 2GO1A 5IDXA 1DRVA 3GAZA 4B4UA 3ZWOA 3I9KA 1FDUA 3H9QA 2JFGA 3ZV3A 1GEGA 3DMTC 5A9SA 3LF2A 2JFFA 4KMSA 2YDXA 4QX6A 4TQGA 4ALKA 4CMBA 4CJXA 4YACA 2B0JA 1I2ZA 4MIEA 3ZU4A 2UV8A 1D7OA 4II2A 3WNQA 4BNZA 5T5QA 1CYDA 2YQ5A 1HLPA 2OGUA 1U3VA 1YE3A 2BD0A 3LLVA 3MCVA 4GSLA 4QO7A 4F45A 4I08A 4M55A 2DBVO 1IL0A 3DZJA 4FCCA 4WUVA 2NTVA 2WYUA 4NMHA 4TVOA 2IE0A 4FSHA 3V5NA 2Z95A 2CVQA 3A1NA 4JIGA 4DRYA 4BO4A 5AXBA 2WEKA 1ZXLA 3QVWA 4CLEA 3QJ5A 3G1TA 2UUOA 4UUPA 3U4DA 1BVRA 1SAYA 1EFKA 3GVIA 1IHYA 5BNFA 2QX7A 4FOSA 3PEFA 4HXYA 4XIYA 4RVDA 3RUHA 4ALJA 2QYSA 3INGA 2QRLA 3GG2A 5A3JA 4ND4A 1JVSA 5ADHA 3WIEA 1YH3A 1UP6A 1YWGO 1JAYA 1UZMA 4L4RA 4RGBA 4Q3NA 4IXWA 4GAEA 4D41A 4LRSB 1V8BA 5BSFA 3FWZA 1GR0A 5EPOA 2NLOA 4IJVA 3L4BC 3VTZA 5KJEA 4PLGA 3H2SA 3ZNQA 1B7GO 2FN7A 3PPIA 1ISMA 3PHLA 3QVOA 1D1TA 2BI8A 4J2OA 4Z0HO 2CVZA 4DXHA 1EQUA 2RAFA 5L4LA 1ZO8A 4Z9YA 1DIAA 5I7EA 4IQ0A 2I76A 3NTOA 3RC9A 2ZYAA 1FDSA 2YW9A 1YOVB 3E48A 2ILTA 3BAZA 2RHCA 3EDMA 1DIRA 3MZ0A 3WGTA 4RORA 1RM4A 1YVEI 2J3KA 2Y1EA 1E77A 1ML3A 3H5NA 5IG2A 4JP3A 2XXJA 4ZQHA 2X1HA 1IYZA 2ZQYA 4D0RA 1L7DA 4J91A 4E5NA 3ZNNA 2X0JA 4WLNA 3GN1A 1G6KA 1R0KA 4PLCA 4YAEA 3AFNA 1LLUA 2C0CA 3I6IA 2EJWA 4RV9A 2E82A 4LGVA 4Z9FA 5JY1A 1XSEA 3DWFA 3DTTA 3EUWA 1YRLA 3F46A 4GLLA 1BMDA 4ALMA 2UUPA 2Q46A 3F3SA 3WBBA 4CM7A 3OJOA 5A4DA 1EVIA 2VTDA 3ZV4A 4CM9A 4J1TA 1ARZA 3EYWA 3K96A 2YHUA 2JJYA 4FN4A 2UDPA 3A28A 4DGSA 1CERA 1Z7EA 1B0AA 3U0BA 5HWSA 4FFOA 2AQIA 1DAOA 4WLFA 3ETGA 2HK8A 3NKLA 4J7UA 4AJ4A 1DFHA 2YUTA 1B3RA 3GFGA 1HTBA 2CDBA 1BW9B 3MOIA 3GUCA 3WQQA 1FXSA 1ZK4A 1C1XB 4NBRA 2D5AA 5A1TA 1I3MA 4Q3DA 2ZKLA 1XYGA 2AEMA 3U4CA 1I01A 1PGQA 2EP7A 1QV6A 5CHEA 4AJEA 4P4NA 4ZU3A 1U5AA 5AOVA 3WQSB 1WDLA 5CDGA 1GCOA 3GVCA 2Q1TA 1YONA 4ND5A 4EI2A 1YS4A 3UGKA 2E49A 2VNSA 2OUIA 1NQ5A 3GFBA 2Q1UA 1QKIA 2V6GA 2YQ4A 4YXFA 2Y1DA 4WJZA 3F1LA 1AGNA 2J6IA 3AM4A 3C85A 4YR9A 1EVYA 5AXAA 3ADPA 4MKXA 2NVWA 5HM8A 3PIIA 1F0YA 3H9GA 1Q7BA 3QY9A 3ASUA 1OBFO 4U0KA 5IJZA 3TN7A 3IDSA 4FJ1A 1Y8RB 4L4XA 1HEUA 3E82A 2X0RA 4G81A 5JDCC 2H5LA 1LLQA 2LDBA 1KERA 4WCDA 2Y66A 4DIFA 4IDCA 5KOIA 3PHHA 3BYZA 1A5ZA 4MPDA 1N7HA 1YGYA 4BO2A 4BQPA 3WBFA 1DBVO 3BHJA 1DRUA 4A0SA 1OC2A 1XELA 4NFHA 3RROA 4AL4A 1XA0A 4RCVA 3L9XA 3D3WA 1C0LA 4XR4A 2NVUB 5DOZA 1PJBA 2X7HA 5HA5A 3I1JA 3EMKA 4BB6A 2A9FA 4MP6A 3ADOA 4I9NA 1HE3A 2VYVD 3D4OA 3DBHB 1BDBA 5TF4A 2HQ1A 4H3VA 3ZWPA 4OMUA 1ZJYA 2O7QA 5B12A 2CSUA 4IY1A 5ENDA 1CF2O 1LC3A 4RPGA 2P5YA 3TZQA 1Z82A 3LT1A 3DOJA 2Y99A 4AJPA 5CAEA 4MDHA 3D1LA 2ZIZA 2PK3A 4GX0A 4XYLA 3UKOA 3SJ7A 1C0PA 3GVPA 4PLHA 1U7HA 3B70A 4A10A 1LSUA 3O9ZA 1IZ9A 3PRJA 4OXYA 4DUPA 5CEFA 1KBZA 3HE3A 4YQZA 4ZQEA 5H83A 1MFZA 4QT0A 1E7SA 2EWMA 1PJ3A 1QXSA 2P68A 3OF2A 4GPD1 4WECA 3PLRA 4CLRA 1UP4A 3JQFC 3NJ4A 3V1YA 2TMGA 5G0TA 3WGYA 3MJSA 3Q2KA 2DFDA 2WMDA 3B6ZA 5EMHA 4D7AA 5F1KA 3F4LA 3BIOA 4PRLA 4JK3A 3BTUA 3VH2A 1GFSA 3DBRB 1H2HA 1VL6A 5J23A 1A9ZA 4NJMB 1GUYA 3U5TA 4YYZA 1B3BA 2JCXA 2QRJA 5I7FA 4NU5A 4FFRA 1FF9A 1Y8QB 1B8PA 4HFRA 5T57A 4B7XA 3WGQA 4BNNA 4HV4A 3WOHA 1PZFA 4XYMA 2VWQA 2P5UA 4DYDA 5ITVA 5L4SA 2X86A 4A26A 3NV9A 2O4UX 2PZJA 5T67A 1GU7A 3R0IA 3RUIA 3CIFA 1UDAA 2I67A 4YT2A 4NBWA 2X23A 2DTDA 4Y6PA 5TRTA 3F5SA 4BNVA 5JCJD 2GRAA 2GD1O 1QG6A 1KEWA 4TWRA 4TSKA 4OXKA 1OOEA 2DU8A 3JQAB 3U9LA 4FS3A 4L73A 3IAHA 1O94A 4YA6A 3H65A 1EUZA 1JAXA 1P31A 1YKFA 2B4QA 3KOUA 3KYDA 3WR5A 4G2NA 2IZZA 1JDJA 3I52A 4LK3A 3RFVA 4EJ0A 4BNJA 3LU1A 3RUFA 1XEAA 5G0VA 4HNHA 1VJ0A 4OXNA 3DZGA 2PZKA 4D42A 3P2YA 4A5OA 1LSSA 2HMSA 3JD2A 4UEOA 1NFRA 2JKVA 1QP8A 4JBGA 1NQOA 1G0NA 2PGLA 1PX0A 4E3ZA 3AUAA 2DPGA 4JBHA 4BNTA 2H63A 3OMLA 3MTGA 1Y5MA 4CMIA 4PVDA 3FHLA 1DIBA 3GY0A 1JN0A 4WK6A 1X0VA 1T2EA 3KEOA 3STHA 5TJHA 3S2IA 2EKPA 5K9ZA 3FPCA 4Z0TA 1TT7A 5K6AA 4CM4A 1E1LA 1RWBA 5ER6A 5JS6A 3IKVA 1UXJA 3AOEA 3FSRA 2FOIA 1VE9A 2GN6A 1BXGB 4OYRA 3PQFA 9LDTA 2YV3A 3PGJA 4TZTA 4EUFA 2ZB4A 2ZTVA 3FN4A 4CM3A 4NG5A 1GQYA 4Z0PA 5CFZA 2RH4A 5L40A 1PGPA 1O8CA 1GADO 4MKRA 2O3SA 2GZ1A 4W7HA 1GPJA 1KETA 4WOKA 3WQRA 4BNFA 5JDIC 1DIHA 3PHJA 4J1QA 4JJGA 1R16A 1PGJA 1Y7TA 1U2GA 3K6JA 5TT0A 5ICSA 1YDWA 1Z6ZA 2ZYDA 4GMFA 5KKAA 4ND2A 5LC1A 2OP1A 1YL7A 1PWZA 4AJOA 1W6UA 2NQ8A 1E7WA 3L0DA 2Q2WA 1JKJA 2ZB7A 1A7KA 3DOCA 3E8XA 4H16A 4BO3A 2CF5A 4DIBA 1K5HA 3EZLA 1NFQA 4CMGA 2PA3A 1CEQA 3GNTA 3ZW8A 3L6EA 3MJTA 1UZNA 2WDZA 3EY4A 1N9GB 5L7WA 2W2KA 3C1OA 3DBLB 3DEYX 2OORA 1ISJA 3L6DA 1A4UA 3T7CA 2SCUA 2BF7A 1H9AA 3Q2IA 3PHIA 4XA8A 3TF5A 4H7PA 4RDHA 1HSOA 4DVJA 1T4DA 4B79A 1B8UA 5HBRA 1RYEA 1V3TA 3JQGA 3B1JA 1KVUA 3GDOA 3A9WA 3PJEA 1NVTA 3L6OO 4GX2A 4B7CA 5L7TA 2NTJA 3OJFA 1IOLA 4ZRMA 4R69A 3RUDA 3CXRA 3VVBA 2IYPA 1E3IA 2IEBA 4N5LA 4PLFA 4ZRNA 2PH5A 1ORRA 4PG5A 3WJ7A 2D0IA 1GQ2A 2PH3A 5B4VA 2O4CA 2FPIA 1QLHA 3BMCB 1CIVA 1O89A 3OQ6A 2OP0A 3OHSX 1TB4A 2GCGA 1CJCA 4LW8A 1ULUA 2HJSA 2WYVA 5GY7A 1LDGA 4UUMA 1GQQA 3B20A 3QIVA 1ZIDA 1FJHA 2AEFA 4Y6RA 2GR9A 3P7MA 4D79A 5GZ6A 1NHGA 2C29D 4N7RA 1ZXBA 1SO8A 2EGGA 2P9EA 4HFMA 1DPGA 4NI5A 1O95A 4FW8A 5KCZA 1RM5A 3ROPA 4PG7A 2PKQO 2I65A 2D4AA 3RKUA 2Q45A 3MEQA 4XRGA 3DZFA 3ZWYA 4E5YA 1Y9EA 1ZMOA 3ZWCA 4DPKA 4GGOA 4K6CA 8ADHA 1XLTA 3HQ4O 4J7XA 5FI3A 5CDSA 1VLLA 3OIFA 3PZBA 3ZWBA 3P2OA 3WGOA 4M8SA 2WYWA 3CPSA 4KZPA 4IIUA 2QG4A 4GWGA 4DQVA 4OKNA 1NFFA 3TZCA 4W99A 4LVCA 4RF5A 4IDAA 2DBZA 3GGGA 4RLSA 5JPIA 1ONNA 4J43A 1PJ4A 3HDQA 4FFNA 1BXZA 1KEUA 3RWBA 4AJKA 3RCBA 4YJGA 5GMOA 2VHZA 1P1HA 1Y9AA 4K6FA 3W8DA 4IQGA 3PI7A 3WSWA 2UAGA 2XXBA 1F14A 3ON5A 3FNHA 1HDGO 1F8FA 2B83A 1UXGA 2EKLA 2NV6A 2YHIB 3BMNA 4PVCA 3O38A 4O6VA 1X7HA 3TNLA 4NPCA 2YJZA 1F06A 4J0EA 3JQ8A 3KSZO 2E37A 5KJFA 1PS0A 4S1VA 1EFLA 3LYLA 3OM9A 4J1NA 4J0FA 1JQBA 3TZHA 4EW6A 4D3FA 3PP8A 4Q39A 3VZRA 2B4RO 1QV7A 1SB8A 3PFFA 1DSSG 4YT4A 5EIOA 1JTVA 5C37A 2FPPA 3VPGA 5IZCC 5THQA 3OQBA 4TRNA 3T4EA 1HDYA 1HETA 3V2UA 3FF4A 2CY0A 2Y1OA 4NFSA 3GEGA 3QV1A 3ZGYA 1PTJA 3WG9A 1LRJA 4MVJD 4O63O 3U09A 2BH9A 3OEWA 1E6UA 2RBEA 4FOOA 4BMVA 1B26A 3OEYA 1A4IA 5G0UA 3VPHA 4YJHB 3H3FA 1CQJA 4A27A 1LX6A 2J5RA 4YAGA 2CD9A 2VUSA 3DC2A 3JD0A 4JROA 1BHSA 1R66A 5DDIP 2DM6A 1LDMA 1M66A 2J3HA 1UDBA 2O3RA 4UVIA 4YB8A 5A03A 2B35A 4U5QA 4CMEA 2X5KO 4XGIA 3EW7A 4AJNA 1T26A 3D3EA 4FJ2A 5G4KB 4BQRA 4E6PA 4FBGA 2PY6A 1NQTA 1JWBB 2PGDA 4R5MA 5FEUA 4RF2A 2HLPA 4EBFA 3RBVA 2TMDA 1LLDA 2X9NA 3SC6A 5B4UA 4FD3A 3ETDA 3JYOA 4IJWA 2BELA 1XDWA 4E13A 1X13A 3Q1LA 1O0SA 4M49A 4KTVE 4CLHA 1E7YA 4BGVA 1KC1A 3EHEA 4YQYA 4WNCA 2OL4A 3DTYA 4BNYA 5C7OO 3VH4A 2PGJA 1I30A 4IINA 4CLOB 2OFPA 3C8MA 3Q3CA 3RJ5A 4QFDA 1KVRA 4XJTA 1CQIA 3OP4A 1Z74A 4ZQBA 3H2ZA 4OOFA 2X0NA 1H5QA 2ZCUA 4NK4A 1U4OA 4YJFA 4EGFA 3OJEA 4BO8A 4DPLA 1P44A 1XHLA 4J1SA 3GK3A 4R9RA 4YRBA 3VZQA 5CDYA 5T8KC 3FBTA 2Y0DA 1BGVA 1F17A 3RU9A 5U1PA 3CINA 4RPHA 2CDAA 3UOGA 1IULA 5L4NA 1E1MA 1X7DA 4GKVA 4N54A 4NFYA 5IXYA 3BMQB 1PWXA 2FHSA 1NX6A 4GGPA 5DZSA 1LUAA 2EG9A 2VNAA 3FI9A 2HCTA 4L8VA 4U7WA 3WS7A 1OMOA 1BWSA 3E5RA 2R00C 4Z3KA 3TZ6A 1V3VA 2HRZA 4ZN6A 2V65A 1KVTA 3GLQA 1I2BA 3GNQA 4BKRA 1FK8A 1HDXA 4CMAA 5U4QA 4DMLA 3PJGA 3H5RA 3ZNPA 3AOGA 1BG6A 3I6QA 1UJMA 1T4BA 4CMJA 3RBXA 1UR5A 3B1KA 4R68A 5TNXA 1HDOA 3KV3O 3R3JA 4QXMA 2Z5LA 2OXIA 1YO6A 4JLWA 4TKLA 3DQPA 1HLDA 2ZYGA
chains in the Genus database with same CATH superfamily
2EEZA 4C0KA 2Z1NA 2IWRA 4BLSA 4E88A 1JJBA 1FP4B 1OC4A 2H4XA 3KP1A 4EL5A 1WEHA 3WXMA 4RD3A 1SUIA 3A7DA 4F92B 1LK7A 5LYJB 2ZUEA 1CFJA 1LWOA 3ANXA 3PXXA 3T94A 2DWUA 4WFKA 2G36A 4LIPD 1N0UA 1T0JB 3SYMA 4MJ3A 2XF8A 3R7WB 1ZMRA 4G3XA 1H94A 4B2LA 4NBSA 2ZBQA 3TNYA 4PLTA 1Z73A 2O8EB 1KSGA 1S1CA 1VZ3A 3ZU2A 4LC9A 4ZCRA 1T2VA 1CIPA 1HOXA 4MDFA 1U8CB 1RDFA 4GZLA 1C14A 4BWFB 1JFRA 5F5NA 4N3CA 4EYOA 3QW2A 2QLFA 4C7BA 2O0LA 3H7AA 2XGMA 4RH1A 4F6CA 3PHGA 1KJZA 5BQPA 5AK5A 3K7EA 2C7QA 4KPUB 4E5VA 4JLUA 2EKQA 1IM5A 1X3LA 3QVGA 5IANA 2FR0A 2QG6A 1NSTA 4ZO4A 4TKVA 3W7AA 1AKMA 1FJXA 2CNDA 1VJTA 1I3LA 1NE2A 1ZZEA 2EDCA 2QTVA 1ACJA 2E6UX 3B1VA 3LUJA 2D0PB 3MWLA 5TV2A 5BXYA 2VHQA 1F7UA 3TEMA 5GZ1A 3SSAA 3EIOA 2VYND 1V9CA 4QPDA 4ZICA 2VYCA 1G7CA 4E1AA 5JAPA 4QDJA 1J8DA 2GFIA 2GTHA 2UZ0A 2ATVA 5ES4B 1E6WA 1YOVA 4YI5A 4YJ2A 1O1YA 4PC6A 2JBHA 5EKTA 1A27A 2CJXA 4MP3A 1C7EA 1LK0A 3KV1A 4BZQA 1R4MB 1S2LA 4KIJA 4HKTA 4A2WA 1S7GA 2ZE8A 4B43A 4RYDA 4XIJA 4DBVO 1E5LA 4KBFA 3ZDRA 1CETA 1G18A 4V0NA 1N4DA 3DT8A 4LYYA 1SUEA 1CF4A 1K7EB 1NYRA 1RC1A 4LOIA 3TDKA 1NI4B 4ENRA 4C9BA 4X8OA 3QSGA 2AMJA 3FOBA 3COWA 3CT6A 3C8DA 1VJGA 1WS6A 3H97A 3IUMA 3E22A 4IFIA 2JCSA 3CM0A 3LLSA 4JELA 1J99A 1GG2A 3N0XA 4MB0A 2D8MA 4PSUA 4TM7A 1M1YB 3TAHA 4BNKA 2PMDA 5ALEA 1RAAA 4E2WA 2QPAA 1I4DD 1UP7A 1UEXC 3DV0B 3L0ZA 1I7PA 3CSUA 4QYMA 2EQAA 3URMA 5FLYA 4YRNA 4HNAA 4I9UA 1J9EA 4EA7A 5I7HA 5DXFA 2R1ZA 1E63A 1M2FA 1J1ZA 1SVUA 2I87A 5EMJA 5P8WA 3F2VA 4IZIA 1FDIA 1Y81A 3EXEB 4HRYA 2ZAGA 5H1YA 3S8EA 3ANNA 2BFEB 2PRIA 4IXDA 2PMFA 4ROSA 2IDZA 3O75A 4KXNA 1RWNA 3H1TA 5B1EA 3P71T 1KEZA 2BGLA 2P3LA 1OZAA 3IR5A 3ZE7A 5LBIA 4H4EA 1JG4A 4GC5A 1RWPA 2JI4A 2DWCA 1TA0A 1BH2A 2EIXA 1SVMA 2CNWD 3B3GA 3E2PA 3HBAA 1E2EA 3TOSA 5BNWA 4RVFA 4PYKA 4M0PA 3LC2O 1JHMA 1G8JA 1VYHA 2I8AA 5FO0A 1VIYA 2AXQA 2XTNA 3GN2A 3LHFA 3UJPA 3ZY6A 5DRTA 3JWGA 4CTMA 5JQGF 2QZZA 3DVAA 3R3WA 1DARA 2XUZA 1DOHA 4LCJA 4Q6WA 1XXHA 2Q2QA 3AEYA 2V03A 4DA0A 4DREA 1DV1A 1EWRA 5AI6A 2R8RA 1OWOA 4W1PA 4RIEA 1WNTA 3UXYA 3LPMA 5CD1A 3OG9A 3A3YA 4ATNA 1PQUA 1PLLA 3HA2A 3UGTA 4I66A 3F9CA 3VR5A 5FWNA 3FKSA 3FWHA 4MVJA 1XVUA 2YVAA 4OCZA 2ICAA 3U7FB 1WY7A 1QLJA 1KBOA 3M83A 4FT4A 4F9FA 4RZIA 3UEOA 4YXWD 3QVTA 1OI7A 4CWAA 1MAWA 4GNRA 1J0DA 4MCJA 3O4JA 5IBQA 1PVDA 4E32A 4M89A 4ZDIA 5I4KA 4AZWA 3ZKAA 4G0OA 2GN1A 1X39A 4BO9A 2H6EA 4OJNA 1WNFA 1O54A 2OCBA 4LTDA 3ED1A 3DWIA 3ESXA 3MS7A 3SPXA 3U1BA 2QU8A 3KJIA 2OBLA 1NBAA 4CM1A 5AW4A 1ZD2P 2F43A 1MENA 2J09A 4Z49A 2AHOA 1CDEA 2BKLA 3IQEA 5ADVA 1XFAA 2GASA 3MGGA 3R5FA 3FTEA 4R1NA 2QE7D 4BC1A 1MVOA 4HO1X 4JJIA 1Z88A 1LSJA 4HQRA 3FR8A 2RGUA 2PGIA 4IGEA 4QXPA 4ZV7A 3RJTA 3L7IA 3RLFA 4FWTA 1LBIA 3W05A 3W8FA 3ENWA 5DP1A 3GFOA 3IIEA 2QNIA 4FMBB 1U0RA 5LA6A 3ZZTA 3SQWA 4YIHA 3BWXA 5E1MA 5LD2B 3CLUC 4OL0A 3O9MA 4D9GA 3LT2A 1S01A 5ENVA 3CVYA 3IXMA 4GDMA 2W11A 1FX0B 2JVKA 5B3LA 3DZKA 1URPA 3DE1X 2C8VA 4QE3A 1JNXX 1Z8FA 1EDOA 2NWQA 3CJQA 3IC5A 3RC2A 4DMHA 1AHIA 2OUKA 4Q03A 3I5YA 5I9NA 4N3AA 1FTGA 4OKIA 2RGAA 3OZWA 5FDFA 5K8UA 2VDJA 3LH5A 1SCDA 1VA4A 4K28A 4JB3A 2JIBA 4JWKA 4WPGA 3WJ1A 1QOPB 4E5SA 1BA3A 3R74A 5IAAA 4NCNA 2ZYHA 4EJ2A 2OFWA 1V4BA 1WTCA 4ZJZA 2FJ0A 4BDSA 3DDSA 2WSSA 2DSNA 5AVTA 1DQZA 4BEWA 2OBNA 2FWAA 1FQOA 4QECA 4QUEA 4MGEA 1CC1S 2DC1A 1Y6JA 2HR1A 5IASA 1GAQA 1RBQA 2H1WA 5E2AA 2OESA 3RT9A 4D9JA 1CDZA 5BVHA 2PZLA 3BORA 2Z6AA 1L5QA 4Q9IA 2W37A 1PL7A 2I3BA 4K86A 1W85A 3WLJA 2P41A 4F9GA 1DJOA 2AJLI 1V8ZA 3JAKA 5MDHA 1ORVA 1S7CA 4XTCS 5LQDA 3THYA 2IZ6A 3KEQA 1E5XA 3I39X 3GP8A 1S9DA 5ITZB 4UARA 1MUUA 4KWTA 2EATA 2O2DA 3K31A 5JZVA 5KJ6A 1DX6A 2NGRA 3P5BA 3NPMA 3ROQA 2DFPA 3DBRA 4ERNA 3ASVA 3KVVA 1NXSA 3EZYA 3SS7X 3CONA 2QT9A 1YB1A 4M3NA 3UIEA 4ARZB 2GAIA 1EA7A 1QGUA 2P2GA 1F0KA 2IRWA 2O2YA 3WB9A 4CT4B 1PR4A 4G1EB 5EKSA 4WKBA 3WGKA 2YZ2A 4FMCF 5ALJA 2CL7X 5E1OA 5JCZA 1GO2A 1I51A 1ULAA 3L4SO 1ADFA 1XU9A 4YDRA 1VHQA 4HUQB 2FWBA 1ACLA 3VPCA 1UPCA 3IKMB 2QAIA 3E18A 3K8QA 3K94A 1OXBB 3PXAA 3T06B 5KSWB 3RV3A 1AKRA 1NMQA 1JW9B 2XGGA 2VLIA 5CNIA 2EC5A 3ZH2A 2WFLA 4QG3A 1E2JA 1OE0A 2XADA 4ED9A 5J47A 1JJFA 3QKRA 1V6AA 2Q4BA 2FDCA 2ZKIA 1PEDA 4XEUA 5DX8A 4BIMA 1YDFA 2P11A 3W7VA 2VPPA 3H75A 4ZK2A 3SSOA 1VIMA 1CUSA 3EXG1 4OA8A 5G53C 1HY3A 2A1TR 4LWZA 3JSAA 1JYEA 1QYWA 3TRJA 3LXRA 3DM5A 5BN4A 4IUCS 2FB9A 5D51S 3S2EA 4J75A 3VYWA 4ES6A 3ESBA 4MS1A 4D3SA 3U7HB 5BYBA 4KXLA 1YQDA 3M6MD 3JAWB 3E9EA 3KZ1E 1RRMA 3ETNA 2BRUA 4AYWA 5CK4A 3STTA 5B1YA 3BGOS 1ATIA 3TQHA 5C34B 5ALFA 1GD1O 4WY8A 2ZCVA 5FBQB 5IN5A 4CW7A 3LVRE 5B6IA 2UYQA 2FK8A 2V96A 5AOCA 4CMCA 1A04A 3ZWQA 4Z7OB 4LUCA 1FBNA 4NG4A 5KHAA 4JOSA 1VPEA 4CG2A 3COSA 3RYFA 2OOSA 4QVIA 1U7UA 3KPWA 3PPVA 4OM8A 3V1TC 1K1EA 2CZCA 2EF1A 1YBHA 1NUHA 2JCVA 1GA6A 5J58A 4MTCA 3LG2A 2GPWA 4YUVA 1SKYB 4I4TA 3TX2A 4DMMA 3N8HA 1K4KA 2H2HA 2QJWA 3L9WA 4QGGA 2NMVA 1S6YA 2WLTA 1PZMA 4YBZA 3UMGA 4GDFA 4CEHA 5BV0A 1QRUA 4XOUA 5I7WA 2F9LA 2Z2IA 3IJPA 5BMVA 1UXIA 1Z8DA 5BUQA 3SYLA 1SA0A 1MAVA 2J3EA 4HSEA 4ND1A 3VTAA 3C3EA 4B9EA 4N0MA 5CXUA 1HE2A 1QTNA 4AS3A 1NJ5A 3FPEA 1QTRA 3B7WA 4WLOA 5EXTA 3SZGA 4EQ6A 4TZ6A 4B1FA 3WLAA 4AAYA 1F51E 1YA6A 2ID8A 4UD6A 5TARA 3IJEB 1L5HB 5HRUA 3FDZA 3UJ7A 4DLSA 3E8SA 3LUKA 3GLGE 4E2YA 1E62A 3RC7A 4AMUA 4F5WA 4Q7QA 4P4GA 1ZW6A 3LY7A 4NAVA 3I01M 3FJYA 4C2UA 4MIKA 2H2WA 2NU8A 1WXFA 2ZJ0A 1Z8HA 121PA 3LYAA 1CULC 1G8PA 3OZIA 3ZE2B 2QV0A 4I2NA 3VBCA 4PRKA 3F98A 1Q7GA 1ZI8A 3BHNA 3EZ9A 3L77A 3RW9A 1JI3A 1KFEB 1ZOOA 1G1AA 2WYOA 3TR0A 4BKOA 4UTXA 3RJZA 3ELUA 2BHNA 2C7VA 2D1TA 2FZWA 5TXGA 4U7GA 1ZDMA 3DAGA 3UT5B 4QZVA 4ZYYA 4LDJA 4CNQA 2HT1A 1YBMA 4OL9A 1ZOSA 3DSRA 5A4KA 2PS0A 4DA6A 4O2AF 2RH9B 3FSJX 4B4KA 1NGSA 4GIBA 4TUYA 4ENWA 5IFLA 5JAOA 2NNWB 2A35A 2X4GA 3PIRA 4JJ7A 1OFIA 1OI4A 1N9GA 1X94A 1IRXA 2ZK7A 4FNMA 4V0OA 3T41A 4EH1A 2PX4A 4CZ2A 1E9RA 2ATIA 1CNMA 3C5VA 1U2RA 4RHUA 4Y9SA 4X8MA 2XWQA 2XQVA 5BT9A 3N8GA 4KFUA 4IR7A 4QDKA 5CLFA 4C03A 1E5VA 1UJ6A 2R68A 4HAXA 4HNGA 3BRSA 3M6VA 4N5HX 2J48A 2MIIA 1CCWA 3EBOA 1SK8A 4S3MA 1YFJA 5CH8A 1I4EB 3MGKA 5C4IA 1KMQA 4RA9A 3C3BA 3VHQA 1VG0B 2O8NA 1AMNA 5AIBA 3P2KA 4OGFA 1DO2A 2RKWA 1Z07A 5EWMA 1TYEB 1EXWA 1TA4A 1E3DA 4QTTB 2Q3FA 3GDFA 3UG7A 1LK5A 1BOFA 2PBLA 1DC7A 2PUAA 1M7BA 1C3EA 5DBFA 1WF3A 1ZM7A 4KDFA 2R8YA 1EUCB 2HM7A 3NIBA 5I9MA 3N6XA 4ZT6A 3IQFA 1TEHA 1M2HA 3IJRA 1Z2AA 4LKRA 4ND7A 1OX4B 3FNRA 4MGKR 1RM0A 4JVOA 2EIHA 3CEMA 5KSPA 1JG2A 1CQZA 2DX7A 3N53A 5FUWA 1DOAA 1JHRA 4ZOLA 1V2HE 4XRRA 5BN5B 3TD2A 1J09A 4Z9BA 2H2IA 2HQOA 2ERXA 3IAUA 1E9SA 1YBAA 2DG2A 1FQKA 1NMXA 3BWCA 3C7DB 3ETHA 3KPVA 1RHKA 3PX2A 4NQRA 3FVWA 1ZFNA 1DKQA 4BJHB 1JHAA 4YBRA 5DBHX 3VNBA 2Q62A 1XQYA 4Z4CA 2RK3A 1X19A 2C82A 4PLVA 1J5EB 1ORTA 1SQFA 2ZSBA 1KI1A 1SBNE 2NN3C 3G79A 4I81A 3DPIA 2F3RA 3QA9A 1QFSA 3PE3A 4U5XA 4XKJA 2X40A 4RVGA 3U1VA 4CKBB 3I0NA 2A0UA 2V5UA 3GRKA 4NMWA 2PD3A 2ZBEA 1KPGA 2X5JO 1WPGA 4RWEA 1SOWA 4YCJA 3UJNA 1R6UA 5REQA 1E7RA 2IIQA 5GM1A 3NHUA 2I6QA 3UM9A 2H08A 4ZKEA 2HFKA 1HF3A 1I10A 5CT6A 4ZPXA 1EFUA 3X1JA 1XZ8A 1PR3A 1MTOA 1P2DA 4IO1A 4J0GA 3M2PA 3J7AC 4WSOA 3HB5X 3WGNA 3S2ZA 3EULA 1FFHA 2HXGA 3AJDA 4AUEA 2V8BA 4M0MA 2BFDA 3L93A 3N8IA 3C24A 1F5NA 5CVEA 2H9IA 1LPPA 3I04A 4MV5A 2ZUBA 4KSCA 3P2IA 4BWYA 3LM8A 3F9IA 1N0VC 1ADBA 1A9YA 2ENUA 4WCFB 3LYHA 2FWIA 4D81A 4LJYA 5LLDA 1XCPA 4BQSA 5DVZA 3RU3A 5IXJA 1H6AA 3NT4A 3J81A 1CT9A 2PKQP 4UEKA 4XFJA 4Y1RB 2OVBA 4B5KA 1GGMA 1T2UA 4RSGA 2RB5A 4PYMA 2WYIA 3VR4A 2QT1A 3L5KA 4XGRA 4P22A 4OK3A 1XJWA 3KT8A 1ULHA 3WV4A 2PV0A 3EAGA 1YS9A 2Y0BA 1W4ZA 2NO6A 3AZPA 3JQ9C 4E2XA 2WZQA 5FUXA 4PZPA 3P9CA 4G89A 1OJ7A 1DAIA 3VR5H 3AW9A 3C8HA 4MVJH 2BM0A 1WG8A 1MRZA 4HDAA 4NZ9A 1SXGA 4BBJA 4B3JA 5FHQA 5IF3A 3OKAA 1OXVA 3DDCA 3W90A 1JG1A 4IVRA 5CVJA 5GONA 5J2UF 4E6EA 3D54D 1H2BA 3HA7A 2V7UA 1QF6A 4HEA6 2G8NA 1DQYA 1V2GA 5F7JA 2GYVA 4WV3A 4ZQGA 3T61A 5EZYF 2IHBA 2OO5C 3R9KA 1XTZA 3CH5A 3BMNB 2X2OA 1YC5A 3SAJA 4XWYA 1X7WB 3CVOA 1B8OA 4I7EA 2PFKA 4LZPA 4PINA 4F2HA 4TWJA 1ADGA 1W0CA 3C8ZA 3EUEA 3EMBA 3O95A 4Z4QA 1RW4A 2Q3LA 3VRHA 2QK4A 1NN0A 3DEHA 4HWPA 1QH1A 3V2GA 3CISA 2JFNA 4H6PA 4CGYA 1SHLA 1UINA 2XCLA 3QXHA 3K9BA 1TT5B 1IZZA 3BEDA 3GRFA 4Q21A 4TSRA 5JISA 4BRSA 2JJ2D 2HL6A 2WW8A 1W88A 3AHFA 3DKKA 3GAFA 1L7NA 1T4CA 4YJHA 2UYGA 2EJTA 2IDJA 3QUCA 3ZHVA 4HH3C 4DUGA 1PL8A 5ALIA 1RPTA 1F1BA 1MX9A 3P9PA 3S4YA 4YUXA 3LKVA 4X8LA 3F5QA 1JU9A 2WKSA 2HMVA 4GPIB 3TZLA 1P62B 1UAGA 3LZCA 1Q5PA 1R8XA 2W6ZA 4HB3A 1HE4A 2IFTA 5JYDA 2F59A 4YN3A 1EHIA 3GT7A 3QI7A 3GLFA 4PEVA 3UF0A 3ZN2A 2QPTA 1EVEA 1JRLA 2HA6A 3PC3A 1L8LA 1PUJA 3G17A 2B5OA 2RGYA 3B36A 3L7CA 3OVMA 4PAGA 5BNZA 1UDXA 4JLDA 4FFPA 5DP2A 2F3PA 3T7IA 1M8JA 4PRZA 1MX3A 5KTRA 2D54A 1HNXB 3GRRA 1MZPA 3BE5A 4Q5IA 2JI8A 2FMKA 3R3ZA 4PQRA 3V8QA 2RGGA 3DFFA 3HU2A 2HIAA 2PQMA 2RKOA 1OROA 2IGBA 3CF2A 3NM4A 4EFMA 4B3TB 4X66B 4OHOA 3VVMA 1QIIA 4TLCA 2P2NA 1KZHA 4FR5A 4PPGA 3NYQA 2NU7A 3JQ7B 1SB9A 4HUJA 4JKYA 4CLOA 5L9AA 1ISRA 3IKTA 5CCXA 3GJ6A 2ZETA 4L5IA 4U2KA 2IH4A 3SFVA 2IP1A 2XQGA 1QU3A 3PHCA 4KUHA 4LZOA 2QGZA 2NZJA 3ISTA 3OX2A 5DYYA 3NONA 2XA9A 3ZE8A 3V4SA 2NZXA 3T1QA 5HQ3A 2GZ2A 2P0EA 3G2HA 1YOBA 2WNHA 3X2SA 3FYHA 1WUIS 2WSSD 3A4IA 3A6HA 4MSUA 5CLHA 3T5CA 4ZYTA 2TMYA 3HO1A 3PL1A 1PL6A 2UYYA 3VU9B 1C1HA 4BN0A 1C7FA 3VMMA 3CMMA 3JALA 4QAJA 4U02A 1GVHA 3NXSA 4X91A 3AHIA 4BJ6A 1N5KA 1OFGA 1VIAA 3GO4A 1QIKA 1XB2A 3IV6A 1QYCA 4RK7A 1DKPA 2ORWA 1M2VB 2GA9A 2VCEA 3SC3A 4CG1A 1HNZB 4EF5A 4YRSA 3R44A 2FY8A 5A3VA 3V7FA 1CEYA 5LMUB 1N8KA 3LOUA 4HMQA 5B6JA 2BLLA 2EXXA 1B42A 1BX1A 4FDVA 1ISIA 1Z2PX 3GD5A 3JARB 5BQ5A 1TW3A 2HRBA 1JZSA 4PYLA 5KJEA 4AYTA 4F72A 2CZGA 4DDUA 1G2OA 5KYNA 1XDGA 5GOZA 1GCIA 1WOYA 4ZZ1A 3THWA 2IXAA 1LEHA 3KS9A 1YCGA 4KNWA 3IMFA 1CUXA 1Y6RA 1DX4A 2AC7A 2JRCA 1MQSA 4FUTA 2QN3A 4LMRA 4MCAA 4Y8VA 2GBLA 1Z5NA 1YQXA 3HXTA 4XM2A 4JI8B 3OJLA 2PWBA 4LE0A 5FYDA 1E7MA 2JVJA 2R62A 4AP5A 1Z29A 4M9CA 1ZQ1A 3MTBA 1S8AA 4X7PA 3JSXA 3V80A 3RFFA 3Q2OA 2HTFA 2ZUCA 5DM0A 4R2LA 4Y9DA 2WJZB 3IDFA 4L16A 2HK6A 2LGJA 3OZBA 4Z1OA 1EZ4A 3A2KA 4TZ0A 1JR3E 2GLXA 4LJAA 1NZDA 2QUHA 1PFYA 2R6CA 4ITRC 3U49A 1SOVA 4RTSA 2HA3A 4HRVA 5KYXB 1KFBB 3QUQA 4H60A 4F46A 1F4LA 2WFMA 3SVZA 1F6WA 4ALIA 4B3XA 3T7EA 4HNQA 4LJ9A 4Q7MB 3S6JA 5AXCA 4FDLA 5DW3A 3UV7A 4ABTA 1R4NA 1Z0FA 5HKKA 1RJEA 4J1TC 4DDVA 3HYTA 2JJ1A 2W2LA 2F3SA 2ZAIA 4MS3A 1PJ8A 2O3TA 3C5WP 3A2MA 3HJUA 5B6PA 3KQWA 2AOUB 3IE2A 4FNOA 3WTCA 2QBYA 4WN9B 2VJOA 3MT0A 3U4MA 3TSOA 4F9TA 3CN9A 1TCUA 2GDZA 4M0UA 5DBIA 1RWXA 3CVXA 4K6HA 3LQKA 3NYRA 4AD8A 2E9SA 4JUDX 1ONBA 3CZ4A 1SU4A 1OGJA 3DNMA 4AI6A 4CM8A 5ARBA 3H18A 5IZ4A 1LBSA 1LZLA 5IMBA 4M4SA 1HFJA 2AN9A 2Y1FA 4I50F 3RF7A 5BSGA 2V7QA 4PZDA 1YJQA 3OE5A 5JPDA 5K03A 1Z62A 4EP1A 5KHOC 1AO0A 1P7YA 2A7XA 2OSVA 5DYWA 2CXXA 1UFKA 1CVLA 2O52A 1QGAA 1VB5A 1VJRA 3RGWS 4DDWA 2OBBA 2REQB 3AHJA 3EUFA 4MZDA 4OHRA 5CXSA 3U7QA 5FOTA 2R00A 3AVTA 1UPXA 3EH1A 3KYJB 4H7DA 4AQYB 4OD0A 3H83A 4W9NC 1MAAA 4GC9A 4JI6B 3F5FA 3CSDA 3OTIA 4MWZA 3USZA 3O8OA 4IVNA 2WZDA 2QP4A 1Q7CA 1MJHA 4FXPA 1C1DA 2ZVQX 2P6NA 5DM1A 4P32A 5C7IO 1EGHA 1CLUA 2ZTUA 4KAAA 3CX4A 4XM0A 1ZUNB 2AKAB 3AUYA 1AQYA 4QFBA 2B92A 4N8DA 1WCWA 3EXHC 1IIBA 5IDVA 4LF4B 1WL8A 3AM3A 3D43A 4TTSA 4Z86A 3CY6A 3Q9UA 3SE0A 2OKGA 3DT9A 1N2CA 4MUIA 1A69A 1N2GA 1BRMA 1AY0A 2BM9A 2JAWA 4CGZA 1XGKA 2YMPA 4YJ3F 5L3ZA 2IPOA 4G97A 2Z3WA 5AW6A 5KMGA 3AI7A 2DQ4A 5NLLA 3CLVA 5CYPA 4E30A 5HP4A 1WV0A 4PYNA 4J16A 3KIPA 3RKRA 4H59A 3ZK9A 3T3NA 3WL6A 3IH5A 3EEOA 1Q20A 2LD4A 3JWPA 3HXQA 1C9DB 1VRWA 3RYCA 1MABA 1Q15A 1T24A 4UU1A 1MBZA 4GWKA 5JEEA 1KI6B 1J24A 2BEWA 4OF4A 4Q9LA 4NDNE 4CCAA 4DR6B 3E9ZA 421PA 4D8WA 2FEWB 3PLNA 5CDFA 1QHFA 4YP7A 1JHPA 3HU1A 4Q4LA 3NX4A 4OMDA 4P35A 4C3OB 2X4IA 4JEMA 3IS3A 3UB2A 1HT1E 1K88A 1VTKA 3CJRA 4LRTB 4E2ZA 1FEZA 1RRVA 3H13A 4RVUA 2VXYA 4MPRA 1QWSA 3GEMA 3DB1A 3IOEA 3QXJA 4ZANA 1TC1A 2GQ0A 5KQRA 2BEVA 2BEKA 1TFUA 2IEYA 4DV0B 1GPDG 5A3QA 3SCZA 1E8DA 1UOOA 2VNHA 3QSYA 4OHUA 5KCMA 3K9FC 1MQAA 5C18A 5EJ2A 4X7RA 1PJQA 1Z4QA 4XDZA 1T6ZA 3PEEA 3ABIA 3GGCA 1IE3A 5CIYA 4M60A 3K0EA 5DRYA 1ILEA 1X2BA 2HWXA 2XVYA 4NNOA 4H35A 3K70B 3HG7A 2C94A 3DCJA 3BH6A 3DWEX 1QOQB 5T4EA 4ZK6A 4XVCA 1GPYA 2X2EA 4ARUA 2ZWMA 4LXTA 4ASUA 5C3MA 3GH1A 2FEAA 2J3QA 4J3NA 1RQXA 4DV1B 4WLUA 5CX1B 1QC5A 5BXQC 1S3IA 4CKCA 2XMSA 3CW8X 1P0CA 5AVRA 4NV1A 4X1KA 5JO9A 1U1DA 5KVCA 2JLVA 3VPFA 2V6BA 2VOJA 1L4GA 2A0XA 2E18A 1XAJA 3GPCA 2I7CA 4BLUA 5JD5A 1EM6A 1NJGA 3HN6A 3HCOA 1TI7A 2W98A 1IEXA 2BGMA 1JB9A 2II6A 2J4DA 2QR5A 3GT0A 3KCQA 4KYIB 3LBNA 4QYTA 2H8GA 4DV3B 3RRYA 3OHPA 4CI9A 1MXFA 1J0XO 1AB5A 3G13A 4PLPA 3WL5A 1C9EA 1H0HA 1TK3A 1QF7A 1ZC4A 4B3FX 3RIHA 5HR5A 4ENUA 4K5QA 5JNLA 5MN5A 3FHOA 4CKYA 1Z5WA 4E1BA 1RZRA 1EYZA 1Y80A 4GYWA 1E1CA 3ACBA 4NP6A 3B2QA 4O2AA 4B5LA 2V59A 2WJ4A 3KVNA 3ORRA 4Q4HB 1YZVA 1TMKA 2MYUA 5C5IA 5IEBA 4GICA 5I4BA 1AXEA 5TQ0A 3PFKA 1ZESA 4JITA 1OB5A 1ONOA 3SF0A 2YVKA 3C3DA 2WSBA 3FUTA 2AOXA 1HT2E 1TXGA 1ZA1A 3O90A 4Q7KA 4M53A 1D4OA 2ZJ1A 2GVNA 2Q0QA 2QVGA 4LHWA 4Q24A 5K8LA 1GXSB 2Q0HA 2ZM5A 1Y7HA 1PG5A 2CVHA 4MMZB 4PG6A 5D3QA 3KUXA 3TLCA 3G8DA 2C5EA 4DJDC 4DB2A 3FR7A 3WIBA 1Q1EA 4L78A 2UVPB 2O1XA 4YQEA 4ZEVA 2YASA 3QFSA 4L4SA 3QXCA 3BCRA 3EFEA 1R12A 4FZ5A 3NTLA 4PLWA 4PX3A 2WV7A 4RZ3A 5D85A 5AQEA 3RAPR 1X87A 1NQWA 2IYVA 1ZVMA 2ZS9A 2H1SA 4NMXB 1QCZA 3QX9A 1RXWA 3TSAA 2OC4A 2MOKA 4QYIB 1VL5A 2BMVA 3RD5A 3TPCA 2IU6A 1L4EA 1J6UA 1E5TA 1R10A 2QOEA 3DBVO 1WUHS 4RK1A 4G1MB 4LOJA 3I28A 5FWYB 3VR4H 5IJ9A 2HXSA 3D5TA 2EGHA 2O7SA 3GCXA 3KQMA 2X1MA 5K2MA 4B32A 3HJFA 4J90A 1LV7A 4C4PA 2JEOA 2A5DA 2AD1A 4QOIA 3ROFA 2Q5IA 1LPAB 4EI9A 1NOJA 1PR9A 1QHEA 3QHQA 2AUMA 3C41J 3CO5A 4JVMA 4TLAA 2WD7A 1KS2A 1AUXA 5FPPA 3TLEA 4L6IA 4W5QA 3GIDA 1FL9A 4RWZA 4LJ7A 3WFIA 2A5FA 3EGXA 1QV9A 2R6ZA 2A9RA 2WI8A 2GYWA 4I9GA 2ZGVA 3IDQA 1I2AA 3VR4D 2WHPA 3E0XA 2FSVA 2VT3A 3DVQX 4UHCA 4RVSA 3F4KA 3BIFA 1SBQA 4PIVA 4BZPA 2PX2A 3QPAA 4GLFA 4MDYA 4QHTA 4AMZA 3AVXA 2ZJ6A 1X42A 4KMOA 5K6AC 3KL2A 3BPSA 4GYJA 2E48A 1DB3A 2PKEA 3HKEB 4HDKA 1OFUX 1KHHA 2XX3A 4LXQA 2ZEJA 3AINA 5LUBA 4PZEA 4YPVA 4RV4A 4HAVA 5AYVA 5DNCA 3K0FA 1UIMA 1IN7A 3HABA 3LKBA 4GZ5A 4BLOA 4CV2A 3FWNA 4JAVC 4D26A 4FE4A 2IXFA 4C76A 2FEOA 4QBGB 5K1ZA 4EY6A 4NLLA 1BFUA 3CRNA 1NY5A 1C3JA 4Y2XA 3SBOA 5D1HA 4RZQA 4A8JC 3TTYA 3CLHA 3FZEA 3ENVA 2YFHA 3A1CA 3DQZA 4LDAA 4X92A 4RZ2A 3MHTA 3RUEA 1IDOA 2DAPA 3O4GA 4YLYA 4DR1B 1E3EA 5TMPA 3DDUA 3OZEA 2C7RA 1J25A 1TK9A 3WNVA 1TKAA 2KM1A 1ODSA 4L2IB 2F64A 3HVKA 1S3SA 3DMHA 1VJ1A 2Q21A 2G04A 1FFGA 1LDNA 2BH2A 3WJAA 4AJIA 3IHTA 3JCZA 4KWIA 1YUNA 4C4YA 5KDOA 1QHHA 1KVSA 1TRKA 1FTQA 4I1RA 6AT1A 1OAOA 5AW2A 1CR4A 1ISHA 2PFGA 2FW7A 5HOQA 5IAJA 1B6TA 3PJDA 1BX0A 1DKNA 1FTNA 3DDHA 4FSDA 4EX6A 4DUGD 3A4NA 2FUNB 1L5RA 2FWPA 2Y1LA 4KP7A 5FUYA 5F23A 2KLBA 1P4JA 2XVXA 3KT3A 3FAZA 4RKWA 1ML4A 4UNSA 1CJKC 3FDIA 2PSDA 1NW8A 1USVA 2OORC 3K15A 4KI7A 4YDQA 1EHYA 4CEJB 3L1IA 3UNXA 2V74B 5E7MA 1K66A 2X9LA 1UM9B 2XCOA 2UZ4A 3KJZA 1A8UA 3O1JC 2PGXA 4K3VA 4RJIA 2LCIA 3ROKA 3GBPA 3F96A 3R9IA 1LFAA 4DIKA 1FNMA 4QOFA 1H2FA 1HMPA 1N8TA 1PNVA 3BGVA 3QELB 4JCOA 2GETA 5ARCA 2IXGA 3U7EB 1ODIA 3H8JA 1N75A 4UTOA 1T3HA 1V1RB 3C5EA 4W8OA 2CLIB 1V41E 2GF0A 4Y7DA 5DI3B 3KZXA 1Y33E 3IO3A 3IOCA 2HSZA 3RK4A 3V00A 4C20A 2C2GA 5LN1A 1IQ0A 1LDEA 2G5CA 3NBAA 4RBNA 3RQSA 4N3GA 2X3UA 1P1JA 1FZTA 2FW8A 2DKFA 4ITUA 4DIUA 4Z6KA 5HTOA 4OI1A 5BQOA 5FWDA 1QGOA 3PIDA 1FSSA 2R6FA 2JGRA 4FD2A 4ZHQA 3RS7A 2DTEA 1AO3A 4V0MA 1W9MA 1X1EA 2VUIB 1LPNA 3RTBA 4DW8A 2OWEA 1SIOA 3DVSX 3K6RA 4FI3F 4NBUA 4ON9A 3QMVA 4X1YB 3ZHBA 4C87A 4ENPA 3AL0C 3BB1A 1CX9B 1QS0B 1MMFB 3V8NA 1SJ9A 4H77A 3DMDA 3EG9A 5FOXA 4UD2A 3NFYA 2R1VA 3E7XA 5TVKA 1YL6A 4LHSA 2VTBA 1O6ZA 3QWFA 3U62A 3VVLA 2VCYA 1MZVA 5KOYA 2R1TA 2AXEA 1QIEA 1PVVA 1P2TA 4MR7A 2JIPA 4Q3EA 2DSTA 5HX7A 3ZDDA 1VGRA 2EGUA 1U2ZA 2J0UA 3K5IA 2WTEA 3ND6A 5KINB 2OGZA 3EIUA 5F98A 2DQKA 4P4SB 4EMTA 3DL4A 1LQTA 1L4LA 5A0FA 3K4QA 2WIGA 3KJHA 3V2IA 1IQUA 3MXOA 2X0FA 1MV8A 1Y1SA 4C43A 3L6BA 1XTKA 1ISFA 3BWEA 3HJAA 3PFHA 4K1LA 2A30A 3FLBA 4PS1A 3RVKA 4CKXA 4P6VF 2FEXA 2EW8A 1T2FA 4RHEA 3QGMA 4PF1A 4CV0A 1JDVA 3TRIA 3UC5A 3UMRA 1HG0A 2PVPA 2YX1A 2I78A 3IP1A 3OU2A 3AF3A 3EGDA 1E3WA 2NXJA 2W2OA 1GU1A 5E0KB 3LBHA 2IHUA 3KLBA 2XKKA 4G1FA 4FS8A 5KVQA 5BPHA 1GQOA 3S0JA 3ADBA 2SCUB 4R2WA 3RSZA 4R8RA 1IU9A 5K0TA 2EFHB 4ZT5A 1H2RS 1HV8A 3UHAA 4RTKA 3Q10A 4AJJA 1WPXA 1I6KA 2CD7A 3AGQA 1YZHA 3FPSA 4M37A 2DTXA 2J9XB 1SUPA 2QXYA 1X86B 1T43A 2X5OA 2C0QA 1UK7A 3F67A 3O84A 4L4UA 4TQUS 2HAEA 1KVQA 3FDFA 2YS7A 3REGA 5ITWA 2Y92A 3GVHA 3SVTA 3QBEA 3QP9A 3KUCA 1W46A 1BMTA 3T4UA 2ZJYA 3WKEA 4BB5A 1T8WA 3V46A 3VAYA 2O6HA 5HKKD 5KWEA 2G28A 4NAHA 1XJ0A 1B76A 5H82A 1P3DA 3NUGA 2YWEA 3L0YA 5IVIA 4DCNA 2JJ1D 2W2LD 4O02B 2Q3CA 5AK4A 4CODB 4O1MA 4URFA 3NH9A 2E4UA 4X95A 4YPFA 1NG1A 2OV2A 2VNIA 4HGYA 2Y6UA 3G3EA 3QI2A 1OLSA 3OAAA 5KAPA 2JHPA 3ONVA 5LB4A 2EWVA 3UFXA 4DQXA 4IW3B 4D0GA 4RLHA 1Y1PA 1SEVA 4BVGA 1NR5A 1I24A 1CUYA 2VT7A 2ZYVX 4FFMA 4JIMA 4L9RA 4RK0A 3RREA 1GJRA 1Y1KE 3VHLB 9ATCA 1Z18A 1EWYA 2IPNA 3SG0A 4IP0A 3DLPX 3N5KA 2PGOA 3NH6A 4YO7A 6REQB 1N1GA 2ZR0A 2VQ3A 3BJEA 5HIKA 2SECE 3W79A 2V7QD 4I5FA 4NICA 4NHEA 1Q83A 2DPXA 2H2DA 1Y6QA 2IYWA 3VI3B 1P2UA 2W90A 1DV2A 3IAS6 4GXTA 1FB5A 2BJVA 2WVGA 4XOIA 1WDMA 2QTTA 1V96A 2CXPA 3BHMA 3E70C 3NBYC 3PF8A 3I5AA 3ZU3A 3M34A 4CYMA 5ICFA 2I3GA 1U7ZA 1NRWA 1NX9A 1OW3B 1HDZA 1PTJC 4JR2A 3WB0A 2IXBA 3HMQA 3TOCA 3FA2A 3Q6MA 5KYUA 3BD9A 3OPMA 4NE7A 4DLZA 1YE8A 2C07A 1G21E 5AJHA 5D8DA 3S2FA 3MMNA 2KBFA 1TVCA 5DKFA 4LVUA 2CFSA 1ZN7A 1XTPA 1DAKA 1RYDA 2IEDA 4G1UC 3S55A 2O50A 2UZAA 3TTUA 3MMPA 4Y2VA 1OZGA 2FHPA 2RI6A 2CL5A 3G1WA 3CNQS 1TF5A 1VCMA 3MVEA 3LTEA 2RGRA 4ESOA 1U7WA 2O59A 3LUGA 4N01A 4DV5B 1OXKB 1Z33A 4NCXA 1PSDA 4FFBB 4QL3A 2VRWA 2H7VA 3L8CA 3U0VA 5DYTA 2VHTA 5EP3A 4W5JA 3T3HA 2AG5A 4F4UA 1M8FA 3I72A 3QBDA 3TR6A 2REBA 3Q11A 3UYKA 3NCHA 1I5RA 3V7YA 2I6GA 1FVHA 1X1RA 1YJAA 1YQ9A 4QU5A 4B4OA 3PEVA 5D84A 3I92A 4IGIA 5DHQA 4D97A 4W8HA 4ZZIA 1C7JA 5BQ3A 3PNVA 2CXTA 3N3AC 1H5NA 4JP1A 5DTQA 2CV2A 1NDUA 2DLCX 1IUKA 5I7VA 1ZHHA 3MJCA 3MRSA 1LKZA 3H2IA 3HB4X 4NK5A 1A5TA 1RWQA 1K6XA 3PDWA 2ZRDA 5H9VA 3FTPA 2R0QC 1DFGA 1TO6A 4YUWA 3PC4A 4JUFA 2GWRA 2ZULA 1J56A 3PQCA 1IIRA 1W5BA 4DLLA 1OJLA 2FEPA 1UH5A 4ALNA 3SQLA 4CL8A 4CM9D 2PXHA 4DNOA 1NJ1A 1K7XB 5A7HA 1Z6QA 4H1TA 2O05A 2QMQA 3WGGA 2XIQA 2PUBA 5EWLB 2R8OA 3MCUA 4PAMA 3MWKA 3WL8A 1YDEA 4YWHA 5CG2A 1C5KA 1G5TA 3NM5A 5TMEA 2BSAA 4OIFA 4DLAA 5GM2A 4Y1FA 5EQDA 7MDHA 2B34A 1HK7A 1AZTA 3L4EA 2BGWA 4JQZA 4MQUA 1ETUA 3SLGA 5FPKA 1TTTA 1AV6A 2ZJ8A 3IO5A 5JXIA 2ZSIA 5FQNA 2WF6A 1KNQA 2ZB3A 5G1PA 3ZZMA 3HCAA 4CF7A 3VOTA 4IDPA 2HJRA 3FCXA 2BGTA 4TLMB 3TPZA 4LJLA 3T5PA 4EB3A 1AKTA 3JYQA 1IZ0A 3KQPA 3ET4A 4JQCA 1M2WA 4L0QA 4YJ3A 3RPEA 2AMFA 2I29A 3V8MA 4DQDA 5ABPA 3BQMB 4KB5A 3GRVA 4KAJA 2BMAA 3A4LA 5I9TA 2R751 4GKAA 1WB5A 4XD2A 5FB3A 4DMFA 4UAJA 3R2JA 5K0BA 4IYRA 3LHIA 4BEJA 1F0PA 4J9UE 1CQJB 1G5FA 2YV4A 2FPWA 4LGYA 4WOBA 5D7BA 1W2WB 2BZ0A 4AY3A 5C8XA 4LSZA 3GH3A 3VH1A 4ZARA 3WGUA 4MGIR 1SK9A 1NV9A 1E2NA 2Q3EA 4QA9A 3W04A 3VR0A 2GM5A 1RBYA 1B73A 3JQPA 3G2LA 3Q12A 3B1ZA 4TS4A 1RZRD 2PXAA 2X13A 2HSGA 1OT3A 2OK8A 2H1FA 4D9EA 2Y0CA 4RABA 1CJMA 2AUNA 1FFSA 3EISA 1CS0A 2QRHA 2ZI9A 3HLKA 3A6DA 4BV8A 4EB8A 4LTMA 3AEXA 5FBHA 4YHHB 2MSNA 1VXOA 1L7MA 1QHIA