6YASA

Hydroxynitrile lyase from hevea brasiliensis, room temperature structure
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structures of enzyme-substrate complexes of the hydroxynitrile lyase from Hevea brasiliensis.
pubmed rcsb
source organism Hevea brasiliensis
molecule tags Lyase
molecule keywords PROTEIN (HYDROXYNITRILE LYASE)
total genus 97
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 1999-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 6yasA00
1VZ2A 3EQ8A 4RE5A 2OCIA 1SC9A 4GBGA 3JYHA 4GLBA 4BC0A 1A7UA 1XZBA 1UKCA 3D2CA 4Y2RA 4OYYA 4FKBA 2OG1A 4QZVA 3WYNA 3WKDA 1GT6A 5AKLA 2VF2A 2FJPA 3D3NA 2WFZA 3A2LA 2QKYA 5AO9A 4NVRA 4J0JA 4LXGA 5ALFA 2XMGA 5FKJA 1XZKA 3OURA 2I03A 3AZOA 1XLWA 4MYSA 2HA6A 3IVMA 1ZD2P 4B6GA 4J0DA 2DHCA 5K3EA 5AOBA 4H0CA 3H0CA 5KBYA 1FJ2A 1K63A 5JD6A 1L7AA 3FAKA 2AJBA 3D59A 3C6YA 4KAFA 1NU8A 1VLQA 1RWQA 5JZ9A 2PSHA 1WB4A 2G5PA 1GKKA 4HAIA 5DYYA 1YB6A 4IH9A 1JU3A 1UOOA 5AM1A 1CUVA 3SWWA 1L7RA 1R3DA 1BN7A 2DQYA 1CUYA 5LZ5A 4BVLA 2WIDA 2C58A 4MQMA 5ALXA 2AXEA 3QPAA 4ZREA 2G4LA 2NW6A 3O9VA 5JAUA 2QOEA 3PI6A 5LZ2A 3OM8A 4J03A 5FPPA 4CG1A 5T4FA 3WK4A 3O4JA 2WJ3A 5FXMA 5JARA 4Q1VA 3O4IA 1XZLA 4MXDA 3WK6A 4GW3A 3G0GA 2XMRA 3K6KA 3E3AA 2WLSA 2QT9A 4QDUA 1T2NA 1THGA 5K3FA 4BAZA 2PSJA 2QJRA 4G5XA 1WM1A 4UHFA 4U2CA 2C7BA 1VE7A 4AMYA 2XQGA 1EVEA 1DU4A 3F96A 4DNFA 2XQFA 3CN9A 3BJMA 2WILA 3WKBA 1ZOIA 3BL8A 2GBFA 4CIBA 1W52X 3R3WA 2ACKA 2Z5GA 4E15A 1C7JA 1QFSA 2YH2A 4WFJA 2XUFA 3QBJA 5CTAA 3D0KA 2J4FA 1QZ3A 4C87A 1N8SA 1CR6A 1QIDA 3F9CA 4Y2PA 1P0PA 1GQSA 3B12A 4WFKA 1VJ5A 1EI9A 4J0HA 3PFCA 2GBCA 5AI6A 4C4ZA 4YPVA 1XZMA 3DDUA 1E3QA 2AJCA 1JT2A 1UK9A 4OU4A 4UFPA 1MPXA 2CUTA 1G5FA 1EH5A 1Q83A 1CUCA 5LKRA 2ZJ7A 1M33A 4H35A 1DTEA 4B80A 3I1IA 2X8BA 4O08A 2V98A 3BF7A 3C8HA 5T4HA 5E4YA 4K6KA 1P0MA 1ZGCA 5FDFA 4Y2YA 1K6EA 2OAGA 2ONCA 4K5QA 1H23A 1UOPA 2JF0A 4EY7A 5BWCA 4H7IA 3KDAA 4HRXA 3IBTA 2ES4A 3G0BA 1DINA 2WG1A 2RAUA 1QOZA 4TPKA 4G1FA 2C0QA 4BP9A 3RK4A 1NU6A 4Z49A 1YA8A 2HHAA 2Z3WA 2C5GA 5EHQA 4G4GA 1E8NA 2JBWA 1GPKA 1KU6A 2XI4A 2ACEA 2XQKA 5IKXA 5CH8A 1I6WA 3O4GA 5AKYA 3FNBA 3SK0A 5IVHA 3AIMA 4KYVA 1CUEA 3VDXA 3MUNA 4X6XA 3WZLA 3FYUB 4G4IA 2B9VA 2C0PA 2XMSA 4RE6A 2QXTA 1UWCA 1CUZA 3ZPXA 3VJKA 1FFCA 1QIJA 4UUQA 1VOTA 1ZIXA 3DS8A 3P2MA 5HF8A 4P9NA 5HQ3A 3F97A 2WG2A 4CG2A 3BXPA 5A7GA 4L3WA 5I9IA 3NUZA 4OSEA 1TKRA 4FOLA 4AN0A 3IURA 1ZI9A 3GBSA 1JMYA 5KWJA 1CPYA 2OCKA 2ZSHA 1IUNA 5HKBA 5DLPA 1EK1A 6YASA 5H3HA 4BZZA 3GZJA 4LHEA 3GELA 3NGMA 3DEAA 5J3JA 2Y2UA 3OG9A 2ZSIA 3RARA 1XZDA 1TIBA 2QJWA 1EB8A 5CT6A 4MYDA 3C6ZA 2YXPX 3QMWA 2JIDA 4A5SA 3H2KA 4F21A 2WHPB 4FHZA 5C8ZA 4DLNA 4M0MA 3H04A 2OXEA 1LPBB 3H2JA 1ETHA 4TGLA 5DYTA 1FSSA 5IVDA 4AN1A 3WWCA 2DQZA 3Q0TA 5HZGA 3E1GA 1TCAA 4B84A 1CUSA 5EIHA 4NMWA 4J3JA 3WQHA 2VAXA 4H7JA 3HACA 4BATA 1QLWA 4U2DA 1FFDA 2I78A 1UXOA 4IH4A 4G9EA 4GHWA 1CFJA 1U8EA 4G8CA 2CBGA 5CRIA 4BC1A 2BKLA 1HBJA 4WDQA 1H2YA 4CI9A 5JAOA 4V2IA 1H2WA 2XUOA 3W05A 4DTCA 3WL5A 4GDMA 3FYUC 3UUFA 5K3CA 2WUFA 3U0VA 3I28A 1YAJA 4BYMA 1X2BA 5ALMA 3WYDA 4GECA 4PW0A 5A71A 1X70A 3HABA 2BGRA 2FUKA 1W75A 1LPNA 3R41A 1MX9A 3PE6A 1XZJA 3V1KA 3I2JA 1AC5A 3V1LA 2CEKA 3H19A 2DSNA 3W2TA 2WG0A 4QDXA 1MAHA 2PSEA 4KAJA 4OB8A 5AKHA 1GPNA 1THTA 4H18A 5DNUA 2DFPA 2JGLA 2XMZA 5ALSA 3AUKA 1BRTA 1GGVA 4Y2JA 2HU5A 2D5LA 4GWLA 5I7UA 5KWIA 2XUJA 3WK8A 2IIVA 3NWOA 2Y1KA 3WWDA 3WKAA 1YS2X 5AKKA 1CV2A 2CZQA 3Q8WA 5K3BA 4UBNA 4DMHA 2BGNA 2XQJA 1LZKA 1EDDA 4ZV7A 3T4UA 3V1NA 1LPSA 3FLAA 1QE3A 5LZ7A 3AILA 3DYVA 4DSZA 2R11A 3PF8A 4P08A 1S8OA 1ACLA 3DKKA 2PM8A 2H7XA 3ANSA 3WKEA 3KD2A 3FWHA 3LS2A 5HF5A 3BDIA 4ITVA 4PSDA 1CUGA 1AKNA 3GA7A 2JGFA 1AQLA 2J4CA 1XRLA 2WTMA 2PSFA 1QFMA 1J07A 1EDEA 2PL5A 3F67A 1QIGA 4B81A 1LPPA 4ROTA 4XWGA 1XZGA 3C8DA 5KREA 1J1IA 1CQZA 2J3DA 1R4ZA 1YSCA 4U2FA 4Y2TA 5AKIA 2HU8A 3CN7A 4MWTA 2HM7A 1H2ZA 3ESAA 1TK3A 3GUUA 2OAEA 3SC2A 3WK5A 5SYMA 5ALWA 1PJAA 3HRHA 3G7NA 3VJLA 1A8QA 2HU7A 2W22A 4C89A 4BE9A 3G0CA 2ZYIA 5DNWA 4QEKA 2WFLB 3OPMA 1EDBA 1R9NA 1AMNA 5CT4A 3EIOA 1TRHA 5A2GA 1ISPA 2O2HA 5FLKA 4AZ3A 2XMQA 3L1IA 4A16A 1F8UA 1CUWA 3W06A 4QDOA 1MNQA 4KJXA 3D5EA 1ODSA 1OXMA 1CEXA 4DM7A 4Q82A 4X94A 1AUOA 5HQ3B 2EDCA 2WIFA 5AP9A 3QMVA 5BV7A 3AIOA 1LGYA 1XZEA 3EQ9A 5LP1A 3ICVA 2DCMA 1WPRA 4FFVA 2PUHA 4HVTA 4WFIA 3STVA 4B82A 2VT7A 3BE8A 1VXRA 5BWBA 3BIWA 3M83A 2VSQA 2XLCA 1JU4A 4ARBA 4M0FA 2OGSA 1ORVA 1HPLA 3O95A 1GZ7A 1P0QA 4C01A 1WB5A 4RNCA 4Y7DA 2YASA 2PSDA 4W1PA 1CUUA 5AKJA 3RKSA 4U2GA 3SX4A 4EY8A 5A7HA 5LLSA 4FLFA 1U4NA 2WU4A 3I2FA 3WL8A 2OLEA 4UBJA 2VEOA 5AKXA 4D9JA 3KSRA 4PO3X 4OD0A 5D6OA 4PSUA 4AXBA 3STXA 5AICA 3DD5A 3VVLA 2HIHA 3D7RA 1CVLA 3TGLA 2RI6A 4X6UA 5JANA 2WQZA 2HA5A 2WSLA 2BUAA 5FV4A 3EQ7A 4DIUA 1LZLA 3VVMA 4UBIA 3C6XA 1P0IA 1JJBA 2XUGA 3RLIA 4B0PA 1BCRA 4X97A 5AOCA 4I4CA 1VE6A 4DMCA 5ALKA 4UBKA 1WHSA 4Q3LA 1MT3A 1F6WA 1LPMA 1XROA 1C7IA 1VA4A 1H2XA 2XUPA 5D3KA 5I8PA 4MEAA 4GXNA 4QNNA 3R3XA 1DX4A 3I2GA 5AIAA 2D0DA 5DYWA 2XUQA 3E0XA 5A7FA 1CUAA 5ALPA 4FWBA 3AJAA 1ODCA 1XLVA 5AIBA 1EK2A 1C4XA 2I3DA 3VXKA 3ZV7A 5JYCA 5HF6A 1YAHA 3O4HA 4Y9SA 4PV7A 5AM3A 3MUOA 2PKYX 1A8SA 1AURA 1IUOA 1ZJ5A 4H7FA 2PUJA 3PDCA 5EIAA 3E4DA 3DL4A 4IO0A 5AK6A 5EI5A 2JGJA 5HCUA 3O0DA 1USWA 3IUJA 2WIGA 1UK7A 3I2KA 4X90A 1VXOA 3STYA 4EHBA 3MGAA 2PX6A 3I2HA 5LIPA 3HXKA 2QVBA 2QRUA 1JFRA 5IVKA 3R40A 3IUMA 4WY5A 3WJ1A 2GBIA 5EHZA 3D2AA 4FMPA 5FOQA 1ZD4A 1CLEA 4W63A 4AO8A 1E8DA 2FX5A 1H22A 1EA5A 3LP5A 3T52A 4BBZA 4P93A 4K2AA 1DWOA 4AMZA 4KE6A 1MTZA 2O2IA 4J0IA 2QS9A 1LNSA 1LBTA 2HL6A 4N8DA 3WMRA 2ROQA 2Z8ZA 2XUDA 3BJRA 2QUAA 5CXUA 1SCQA 5AH0A 4N5IX 4Y2QA 1MAAA 4DNQA 3A2NA 1FFAA 4Q34A 1AZWA 4FLMA 2JGMA 5C8VA 3QMMA 1PFQA 1MN6A 4LXIA 1W1IA 3C45A 1JJFA 4E46A 1G42A 3ILSA 4LKOA 2ZYSA 4G9GA 3WIOA 5AHXA 4W9RA 3UUEA 5ALUA 1ODTC 2WM2A 3ESDA 5ALHA 1VA5A 2CMFA 2ZJ6A 4FLEA 2HFKA 4ETWA 2V9ZA 5HK8A 1YR2A 4MJ3A 4HS9A 2VJAA 2VJCA 5K5EA 3BF8A 5ALQA 3F98A 5CH3A 3DNMA 3F8SA 5ALRA 1UOQA 2Q0XA 4X93A 4MEBA 1OCEA 4QLAA 4HZGA 1XQWA 4W1QA 5CURA 4BAGA 4TVKA 4DGQA 5K3DA 1IZ7A 2ZVDA 3NOXA 4X6YA 4L9AA 3S2ZA 4EY6A 1QIFA 2QTBA 2G5TA 4CFSA 4IHAA 4ZXFA 2XDWA 3FYUA 1IVYA 3PUHA 1CQWA 5CW2A 2WIKA 1RP1A 4NS4A 5AJHA 4Y2VA 1XRNA 3IB3A 3G9UA 4X91A 1CUHA 4X71A 3I6YA 2AJLI 3I6MA 2DHEA 1MU0A 3AIKA 5ALVA 3K2IA 5EFZA 1XZAA 4GI1A 4UFNA 2XE4A 5K3AA 4AO7A 1CUDA 3BIXA 2XQIA 4AO6A 5CH5A 5DTJA 5ISMA 2V96A 1MX1A 1GKLA 2PPLA 1EINA 4M0EA 1LPOA 3WA6A 3LIPA 3AINA 3JWEA 3WWPA 3D4LA 3QZUA 3ESCA 1QJ4A 5HF9A 5JZBA 2VTVA 5T4EA 3WZMA 1DWPA 1T4MA 2XUAA 4FBMA 2HFJA 2QR5A 3FSGD 4BE4A 1AX9A 1UKBA 5AM4A 3G9TA 3WA7A 4INZA 3WJ2A 5C81A 4U2BA 1TAHA 1WCYA 4BB0A 4J0KA 1W76A 4KE9A 4K6GA 2LIPA 2J3QA 3VISA 5JD5A 2WUEA 3ZLVA 4Y2SA 3DYIA 1CUJA 2O2GA 1O6GA 2OGZA 2VJDA 4H7HA 1LBSA 1W6RA 1CIJA 1QIMA 4UHDA 4EY4A 2WHPA 3R3UA 4FTWA 1QTIA 3IDAA 4XJVA 1HDEA 3G0DA 5ALEA 2W6CX 4Y2UA 2EEPA 4G8DA 1AGYA 2OPHA 3WL6A 4AZ0A 5CT8A 4BVJA 5CBKA 1U2EA 1UT6A 2PU7A 3AZQA 5LZ4A 1EHYA 3C5WP 2H9YA 2Y2VA 1ZIYA 3RM3A 1UFOA 2AJDA 4PQEA 4BVKA 3IUQA 4OB6A 2QXUA 1DWQA 3W9UA 1BEZA 4S0XA 4XIIA 1DQZA 1HLGA 2IITA 2B61A 1R50A 1XKLA 3JW8A 1ZI6A 4CIAA 3TRDA 2G63A 1FFEA 2H7CA 2JEZA 5EGNA 4KR0A 4BTLA 5JASA 1K5PA 5D7BA 5SYNA 4WDRA 2OCGA 1XFDA 5FRDA 1DQYA 5JAHA 2GYUA 1YB7A 3FYTA 2OQVA 1BS9A 4KEAA 2JGIA 3DL7A 2WIJA 4QDZA 1D07A 2GYVA 3DQZA 2IX9A 3B3QA 2Y6VA 5HFNA 3PICA 1BU8A 4KRYA 5AM5A 4F60A 4BRZA 1K8QA 3HSSA 4HRYA 4Q05A 5D3ZA 1XRMA 4EBBA 3ICWA 4OU5A 4EUSA 4J0GA 3W04A 5AK4A 5ALOA 1GXSA 3R0VA 4UHBA 1XZHA 3C43A 2EDAA 4W1SA 5ESRA 5JADA 4QA9A 2H1IA 4ZRDA 4Q3KA 1SOMA 2O7VA 5HKAA 4B85A 3A70A 3BWXA 3GFFA 4ARAA 1R9MA 5AM0A 2OGTA 3ZLTA 4OPMA 1XRQA 4AB1A 5DJ5A 3KXPA 4EB0A 4FNGA 3AFIA 3U1TA 2HA4A 5JALA 4IH1A 5ALTA 1R88A 2GZRA 2Z3ZA 1IMJA 2AJ8A 1R1DA 1BN6A 4KE7A 5CT9A 1K4YA 1EX9A 1F0NA 3PFBA 2GBGA 2VT6A 5IVIA 3C6BA 3LCRA 3C5VA 1QIKA 3EBLA 1CRLA 1UKAA 1FFBA 1QO9A 3FCYA 4AQDA 3KOOA 3WWOA 3V1MA 2HA7A 3VJMA 5AI8A 3WL7A 1DX6A 3X3HA 5C7YA 3OC0A 3TEJA 3FVRA 3PF9A 4RPCA 3A2MA 5FUMA 4H7DA 2PU5A 5HFAA 1YCDA 3WI7A 2ORYA 5EHNA 5AI9A 1UK6A 4BAUA 5LKAA 2I3ZA 2ZYRA 4J7AA 3WLAA 2CB9A 2XUHA 2DR0A 1G66A 3IULA 2CJPA 5F4ZA 3HLKA 1A88A 2XB6A 4B7ZA 1F0PA 3QITA 1W4LA 5EIEA 3STTA 2B4KA 1QIHA 4QLOA 2X5XA 2QZPA 1XKTA 4FFWA 3BDVA 4BCCA 4IQ4A 3HYSA 5JAPA 2BJHA 4BCDA 2VAVA 2PVSA 1EXWA 3M81A 5DTIA 1VZ3A 3H1BA 5ALDA 3S8YA 4AX4A 4DNOA 4LXHA 4EZIA 3DLTA 4QWMA 2HA2A 4H7KA 5FP0A 5LZ9A 2JGEA 4J0CA 2R8BA 3UMJA 2BUBA 1DT5A 1E8MA 5ALZA 1Q84A 2BUCA 1SCIA 2WHRA 4ZI5A 4B0OA 3HZOA 1HL7A 4DMKA 1G4HA 1Q0RA 1KU0A 4P92A 1Y7HA 3ED1A 3H2IA 3G8YA 3HI4A 4LYEA 3W9BA 3WK7A 4QWWA 4JH0A 1ORWA 3H2GA 4X3CA 1YA4A 5JZSA 3R3VA 4H77A 3DOIA 2C5FA 4UBMA 4HXGA 2VA9A 1E89A 1JMKC 4WY8A 4Y2XA 2HRRA 4PSCA 4CG3A 4BTVA 3FVTA 1L7QA 1E5TA 2P8SA 1ZD5A 3V48A 4K6HA 1OILA 1N5MA 1RYYA 2QUBA 3K9BA 4X00A 2HA0A 5AK3A 3DJYA 4XX1A 1JI3A 1BROA 1XZIA 2FJ0A 3R3YA 1Q0ZA 3H18A 2BAGA 4GEGA 4UFOA 1QIEA 3TJMA 3WWEA 5ALNA 1WPXA 1YASA 3KWFA 4N5HX 4X7BA 2B20A 1WHTA 4C6HA 4Q3OA 3I6ZA 5DNVA 3YASA 4HTAA 2WJ6A 5CT5A 5ALYA 5DWDA 3B5EA 1TCCA 4NZZA 2WU3A 3G02A 3N2ZB 2XUIA 1ZD3A 3CXUA 3O9MA 4BDSA 4G4JA 5CXXA 1U65A 1QIIA 3CCBA 4ZGBA 3OTQA 3DKRA 2WUDA 1UZAA 4C88A 5AI4A 3R3ZA 1XQYA 1HQDA 1SCKA 3FCXA 2DHDA 1EVQA 5ALGA 1LLFA 4UHHA 4BP8A 4WCVA 1IZ8A 2QMQA 5IH7A 4QE3A 2VQ6A 2WUGA 3STWA 4MQLA 3G9ZA 3IIIA 1XRRA 1LPAB 3FBWA 4BDTA 1TQHA 2GZSA 5JATA 2Z8XA 5E2IA 1XZCA 5K3FB 2OCLA 2E3JA 1J06A 2OQIA 2RGUA 5LZ8A 1MNAA 4PF1A 1JKMA 1WOMA 4OB7A 2XUKA 5FPQA 2CKMA 4KE8A 2X76A 2GYWA 5AKEA 1EB9A 1JJIA 3I2IA 1A8UA 4BCBA 2HADA 5AM2A 3L1JA 4HXEB 3HC7A 4EA6A 3H1AA 2WTNA 1UK8A 1Z68A 7YASA 3L1HA 4HXFB 4BRSA 2ECFA 4F0JA 3IA2A 3LLCA 2YYSA 2XMCA 3QVMA 3CCCA 1CUBA 1ZGBA 3M3DA 3WIBA 4YASA 4OYLA 4N8SA 2XMDA 2XT0A 4A23A 5BOVA 2HA3A 1J2EA 1B6GA 3OOSA 3KWJA 4L0CA 2K2QB 3D2BA 3FOBA 2C4HA 4JNCA 3FSGA 4W1RA 3WKCA 1XLUA 2O7RA 2WFLA 5LYYA 4PNZA 5E4JA 4JUIA 4DNPA 1E66A 5A6VA 4CCWA 4B9AA 3LIIA 1ACJA 5A62A 3I1YA 4UPDA 2BCEA 2ZJFA 3ZLUA 1YS1X 4WJLA 4N8EA 1XZFA 2RIPA 4C4YA 3ANTA 4UHEA 4JYPA 4UBLA 2WHQA 2RHWA 2WKWA 1XRPA 2WFMA 4B9EA 3N0TA 3FLEA 1MJ5A 5AOAA 4DYHA 5CMLA 3MVEA 5AI5A 2V97A 1NX9A 4RGYA 1QGED 4L72A 5ALIA 3A6ZA 5ALLA 1CUIA 2BFNA 3QPDA 2HRQA 4G8BA 3QM1A 3HJUA 1BEEA 1KEZA 5AKZA 4FDMA 4X85A 5C8XA 1MO2A 4OUKX 5ALJA 1WB6A 1QONA 5JIBA 3IUNA 1BE0A 2VJBA 1ZI8A 3DOHA 2WJ4A 1HKHA 4E11A 1QTRA 4JEIA 2XMBA 4BZWA 3ZWQA 4B83A 1Y7IA 3EF3A 2ZYHA 1B41A 3QYJA 4YK7A 1XQXA 3ESBA 1N5RA 3C87A 3G0IA 4I19A 3AZPA 3V9AA 2JEYA 1CUFA 1PV1A 1QO7A 2JGKA 4KRXA 2H7YA 4CCYA 4FBLA 1MX5A 2HDWA 2RONA 1DT3A 4ZWNA 4E14A 2UZ0A 4I3FA 3ZI7A 4OCZA 5EHXA 4ZV9A 3GROA 4H7EA 4UBOA 4U2EA 2PBLA 1IUPA 3FLBA 3H2HA 3QH4A 1O6FA 1GPLA 3G9XA 4MWSA 3QPCA 1ZJ4A 3M82A 4XVCA 1SFRA 4DMFA 2RHTA 4EY5A 2VATA 5E4TA 3VKFA 3WK9A 1GQRA 5T4BA 3PUIA 1BCSA 3H17A 4X95A 3HEAA 1CUXA 5AKGA 3DCNA 4LYDA 2QM0A 4YX9A 1N1MA 4LIPD 4CCYB 3C70A 1VKHA 4C4XA 5YASA 4F5ZA 5HK9A 1ZICA 1TCBA 2XLBA 4X92A 5AI0A 2Y6UA 4JYMA 4KACA 4QDTA 5JD4A 4DSAA 1XQVA 1X2EA 4KAAA 5AK5A 4UHCA 4FNMA 3STUA 1Y37A
chains in the Genus database with same CATH superfamily
1PS0A 5L3SA 1ILEA 3NALA 2Q7DA 4QEDA 1H1LA 1PWZA 4EITA 4OJTA 4D4JA 2F1KA 1SIBE 1QZUA 1UJ5A 1E61A 3FMPB 3HBFA 5REQA 2J1LA 2OCIA 1HZZC 2QUKA 1NQVA 3TPFA 2VP9A 3ZWXA 3FOZA 4MWCA 4JX9A 4X7MA 4ENQA 1F2TA 1A7UA 3BBPA 2Z83A 3L82B 5BRNA 4E2ZA 5IW8A 4M1SA 3BHNA 4FOTA 4Y2RA 5JXIA 4OYYA 4HQNA 1GL9B 2HNBA 2YJ3A 4L6AA 4LV8B 1ZEMA 1O57A 1WTAA 1V95A 2E4UA 4Y0AA 1GT6A 1VJRA 1NW7A 5DGCA 3LUGA 1TMGE 1RJ9B 1S2DA 2R3SA 3NGLA 3NHKA 4GUAA 4W5JA 2VF2A 2W93A 4FB4A 1KQFA 3GLGB 1H1DA 2VLBA 5DN6D 1J42A 2WLTA 3O8DA 5COAA 3H9JA 1NDHA 2C5AA 3D3NA 3HA7A 3PFFA 2GXAA 2ZRLA 3JQPA 3LVFO 1RCUA 1WTCA 3ZIAA 3PNSA 3PA8A 4NLLA 3U39A 2A35A 2PXHA 3CX4A 4J0JA 4LXGA 3R44A 4MW0A 3TQCA 4UULA 5FKJA 1E9EA 1MOZA 4LK2A 2YHAA 1NR5A 1T2EA 3H5NA 2YWGA 3NVAA 2CXPA 4AJKA 3IUBA 3IVMA 1JE1A 4KMRA 4QPCA 3BDAA 1HNZB 1JDSA 1ZY2A 4W5WA 4ZXPA 3DE4X 2DHCA 2PUVA 4OJKA 5AOBA 1QYRA 3I05A 1EWVA 3LZCA 4MGZR 4H0CA 4WNCA 4ZO6A 3USZA 5FL3A 3P9PA 3H0CA 1TEZA 3EF1A 1M74A 2B92A 4E88A 4O2RA 4ZD6A 1FJ2A 5K8LA 1F8FA 3LO5A 3KKOA 5KBYA 1U5AA 3AOGA 5JD6A 3ZE9A 2JVIA 4TRRA 5J23A 3FAKA 3PXUA 1M9NA 2E6KA 4RTNA 4NQZA 3HWX1 1EDZA 2VFAA 1PW7A 2Y67A 3C6YA 4FFBA 1LVUA 1DL5A 3VI3B 1BXKA 3BGOS 1S2LA 3CNLA 4BKUA 3A7DA 3ZD9A 1KO7A 2OXTA 5AW7A 5A1JA 1WB4A 4AZWA 3KKKA 3LHSA 4HAIA 4DXDA 3DP7A 1IM5A 4FVTA 1NUTA 1CJVC 2RC6A 4NBTA 5B5SA 3BXGA 2INGX 1UOOA 4X64B 3W0LB 3AT1A 1CUVA 2OV2A 4BB5A 2EKZA 3SWWA 1GNVA 3RJ9A 3L5OA 1NE2A 3WHLA 2Z2YA 1L7RA 1R3DA 4TKUB 5FJIA 4D42A 4EVIA 1WCXA 5LZ5A 5CIWA 1KXJA 1NI4A 2MYNA 3LDFA 2WRZA 3C3BA 2RGCA 2CHQA 5CU7A 1QO0D 4IDGA 2O4CA 5CDTA 3SYRA 3E9NA 2AXNA 4FYJA 3LBIA 3PX7A 3GZNA 3V8BA 5I5EA 5LSAA 1DQNA 2EKLA 3P96A 4OIMA 5LZ2A 2YVQA 2DBYA 5BOSA 1N2HA 4CG1A 5E1OA 5T4FA 1G20B 1T8RA 2VO1A 3IL2A 3Q41A 4F6CA 1IIRA 3OO0A 1CK4A 2JG3A 1S3SA 2XZOA 1ORTA 2MMCA 3OPNA 3MWDB 2ZJ0A 2EHJA 4LOKA 4GXTA 3RREA 5IAOA 3O4IA 1PKXA 1WDKA 4NE7A 1RTKA 1II0A 5IKMA 4U9UA 3RSQA 1N75A 2WLSA 4RZSA 2J9FB 2ZYGA 3AEXA 4UQOA 4KQ6A 4QDUA 3FZYA 5F1KA 5FWDA 4MUBA 5FF9A 5L6LB 1R6BX 2Z43A 4BAZA 2KJQA 3OX1A 4C04A 1RZVA 3F5SA 2BGGA 2ODWA 2HF9A 1SCNE 2ESRA 2EFGA 3OFKA 5DIFA 1SBNE 4JQSA 1VE7A 4EKEA 1O4WA 4MQBA 4QICA 4XYGA 4A3SA 2WJHA 2HK9A 2QTVB 1W35A 2D2IA 4O02B 3HU1A 1R6VA 3FOFC 2Q8PA 4YLGA 3E0QA 3EIFA 3U26A 2FMTA 2PCJA 5BQ3A 1E1QD 1IG0A 3CN9A 4DNFA 1DKUA 3FTEA 1P91A 5KPDA 1BTOA 5JI3E 1IY8A 3O8OA 3BJMA 2QU7A 1SO8A 2GB4A 4P32A 3PDIB 4FQ8A 5TR9A 5LQAA 1FOEB 4YMWA 2XGSA 4Y67A 1SWVA 4IDAA 1UPCA 5BMVF 4IOLA 4F2HA 4UTVA 1YB4A 3QHQA 2J85A 2X4LA 1UQTA 4ZAFA 2OFFA 1MB4A 3EGEA 2JFHA 3Q5DA 1ESDA 4MTLA 4ND1A 1WEHA 2P9CA 1VTKA 4NMLA 5D1NA 2XUFA 1SM4A 2WSIA 3OMWA 2B6NA 1XNGA 2B94A 3L9XA 1JLLB 3JYLA 3SVZA 4Q9KA 4L27A 1Y8QB 3KQSA 1J2YA 3KSZO 4RZHA 2PRSA 1TQ4A 3S2UA 1CR6A 1R6TA 5DV9A 1HE5A 2C88A 2Z2JA 3DUFA 1D0VA 1ICEA 2UZIR 3C3PA 2VUUA 1SBYA 1E3DA 5IUNC 4I1VA 1KH1A 1NZDA 1VJ5A 1ZBQA 4FKZA 3HADA 3WIEA 4AJLA 2VSXA 3Q7EA 4HAWA 4O59O 1P8AA 4WOCA 4ZHQA 1SXJB 4P58A 3ZWBA 5PNTA 5FT9A 5B2EA 4ESVA 2REXB 3CB2A 4ARVA 1KI6B 1W5BA 3DEIA 2HV9A 4AI6A 4U5XA 1W93A 3T5GA 3FVQA 1XZMA 3DDUA 2P9TA 4YP0A 1P7PA 5G4KB 1FSZA 1RWKA 2G9VA 2MMGA 1QX3A 4TMVA 1UK9A 1FJXA 1G3RA 4ZARA 4QGBA 1C1YA 1MPXA 3NJRA 2YICA 4YJDA 3I42A 5ED0A 2D0OB 1DJLA 1ZIDA 3SYNA 1MRNA 4IICA 1USKA 2W2NA 3KUUA 4XDZA 5BUCA 3NBQA 4GPD1 4KIUA 4CQLA 2BFEA 2H2DA 3WHIA 1I4WA 5HM6A 2J9XB 1EXVA 2RE8A 3QLJA 3W2EA 3ONDA 1LW7A 4O08A 2V4ZA 3D8UA 3SGLA 2V98A 3BH7A 4Z8YA 4JJEA 3W5DA 5EWJB 2FQXA 4ASUD 4BMPB 2A0XA 3H1GA 4Q3DA 1T5SA 3RI3A 3SXUB 1T9DA 4K6KA 1S89A 4DAOA 3LXXA 2D1RA 4IDQA 3HY6A 1JYEA 2EBHX 2OAGA 4AYXA 4MUYA 2M2IA 1T5IA 1X1BA 3UK2A 4M6WA 5BP7A 2VP0A 1CR1A 3AERB 1ZC4A 1RAGA 2H9IA 1CY7A 4LAFA 4GYWA 2ZAIA 4JC4A 5BT9A 5AVWA 4JLPA 1IN1A 3CY6A 1TMYA 3AK4A 4EY7A 4RIEA 4WKGA 3CVWA 1CC1S 3FDFA 1R4MB 4Z9BA 3UANA 4DGSA 1F1BA 5AWFC 3AKYA 4H7IA 5JNRA 2DJ5A 2BKEA 4HRXA 1JNYA 2BR4A 1PG0A 3IBTA 2P9FA 4CKBB 4ZPJA 4PYNA 4V1CB 2ES4A 4H1HA 1U8CB 2O7QA 3ZWDA 1NAIA 1PZNA 3AP2A 3G0BA 4KO2S 4OQYA 5JG7A 3VH4A 5ENVA 2YC4C 3KCQA 5E7JA 5L7TA 2RAUA 1E69A 3MRTA 4OXRA 4G1FA 5K8UA 4AW9A 3N2NA 1X14A 1GRCA 2W2KB 2BHRA 1EHIA 4G4GA 3GC6A 4CMJA 3QJGA 3LJKA 1E8NA 4HN9A 4M87A 1T8YA 4PC2A 3C6QA 3UM9A 4MK4A 4B6RA 4EUFA 1BOFA 4H6PA 5CM9C 1GPKA 4Q18A 1V5IA 3KLPX 1N2SA 1P2GA 2BLNA 3NLLA 2ZUCA 4YP6A 3BRQA 3IMFA 1US8B 2XQKA 1G7TA 1XZNA 2LCFA 1PLKA 2YFKA 3FTDA 4HMPA 4IDPA 5TB5A 1G38A 1E4EB 3BSFA 3EZLA 3LUJA 3RROA 2YZNA 4LHXA 3SK0A 4DJ5X 1CUEA 1XTBA 1G6KA 1E2LA 1F4PA 5BSUA 1JG4A 2PT5A 2QRGA 1AF4A 3CB4A 1GCOA 4QOEA 1X15A 2C0PA 4CQMA 1UBNA 1WUYA 1WD5A 4XA8A 4PFQA 5ERGB 3CURA 3LYHA 4RM3A 2GLUA 4JVSB 4BNXA 2GEJA 2PX3A 3ZPXA 3G5UA 4YNBA 5J4KA 5JHHB 3JQ7A 4JELA 4XEHA 2FZLA 1E20A 1UFRA 4UAGA 2OE2A 4UQLA 3KQTA 4RH3A 3EZYA 3P5SA 4AS1A 1IOWA 5JEDA 4YAWA 1WBBA 1ZN7A 3K9LA 1HO3A 4FCWA 3TLYA 3DS8A 1CJKC 1ESEA 1TZ2A 4PRKA 2XB9A 5DOZA 3OCYA 4PM4A 2HYIC 5E1MA 4C5CA 5GTDA 4KMSA 1R37A 2RHOA 1RQ2A 3F97A 3HBMA 5G0UA 4OK5A 2QY9A 5ERXA 2XQVA 2Y92A 4MV9A 2VPQA 3H3XA 3SM3A 2WG2A 3AFMA 3OJFA 3UHPA 5LDDC 4XI9A 5IT4A 4LBZA 3BXPA 1NT2A 7ABPA 2J9GA 3LDHA 4P3YA 3Q12A 3QSGA 5CFQA 4O25A 2OBBA 4MITA 1Z74A 5I9IA 4P53A 3D64A 3DO6A 2OO3A 2VIIA 5BN3A 1TKRA 2V9PA 4FOLA 5CGQB 1PDWA 3ZXYA 2DSTA 4AUEA 1WNTA 3DXYA 3GFQA 3L6BA 3LLSA 3MQ2A 3COYA 3ADPA 2A3NA 2EG5A 4FCTA 4Z7QB 3Q88A 3WTCA 4ZOLA 4I6GA 4IFEA 2DT8A 5KWJA 4ZKEA 1KZGB 3BQNB 1CPYA 3E82A 3AHIA 3F3KA 4LDZA 5LLTA 3X1DA 3MCZA 5DLPA 1ZKDA 3EWAA 1PFUA 3DF9A 3QG5A 4BZZA 3TUZC 3GZJA 3C3KA 1FUKA 4MUHA 5J3JA 3LUAA 3HBLA 4K8RB 2YZ2A 3DYBA 4DLRA 3H5WA 1MJFA 3RC8A 2O3TA 4QASA 4RKWA 4LJRA 2JATA 3FF1A 5KOHB 4MV1A 2XMPA 3ZZ0A 3WAJA 5EXDA 2EU8A 2FZWA 2O4UX 2YXEA 4C7MA 4DE5A 4ZYUA 3SI7A 3H2KA 3USCS 3IBFA 2XKJE 4ZJPA 4RTPA 4KXWA 2FXIA 4YHHB 1N6RA 2VPIA 4FHZA 3T3HA 3BX1A 3U4GA 4C0WA 3FHOA 4PSVA 3GDFA 3F74A 3DMYA 3KXIA 4RKYA 1QBGA 4WVFA 1UFVA 4NCAA 1G17A 1X8KA 4IJWA 4BNLA 4D5GA 2IVZA 1LPBB 4BZPA 1Y6RA 5IBQA 5DYTA 3UMBA 2G8NA 2YVUA 2QGFA 4WBNB 1YS6A 4PWZA 2CFCA 3ZYZA 2L69A 3PSAA 2G5CA 4HDQB 5ENZA 4NBLA 2UXDB 5LP6C 2HCJB 5HZGA 3RU7A 1OLUB 1TCAA 3GH1A 5CFPA 5H70A 3O91A 2GJ8A 3CF4G 1GO2A 2OFPA 2OHXA 1J56A 3ESXA 2JJ2D 3I09A 5ARCA 4ER3A 5BNTA 2HSGA 1RWBA 1EHCA 1OHHD 4RK0A 2R62A 4Z1MA 3TSOA 4OGFA 3WQHA 4AF7A 2D7DA 3HACA 4DWOA 1AMOA 5C51B 3JQ8A 4BLUA 3DNPA 1USVA 3HHPA 2XPCA 5AJWA 1X39A 5K8VA 1X1RA 4U2DA 3GLQA 4X1IA 5JJCA 3PHIA 3HKDB 2I78A 2CWDA 5BN5B 1GNPA 4IH4A 4FZJA 1W5SA 1T36A 4WZ6A 5EQTA 1U8EA 3ONEA 4XARA 3EH1A 3M6AA 4LHSA 4RK1A 4TYNA 3R8FA 1RQRA 3EGXB 2HC9A 5EMJA 2BKLA 3PHHA 3PGVA 3W1WA 3HN6A 5CVVA 1HBJA 3TW8A 4CI9A 3MJCA 5JAOA 4HX5A 2Q6KA 3DZIA 1XEXA 3BE6A 2XUOA 3R9XA 4IF6A 1RZ3A 3W05A 2P0EA 2X86A 1KVRA 2BKXA 2V6FA 1Z5ZA 4XR4A 3SX2A 2O2ZA 4LYFA 1M72A 5K3CA 5BR1A 1J5EB 1EA7A 4X45A 1WWKA 4AS2A 2JA1A 4LUCA 1YAJA 1E3IA 2F90A 3OE1A 4J94A 5B53A 4MIYA 5JSKA 2FEMA 5ITZA 1DWUA 2WP8J 1EFPA 3TBFA 2AZXA 3AEKB 3NBYC 4KMOA 1X2BA 4L9RA 4NECA 4Z86A 3H7IA 2W2OA 1P6UA 3FOWA 2IV3A 3DB2A 4GECA 4KIGA 4NU6A 3HBAA 4S1OA 2IX3A 2V5VA 1OA1A 5KKNB 2FUKA 1TQ6A 1NC3A 3U1BA 1U0GA 2VF7A 1W75A 3PPVA 3D2LA 2WA1A 3FYHA 3DEKA 3HV0A 3JATB 2QYHA 1P5FA 2V7WA 4JBYA 2FW9A 4W8HA 1JMVA 2P2SA 4CE6A 1PTJA 2ATCA 2D8MA 3K4QA 1XZJA 2NUBA 4F96A 2VUIB 3LE8A 3ZH2A 5AUQA 4DDKA 1AC5A 2D1QA 3IV6A 1DXOA 1T5LA 1JEJA 2YJTD 3K9HA 1XDDA 2VA8A 3MCVA 3PFGA 4JT2A 4Q9LA 2PX4A 1RI3A 1VLJA 1P7CA 2DSNA 3HV2A 3EA4A 3KTFA 3T99A 3W2TA 1UMCB 1C0EA 1MAHA 3HGTA 2PSEA 4KAJA 4OB8A 5T5QA 3ASZA 2LCQA 4EG6A 5GMOA 1GPNA 3LUFA 4LSWA 1THTA 4H18A 5DNUA 1NVFA 1T5BA 3AF1A 3A8TA 5DLQC 3ROTA 2R2AA 3B78A 3GD7A 5LL6P 3QNWA 5ALSA 1IZ0A 3ZKWB 4UE3S 1FDVA 2I2DA 4ETIA 1I7LA 2BZ0A 4B3HA 5JLJA 3E5MA 5BV2P 2YMQA 1GGVA 3LNCA 4HF7A 4OREX 4DEXA 2MSWA 2J7PD 2W5UA 2ZRIA 3DZJA 2HU5A 3K1AB 3C3XA 3OCZA 4Z7JA 3HDYA 1GG2A 2O0HA 5KWIA 4ALJA 1X8LA 3AJ9A 3BA1A 1GKUB 1ZINA 5LQSA 5C1BA 4CDMA 4MS1A 4NY1A 3W2FA 2ZI9A 3FW1A 3DT8A 4Y30A 3WWDA 3WKAA 2W8BA 1BKDR 1YS2X 3ICQB 5EC8A 2A59A 3HVJA 4CWAA 3NV9A 5D00A 2CZQA 3Q8WA 4AJ4A 1E6MA 3RBAA 2VHVA 2XVZA 3DCJA 1IAVA 2ZUWA 4RPKA 1QGOA 4UBNA 1YE8A 1RZRA 2ERXA 3KJHA 3CGWA 4EYSA 2QX8A 3QK7A 5J5CA 2LRHA 5LD2C 1USGA 1X86B 1LZKA 1M5TA 1Z56C 1EDDA 3VAZA 4OX9Y 4X7RA 1CQXA 1V3QE 3FA2A 3FR7A 4ZV7A 3SZLA 3T4UA 3WDLA 2J5RA 4D0SA 3DGEC 1RU3A 5I9SA 2VUSA 1LQ2A 5LZ7A 3U56A 5F98A 4AUKA 5D8DA 1ZM3A 3KTAA 2P65A 3A9TA 1A0OA 2R11A 2WWRA 4IS3A 3GOHA 4OSPA 3RODA 3RVQA 2JC3A 1F9EA 1MVNA 2JK1A 2E7ZA 3JYQA 4Y6RA 2DBQA 5JNUA 1JVBA 3H5VA 1BA3A 3SEZA 4DXHA 1L4YA 5K4HA 1U9JA 4HAVA 1QGAA 3TR0A 3R8XA 4P31A 3JQAD 1XI2A 3QG1A 2FEXA 2H92A 2P27A 4MS3A 4RL6A 3IPAA 4OFZA 1V39A 1NKVA 2O1SA 1EX1A 2I8CA 3UA3A 1I3MA 5EJ9A 3CEPB 1CUGA 1KSFX 2R8RA 1ZJYA 1L5OA 5CP8A 4DV4B 1J2RA 1JEQB 4DRXB 1Q0PA 5CB0A 2QG6A 1N8KA 4NBNA 4TM7A 2BFDB 3B70A 5LQDA 3ZTWA 2R6DA 1XTTA 4YJ2B 1CU1A 4Q9NA 3TPZA 1L7OA 2F9LA 3B52X 2O05A 1H9BA 2I7CA 2D7CA 3F67A 2QN2A 3Q9UA 3ZX5A 4LMAA 2YBDA 1OWLA 4ROTA 2H1SA 4YJKA 1RXUA 3T9BA 4N41A 4DJEC 2VK1A 4G0XA 2C2HA 3RBXA 4GLFA 3LY7A 1EVJA 3VC1A 3BJZA 1RC0A 4BV3A 2C8VA 3G2JA 4EGAA 3IEMA 2Y1DA 4FHDA 1CQZA 2J0UB 1W8DA 1AH2A 5E1DA 3GG9A 1UC5B 5TRTA 1UR5A 2HK8A 4RMJA 3ZXSA 1WXWA 5JNSA 2XDQA 4Q12A 1CJUC 1F6DA 3CN7A 4OHMA 5HQTA 2NPFA 1IBLB 4D25A 1YOVA 2B4RO 4MWTA 5T8KC 2NQ8A 1EFAA 4U7TB 1M8FA 2CFTA 1AK1A 2IHVA 1XD2A 4Z99A 1NVAA 2VSOA 3TN7A 4X3OA 1E3WB 5JH7B 2OKCA 3BCHA 4YAFA 4ZZ1A 2Q4TA 2DPHA 4WACA 1DBWA 5JAIA 4YUVA 1TK3A 4IG4A 1P9RA 5AVOA 5GIOE 2RD2A 2OT3B 2PXCA 4I81A 5G53C 3RE1A 4YMUA 4MV3A 1RWNA 5BO5A 5ALWA 1ESNA 1MVOA 2AOWA 1QP8A 2QV0A 3NHSA 1KI3A 1UJ2A 2JI6A 3I92A 4UREA 2ZBVA 3T5MA 2FA9A 4EQ6A 5JS6A 2CCGA 5IABA 1T13A 2JBAA 1XTJA 2ZYIA 1H2RS 2QLFA 5EN4A 1WDTA 3D43A 5DSZA 5IMSA 1IM2A 2XXJA 4QOGA 2OTCA 2VHTA 5B3LA 5FYQA 4I9HA 3OPMA 4DAEA 5ITVA 1PYDA 5FNVF 2QTHA 3WGUA 1UCFA 2P1RA 3EDMA 3HJTA 1TRHA 4EHIA 4LA4A 3E18A 5C37A 3G49A 3PJFA 4JOQA 4NENB 2ECQA 4P4NA 2IEAA 2XMQA 3MS7A 4NG4A 4IS2A 2VAWA 2BKUA 4O6VA 4ASUA 1IY0A 2O5VA 3W06A 4QDOA 1ZD1A 4ALMA 1R3UA 5JSZA 1LWNA 2F3PA 4FYKA 3MWLA 5TQVA 2BTOA 1OFGA 3PCRB 4TS9A 3IIMA 3O4VA 2WWGA 3PL1A 4OQMA 3OOWA 5TDHA 3U0BA 4X94A 1AUOA 5IYZF 1T2VA 2FPOA 2GPWA 4TOIA 1EK5A 5KTPA 4KG7A 1RLMA 3INNA 2GD2A 1HE2A 3DXZA 4RAQA 4TTSA 4C6TA 3AIOA 3B6KA 4JD5A 5TVKA 1ILWA 2ZETA 4R05A 5FI3A 1XZEA 2ZRBA 4K3UA 1J8QA 4G5SA 2L18A 3F78A 4IKOA 3ICVA 1W4ZA 2IE0A 3PX2A 3PLRA 4IIEA 1IHUA 4B3CA 2IDKA 2PS3A 1UPUA 1Y1SA 4HVTA 4L8GA 4U0JA 1AV6A 1Z5PA 2VT7A 3CMMA 4UEOA 4HX2A 1G18A 1UXHA 1VXRA 1U94A 1IEVA 1WLYA 2LTAA 1N2ZA 1OY1A 3LLVA 4YFYA 3K1AA 4U6SA 5EZSA 4OHWA 4ARBA 3STHA 5KINB 1D2NA 1S2MA 3LC0A 1JFTA 1ORVA 2CMGA 1L5MA 1J6UA 2F62A 1M2EA 3CWCA 4AKSA 1QPZA 3C3CA 3MWDA 4C43A 3LQYA 2I2FA 1MX3A 2GN4A 4YP7A 1U3GA 3IBCA 3N0WA 3RVBA 4JENA 2YASA 4S35A 1GITA 4HLUA 2V7QA 2EHDA 3RKSA 5K09A 4X5OA 4U2GA 2JBHA 4L78A 4ZVUA 2GPSA 4H31A 4MPJA 5CLQA 1M1YA 4V0SA 2CYAA 2WM3A 3BMNA 1DOZA 1CXZA 1U28C 4RXTA 1ZOOA 3H87A 5F35A 1FYFA 3K05A 1QFYA 3HCPA 2BFWA 4FOOA 3UT5B 3A0UA 5CVCA 5EQDA 1GTVA 3JARB 4FLFA 4J07A 2FP4A 4MULA 3WL8A 4MW2A 3EWNA 3WDSA 1H5NA 2FP3A 4UBJA 2C59A 3KSUA 4IMRA 2NIPA 5M29A 5J2TF 2CNKA 4PNPA 3EUAA 1GN9A 2X0JA 3TM5A 1ZH6A 3UC9A 4YUAA 4LC9A 1EXDA 2XBUA 4GZMA 4EUEA 1RLOA 1XHLA 4AF6A 4LC1A 5I7OA 4CM4B 1W36D 1DEHA 3BCUA 4MQFA 1PJ2A 2BFCB 1JHZA 2ZYUX 4DPKA 1E2EA 2C8LA 2H0QA 3E9MA 2O3UA 3GLKA 1U9ZA 3KR2A 4D8XA 3UPTA 4IHJF 5AICA 1KQNA 3UJHA 4B6JA 1J8MF 4CEHA 3A25A 1W5AA 2HIHA 4KBYA 3EAGA 3OQNA 5EIBC 1JSCA 2A88A 3U81A 3KB2A 4E6PA 3I58A 3RS3A 4O5AA 1M1YE 2W2XA 3HCDA 2C57A 1E5LA 3B3GA 3QBTA 5IM5A 2VPXA 2WSLA 4U1RA 3RRMA 3T1HB 4BNDB 3WC4A 3FOEC 2ZR8A 1EU1A 3DAHA 4OJYA 3ZWAA 2RGDA 2C96A 4A10A 3VUEA 2H8GA 4MTCA 2P4SA 5REQB 3RG2A 4CLEA 1ZOSA 3EQ7A 4QUBA 4CQLB 2FETA 1LZLA 1P1RA 1U7UA 2VWGA 3AETA 2FPXA 1Y9DA 3CLTD 3ENVA 4G81A 1U2GA 4GX1A 1PGPA 4MUMA 4UBIA 4XUDA 3HJBA 4BMCA 3VO9A 4BMOB 4I1PA 4WSOA 4B0PA 3JZFA 1AKEA 5ERYA 2AFIB 4TTVA 3ZE0B 4JAVC 2REQA 3OUZA 5ALKA 1EFVA 1RYEA 1OJLA 1SVSA 2AS0A 1T29A 4QREA 3D7SA 4KGVA 3WLEA 2A5GA 3T1YB 1Z17A 4QOFA 3KSDO 4Y9RA 1F6WA 1HG1A 1XROA 4E4RA 1RJ9A 1MENA 3KQLA 1C7IA 1KIFA 1SB8A 2PYIA 2BPOA 2VYFA 1J8YF 3C85A 1H2XA 4H2DA 5KSWB 1CY1A 1XMJA 4IHJA 4AMUA 3GW8A 1GNLA 1O0BA 3J81k 2ZIUB 2QL7A 2XUPA 1M2WA 1EVIA 3AEQA 4FFNA 1P62B 1U0SY 4Z9FA 5I8PA 3GR6A 5HMMA 4MEAA 3NTOA 1X7YB 2IXGA 3MJ4A 2IYYA 3S7TA 3AB3A 5F51A 1XCPA 1C7EA 3V55A 5KOHA 3TQTA 4Y9TA 3ZEIA 4C4RA 1VIMA 2OHIA 3ECCA 3A05A 2GFQA 3U3JA 5JO0A 1LUAA 4HLCA 4RA9B 3PC4A 1CUAA 4JI5B 3O8RA 1RMTA 3TXXA 3WRYA 1UJ4A 4M1YA 3GPIA 2R25B 4OLFA 4R3UC 2FPUA 3RFVA 2IZ5A 1Z0JA 1C4XA 3FPJA 5EQFA 1V5EA 3R0XA 2AW5A 4JKYA 2WWXA 4Z9AA 3T7SA 4DNXA 4PYJA 1RHMA 3CA8A 3ZV7A 4MA4A 3DAOA 5B1SA 5JYCA 4GZ6A 4ZI7F 3WGJA 3O4HA 4D74A 1GAJA 3AUSA 1AK9A 2RGNC 2AL7A 4YPFA 4D96A 3TECE 2X15A 5KHOC 2FDCA 3CRVA 2DFTA 3KAQA 5A6SB 1TOAA 2GAIA 2PL1A 2XCSB 1PUJA 1SD2A 3MUOA 4HYEA 1RYFA 3K70C 1B3RA 4XJXA 1G7RA 2R8EA 1IUOA 1FXWF 2YV2A 4Y2GA 1ZK0A 3EXAA 4HV4A 1YKSA 2FMUA 3PQ5A 3PDCA 5CAEB 5EIAA 1UPXA 2KPOA 3E4DA 4E09A 4U63A 4JKIA 3AKCA 1D03A 4GSYA 1KO5A 2ID4A 3AUUA 3GQBB 1ICIA 4KLRA 4V39A 1X0XA 1NONA 5CUQA 1YNOA 2OO7A 4K03A 4ND2A 3IAFA 2C7GA 5DN9A 3STYA 2YMMA 1BQ3A 1R2QA 4PGMA 4EHBA 1JUDA 1NP6A 3MGAA 3C5EA 1JHPA 4EFNA 1D1TA 2ZPAA 3U48A 4GLJA 3BA6A 3K2EA 3NWJA 3FVVA 4NPHA 3ICOA 3HG7A 4Q9DA 4ZOQI 2CV1A 1AU9A 1D4FA 4PZLA 3JTMA 3FVWA 3T12A 2GF0A 1MOSA 2HKIA 3AHJA 5GV8A 2IZ6A 2OZPA 1E63A 4YBZA 4AJ9A 2QXYA 1O8BA 1W36C 1QQAA 4DVGA 4TV9B 1YQGA 5D2CA 5I9TA 4N7JA 2SCUB 4KXFB 5BPHA 4ZVOA 4D3SA 1PWXA 3D2AA 4FMPA 5FOQA 1ZD4A 4AO8A 4JSYA 1I0IA 1FE8A 4QHTA 1A9QA 1DKMA 2P4HX 1XVLA 2FWAA 3LP5A 8AT1A 2BCJQ 4K2AA 4OM7A 2UDPA 4FKMA 1RC8A 1KSGA 4UTRA 4O4HA 4DJDC 1PZHA 4KO8A 3DHWC 3VHRA 2FJUA 1ZJWA 2NO5A 5JBNA 1ULSA 1HT3A 3HYNA 3UPUA 3AVXA 1MTZA 4J0IA 1GD1O 2DOKA 3FPEA 3PBKA 4OQNA 2AIRA 9LDBA 1LNSA 1KJYA 5DBFA 3GLTA 1DQSA 2FZKA 4B79A 5IZ4A 3W34A 4QEZA 1QVWA 2CHVA 1IXSB 2C4MA 1JR3E 2ROQA 3KUXA 1BDHA 1J33A 1IY1A 2ACWA 3F71A 4Z4FA 4RZIA 1Z4MA 3D02A 3GRZA 1J5PA 4ZO4A 3JAWB 1DBIA 3CH5A 2C92A 1S1MA 2HLPA 1V4BA 2ONJA 5TQ2A 3PR2B 1I51A 4DQLA 1PVOA 5CXUA 4L07A 5EMMA 1OFUA 2HLHA 4BZXA 2VNHA 4RULA 5E2BA 1JP7A 2G71A 5T6BA 4YYZA 1E3WA 3H2ZA 1SIOA 2P9EA 4MAMA 2PBZA 3VMMA 4DQVA 1D5WA 3UMGA 3T95A 1BQEA 1E0KA 1KIMA 2XE6A 3CMCO 3JAKA 4FOPA 4FSHA 3BWYA 1UJ6A 3A4VA 1I30A 4N5IX 4DUGA 1MAAA 1O9GA 3Q9NA 2EVWX 2AYXA 3LNTA 4O2BA 1O94A 3MWEA 5HXAA 5DASA 3UN1A 4JJ8A 3UKOA 4KL8S 3NHWA 4RJJA 4FLMA 2YUTA 2IBSA 2O23A 1IE3A 3QMMA 2HO4A 2G88A 2XWSA 4P7KA 2GKSA 3C45A 1B8OA 1JAYA 3C7AA 4AWBA 4PN7A 1O4VA 3PDHA 1U9IC 4JHXA 3GPCA 4CM6A 2DR3A 4DCTA 1ZVQA 1G42A 3OLYA 5DXJA 5JTUA 2F3RA 5DSXA 3SZRA 3IE0A 5IASA 3A9CA 1N3BA 4MKZA 3S0JA 3WIOA 1QU2A 4IPTA 1X80A 2OHVA 3HP7A 4Q4JB 4F11A 3AVYA 4R8SA 3S1AA 4KQKA 4W9RA 2E48A 1V2HE 5ALUA 4CQJA 5IBCA 1Z7EA 1ODTC 3QEMA 4URWR 4GOJA 1I94B 1PFYA 3DDHA 4UAUA 3ESDA 4C05A 4IUBS 4DDHA 2VRNA 2ZCVA 3GWGA 9ATCA 5JY6A 1SHUX 4FLEA 1AVTA 1YNSA 2HFKA 1JR3D 2J0EA 2OM6A 2ZITA 3EVNA 3OT1A 4FGLA 4IWYA 1M7BA 2NU9A 2Q1YA 3QKWA 4IV5A 4CLXA 2VTBB 1C14A 2C4TA 3KR1A 5JJKA 1N25A 1PT8A 3AHFA 4L5AA 4MJ3A 3LYLA 3OWHA 3H2YA 4I6EA 1HSZA 3L7LA 3JV7A 1EZ4A 3LTNC 3R3SA 1EX7A 4LFBB 1RXYA 2BH2A 1U8YA 3BF8A 5ALQA 1Q5PA 4G86A 1J21A 5DSTA 5CH3A 5KMGA 1LB1B 1K98A 1M5UA 1HYGA 3RCBA 1U0RA 5ALRA 1YGYA 4LN1A 4DCVA 4LQDA 2IUFA 5FUQA 1RTTA 3KAPA 2WWYA 2R1VA 1H4VB 4MEBA 4QLAA 5FPYA 2V7GA 3VSDA 1R4NB 2O2XA 3QVLA 3UB3A 1CR2A 3TLKA 1RXIA 2P1ZA 3DE7X 4IJQA 4HQOA 4JSRA 2R1TA 4F6RB 5JQWA 5JYDA 4UNSA 1R16A 3UBTA 3X44A 5FX2A 3MEQA 1UINA 4TV8B 1H0RA 5K3DA 3TE7A 4UZEA 2R751 1Y6GA 4P3NA 4YAEA 4EKDA 3ZX4A 1VE3A 4TUYA 4F9EA 2NYRA 5IVPA 1C3OA 3HKCA 3NVMB 2OCPA 3K0FA 2DJIA 3S2SA 1IPHA 3R2JA 1NYLA 1T9AA 1IOLA 3O3OB 1U8AA 2ZTHA 1KS2A 4BY9E 4JI8B 1YC5A 2V6BA 3L8DA 3Q10A 3OAAD 4GKBA 1KI7A 3RK0A 4DRYA 2NSDA 4F91B 3I3SR 4NG5A 3V33A 1EGAA 2YDXA 3R0ZA 4CKWA 1UM9A 4NULA 2PSSA 3PNVA 4JDPA 3LX4A 4ZOEA 2FR8A 4CQMB 1JPNA 4QG7A 4ZXFA 4BWYA 4M0DA 1FBTA 1PT9A 3O8LA 4WA8A 1QB7A 2XJ4A 2J67A 1P44A 2XB4A 2XDWA 3FYUA 1W1UA 5J9FA 1YDHA 1QVAA 3E3LA 4X1KA 4AULA 4FGWA 1CQWA 3V6MA 4BNFA 1Z6TA 4I55B 5CW2A 2NYAA 1MBZA 1US8A 1JLRA 2EBFX 3MCWA 1XRNA 4AKHA 4QTTB 5C52B 2QAGA 5KZMB 2OYSA 2I0FA 1P3Y1 4YAOA 1L1EA 3I6YA 3I6MA 4UE6A 2W4QA 4KJZA 3C48A 4YJGA 5CDYA 1IRXA 4D0LB 1VRWA 1YR7A 3DOOA 3O3CA 3DTVB 4IXTA 4YRJA 4Y3UA 2CXXA 3DBIA 3MCTA 2PS1A 3EOAI 1XA0A 1D3AA 4HP8A 3EPKA 1QGYA 5B12A 2UYCA 3PNLA 4UFNA 1DB3A 2XE4A 2VZ8A 2QM3A 4M8KA 1FLNA 4UZSA 2VJMB 5JCJD 1DE0A 1K0FA 1OAAA 5K3AA 4RF3A 4EYGA 1CNMA 5F5LA 2OV6A 2PIAA 2YFHA 4JGIA 4KODA 2FQWA 5DNAA 5LR6A 2Q2OA 1D8AA 1S2OA 2B69A 1IEXA 1KYWA 4AO6A 1P2UA 1RZUA 5GJCA 2D8AA 1FTNA 3T3EA 1XP8A 4FDVA 1H2AS 1MX1A 4LV6A 4A6EA 3B8EA 5AHRA 5ITZB 1EINA 1OVGA 1Y4DE 3WGGA 3HDTA 3LIPA 3CO5A 2GR9A 3G7UA 1TAUA 4O2AA 5F7ZA 5EUBA 1GZDA 1Z2EA 5INTA 1FNDA 1XDZA 2D0PB 3LCCA 3JWEA 4S1NA 4IRXA 4C4OA 1ONBA 1H0SA 3VSAA 4WASA 3ESCA 2JHPA 5CIQA 4X8HA 5FNZA 5HDQA 4ZAGA 3GRAA 4ESHA 3TLMA 5T4EA 4DV2B 3WZMA 1DWPA 5KYXB 1T4MA 3FCEA 2HFJA 2ZYDA 1QJCA 2JFWA 3TIXB 4EB8A 5C5EA 3HR4A 4CHTA 4OHZA 4DR4B 1W73A 4NEQA 4P38A 4QD3A 1T0JB 3AR6A 1ZONA 1UKBA 2CFIA 4L8LA 3IV9A 4KW7A 1NMSA 5AM4A 3G9TA 4F72A 4RZ3A 3WA7A 3GJSA 5FOXA 3V46A 16PKA 1MLDA 1V5WA 3E7WA 2CNBA 1LNQA 2FWBA 4V24A 4CM8B 4AZ0B 1PR2A 3BKWA 2B99A 2JLCA 2I9PA 1WCYA 2F43B 2W2LD 1PEDA 1W76A 3AVPA 4KE9A 1YZGA 4WV3A 4UTNA 4OGLA 3RWOA 4EDFA 3ZLVA 4XLTA 1C1DA 1Z3CA 5B57C 1NJGA 2Y8EA 1QRTA 3FH0A 3U9TA 1CUJA 2FMKA 4CV0A 3VPCA 4J49A 2GJKA 2R7LA 4L4SA 5ILQA 4DSTA 1HFJA 1IBSA 3LT2A 3RJZA 3VYSB 3VAYA 1THZA 1W6RA 1S4MA 2O5EA 3KL4A 3H5OA 4UHDA 3A26A 4R1QA 5JOQA 4B3FX 3AEYA 4FZ3A 5IYZB 3A9UA 2QRLA 4R2WA 1FU8A 1S7CA 1QTIA 1NLMA 3PC6A 4ZMSA 1T0UA 3F4BA 4KN9S 4MKGA 4X41A 1HDEA 1CW2B 2R96A 4KO3S 2D3WA 1PD1A 3HYCA 2JIZD 5GONB 3TZHA 2C97A 3UGKA 3UK0A 2IPOA 3NBUA 2FQYA 3RIGA 2VRCA 4YH1A 3DO8A 2FEPA 1YT5A 4XUEA 1PJSA 3AY3A 1DC4A 2DUJA 3MYRA 3WL6A 4AX8A 5EXPA 4KR7A 4RD0A 4Y1GA 3SOZA 1LSUA 1PWHA 3RNOA 4BRWA 4YJHA 3V9PA 3LXRA 1XIVA 2F3SA 1DRVA 1C3JA 4O1HA 4OKIA 1Q6YA 1KDYA 4AF8A 1DKOA 2GVZC 4TMZA 3TLAA 3PQ8A 5IXYA 1QHXA 1A98A 5AMXA 1WETA 5FNVB 2V45A 6Q21A 3U7GA 1L6RA 3PKIA 1OXTA 3LWDA 3PD1A 3INRA 4LVUA 1C2YA 2E82A 3ITNA 3LUHA 4OUDB 1AUPA 5TE9A 2JD2A 5LZ4A 3BWCA 4D4GA 4E33A 2Y4NA 5C32A 4CQMD 5C18A 1Q57A 1T3SA 4I55F 1U7ZA 2SKCA 4TVSA 4FGSA 4XYMA 5ELXA 2EF0A 3RM3A 4YMGA 1UFOA 3JSAA 3PPIA 3Q2OA 4PQEA 2CXSA 3QWBA 2PT9A 2WBLC 2VCEA 3KFXA 3B5IA 1TJ5A 2AFVA 4ML3A 4RFVA 2YXNA 3BRWD 1P1FA 2AG5A 1DWQA 3D5QA 2FN8A 1FX0A 2LDBA 1JKXA 1SK9A 3W9UA 2YJGA 4Q02A 1SELA 1GL6A 4JEMA 2QBYA 1PFVA 3LVBA 1HLGA 4KUGA 1S3GA 1R50A 3JW8A 3KB8A 1GYRA 4PAMA 3W2HA 2EQBA 1VMIA 1UP7A 1PQWA 3DCIA 3MMNA 4B7XA 4YIHA 4CIAA 2WAOA 1OFHA 3H2SA 2ADFA 4OVKA 4EI9A 1WZ2A 5DLDA 4AMBA 3OOEA 1CETA 3HSKA 4OLJA 5EGNA 1PAUA 2DYKA 5JASA 5KYYA 1NHGA 2Z5VA 3RYFA 3V42A 2L2QA 3JRXA 1UBRS 2AWNA 2CNOA 1NVKA 5SYNA 4KPFC 4HLQB 5B6JA 1N0VC 2H4XA 3KJIA 1DQYA 4IY1A 2VHZA 4EL0A 4QT4A 3FWNA 1BS9A 1XDUA 3EEQA 4XYLA 2DWCA 2C77A 4S04A 2DETA 4Q3CA 2JGIA 4KQFA 3F2IA 1DBRA 4I9UA 2DWUA 1A1SA 3Q0TA 1HA3A 2PUDA 1GR1A 4D9MA 4QBHA 2O2DA 1JIIA 1D07A 3AP1A 3CW2A 4OHCA 3VC3A 2PRJA 2FSUA 4IJKA 3GRVA 1GPDG 1FYXA 2VP2A 1GZHB 3B3QA 1I0LA 5DO9A 4E7PA 4EW2A 1U8TA 3PNMA 3HDQA 4LHWA 5L7WA 4KRYA 3E9ZA 3RKRA 4HWKA 5JW6A 3JPYA 5BUSA 1O0CA 3GEDA 3LLUA 3WSTA 1U3TA 3QE3A 2NPIA 3BXXA 1K8QA 3E27A 5FQNA 1PK8A 1OFIA 3EIQA 2AMYA 3HSSA 3GJ6A 4CTMA 2J0SA 1CCWA 2NZWA 3ZDZB 2BM9A 2YIMA 5AHKA 2C8JA 1QV7A 2O52A 4M54A 1F8GA 4CM5A 4AVYA 5E9QA 5I48A 5E8RA 1VSUA 4OU5A 3U19A 5CD1A 1A9TA 3OZCA 4IW3B 1I3OA 4J0GA 1J20A 1ZRHA 4XD7A 1DAPA 3N7UA 1ULZA 5AK4A 3V6LA 1RXCA 1V11B 2K6GA 3WO1A 2YOFA 1C9DB 4Y9UA 5ECYA 2I1LA 3FIJA 3UHJA 4BVBA 1R8XA 4C0XA 5IJ9B 2BMAA 4PYRA 3PEUA 3UNXA 5C8YA 3K92A 4N12A 3EGVA 4DCPA 3IP1A 3EMVA 4X9XA 1VP3A 3P9ZA 4TV8A 3IEKA 4RHYA 5FBRB 4FC6A 1C9NA 1RXSA 3DPSA 3MTGA 4YTEA 2KWIA 5HKAA 2EP7A 3OBBA 1LRJA 1FL9A 1C2TA 3A70A 3VSEA 4ARAA 1LK0A 4NJEA 3A27A 1M76A 1T0IA 3KQOA 2JFXA 2RFLA 3OPYI 1A82A 4C0QC 2O59A 5AM0A 2QI9F 4MVJI 2OGTA 1T4CA 4MMYB 2I6UA 3NVKI 2XYRA 3KO8A 2F17A 5JZOA 1IZYA 1LF5A 3EB9A 4G1VA 1XCMA 1XRQA 3FJYA 4MR7B 3QVSA 4GKJB 3RYHB 1ENZA 1W0JD 1ZW1A 3WO0A 4B47A 1U4OA 3AFIA 4R1OA 1U2SA 3O1HB 3U1TA 5JALA 4WOJA 1C8BA 4E5YA 4Y98A 4NBUA 1N5IA 4HEA6 1U7OA 1R88A 2ONKA 3DDNA 4WLUA 1LEHA 1ZSVA 3E9YA 2PL3A 3JQQA 4MYCA 3S2IA 2FOIA 1R1DA 1KP3A 1F8XA 2NOAA 4DA8A 5LMZA 3F8TA 1JQAA 1GGEA 1AD2A 2G9RA 5KDLA 1VG8A 3P45A 3M6LA 3WNZA 3BHJA 4UDNA 3C2QA 3LDUA 3LV8A 3PDUA 3PL5A 2PYZA 3PFBA 5I9BA 1ODIA 4AJJA 2J9YB 1KRHA 1RI2A 3C5VA 2WYWA 3DDWA 3NV7A 3R7WA 3O90A 3U9SA 3LO8A 2I29A 2YWCA 3T3IA 4LJAA 5KCMA 2PKXA 3BERA 2VPZA 2PYDA 3EXHA 5CLGA 3I0MA 4BQEA 4QNMA 4CKEA 3WDMA 4AQDA 4MV6A 2JFUA 4OM8A 3CUVA 1JFLA 3W5AA 3WWOA 3QKUA 2ZB7A 5EMNA 4XRGA 3VJMA 2NXNA 1W0JA 2Q6VA 2XDQB 2PRYA 4U9IS 1YF3A 2WAYA 2WJJA 1XVTA 4CEIA 3EG5A 2E5WA 3WOHA 3PU6A 2VP3A 3S70A 2P75A 2ZSFA 1JLMA 1DELA 1O8CA 2HTEA 2ZKIA 1LK7A 2PU5A 3GU3A 2GKOA 1VPEA 1SBTA 1YCDA 2GO1A 1A9RA 3OTWA 1Z8NA 2NU8A 4OG2A 3GH3A 4BJ3A 3WI7A 2ZRQA 2ORYA 3EY9A 2BI7A 1C30A 1AKRA 1AHHA 4OJQA 4S24A 1E59A 3GFPA 1IJFA 3GCZA 3C3JA 2X7HA 4XYEA 2MIIA 5DEIA 4FGKA 4UU1A 4AJHA 4XCVA 1EJ0A 3KEFA 1KK1A 4RDIA 3WB2A 4HDRB 5KYKA 2NZYA 3EVAA 2IHYA 1BNCA 1BA2A 4GC5A 4P4LA 2XUHA 2DR0A 1G66A 3U4DA 2AFHA 1YVUA 3T6KA 4JI0B 4XD7D 5KWSA 4MOWA 2CJPA 4MYHA 1SJ9A 3MS4A 4DCSA 5LC1A 3ZN2A 4EWLA 2E49A 1MMFB 2GWRA 2XEDA 3H1EA 3CLTC 1WSAA 1EPUA 5EJ8A 3LX8A 1SU7A 4H3KB 4J1NA 4MQFB 1UMDB 2RHCA 4DDVA 5EIEA 3IP8A 3CO0S 2QX7A 2ZYTX 3R5FA 4TVBA 3WGKA 4QLOA 5M04A 2WAAA 5THKA 1I36A 2QJTA 4BQQA 3AR5A 5AVVA 2TMYA 4HK4A 3AVTA 4KPGA 7GPBA 4TZKA 1KVQA 4CF3A 5KUTA 1U2DC 2O1XA 3B7GA 4M86A 2P35A 4TV9A 3KVNA 2PNJA 2VAVA 2Z6UA 2PVSA 2R6CA 4A0GA 3M81A 5DTIA 3N87A 1VZ3A 1Z0KA 2ISQA 4REQB 1RWXA 2C9DA 1YWGO 2XNDD 4ND3A 4BUCA 4JXXA 1U1FA 1Y34E 4JYCA 2BRUC 4ILEA 1T2DA 1W85B 5DHTA 1PD0A 1W2HA 4DNOA 4JLBA 3A3OA 4RLHA 4EZIA 3ZDYB 3TX2A 1Q95A 4GL4A 4UNPA 4X0EA 4DLUA 2AR0A 2C4NA 5HKOA 3UGJA 5LZ9A 4RPLA 2JGEA 3KEGA 2PGOA 3WWYA 1ZHOA 2W00A 3ZW9A 4NESA 1Z08A 1B4DA 3U4QA 5ALZA 3NT5A 1WXIA 1W48A 3CG4A 3QOFA 2WZCA 3TOXA 2WPNA 3MJSA 4MMXB 3HVKA 5EE5B 3HZOA 3TJRA 2C84A 3W77A 3BIJA 3DOEA 2ZUVA 5CYFA 1KU0A 4FW8A 4HO1X 1Y7HA 2GPAA 1PZEA 3ED1A 3NH9A 4MI3A 5TQJA 4LYEA 3OLXA 3TIFA 4JZKA 4EDHA 3TSCA 5BMVA 4QWWA 5AW9A 5AOVA 2UUPA 1DTSA 3LCJA 3BL5A 3KALA 4EHDA 3H2GA 3KBBA 5MFPA 1BGXT 3L07A 4RJIA 1U5CA 2B21A 5JZSA 4P6VF 3WYEA 3ZZNA 1BVUA 2OO5A 2D2FA 3QPBA 2YZ7A 4H77A 3NETA 4NDNE 4AY6A 1JR2A 4JR1A 3OQIB 1QG0A 5KJ6A 2N0SA 2DQKA 2YVLA 2J48A 4FIDA 5H9VA 2PVPA 1GTMA 3ETCA 3S40A 2AEMA 1E89A 2O48X 2R6GA 2RHBA 4ND4A 5LA6B 3SFZA 4S1VA 3H7AA 2NVUA 3AU8A 3DKIA 3PVSA 5L6MB 4OHFA 4IIHA 1TCUA 2NO4A 4PSCA 1CIPA 4DJFC 1HLDA 3FVTA 1L7QA 1U90A 1RE1A 1E3SA 1NN0A 2ADMA 2P8SA 4PLWA 1ZZGA 3MG9A 1ADCA 4QPDA 4YY3B 2CGEA 3GGPA 2ZTLA 4K6HA 1YDMA 1RYYA 1K89A 3M5PA 3X2SA 1TQDA 3UQYS 1G21A 4XX0A 1B74A 4WH0A 1T0PA 5I7VA 1JG7A 2FDXA 1K8ZB 3N70A 1OKKA 4DV3B 1NNEA 3JD1A 1MG5A 4HFMA 1H94A 3ZU5A 3DO5A 2IT1A 1HV8A 5A3RA 2PQ6A 1DOHA 4L2IA 2RCYA 5AW0A 4N3AA 3RS8A 3KYCA 4YQFA 4FI3C 1VKOA 1PT7A 4OOFA 4GT1A 4R5MA 2DLCX 2PJDA 4OF4A 3BMXA 4AN4A 2Q4OA 1D2RA 1EGQA 2FWMX 3OT1B 4AP9A 1QUFA 2HPHA 3QV2A 4X7BA 5HILA 4A8PA 2B20A 3HO1A 2MSDB 2FH5B 3CRQA 1BS2A 3ILVA 3MBKA 4R16A 2Z2IA 3SKVA 4WXMA 4TTQA 3YASA 3V2HA 5BSHA 3HPQA 5FBHA 2WF8A 2CLMB 4R5HA 3I62A 1X1CA 3CSDA 4WLOA 4X61A 3GARA 2WVJA 1Y1LA 3LVRE 1QHEA 2AMFA 2IBMA 4JNKA 3UB2A 2A9RA 2BEWB 4BNHA 1VFNA 2HMSA 5EPUA 2JAPA 1FFSA 2PMCA 1QHHA 4L85A 4OUDA 1A95A 4Q1FA 2X6QA 4R6WA 3S8MA 2DR2A 2NV6A 2CCJA 2BHSA 4HB4A 5KAMA 1AO3A 3CXUA 1QF7A 2ZSEA 3VR2A 5JVDA 2G40A 3BFJA 2DKNA 5CXXA 2F4VB 1QIIA 3QYAA 1KP9A 4PZAA 2WHYA 3EC7A 2J0UA 4NYJR 2N9UA 4ZVLA 5K20A 2PVCA 4IWNA 1Y0BA 1URPA 4X1OA 1OTYA 3DKRA 2WUDA 3M33A 5CLIA 4C88A 5BSGA 3L0SA 2ODNA 4FMCF 2ETXA 1TJ3A 2HWXA 3EIEA 3OU2A 1DXQA 2EFYA 5DWQA 1AA6A 3PEWA 1JDZA 1HQDA 2PFSA 1MFPA 1NBAA 1TKBA 2X0IA 1T9GS 3L1VA 4JYBA 5I5GA 5SZJA 3WNBA 4BB9A 3C8MA 3L40A 5HOEA 4E22A 4A6DA 1LX6A 1RRFA 1LDMA 2Q5OA 4XWYA 4BIMA 5AVQA 1NURA 3G8CA 4PG7A 2QMQA 4DLVA 2QP9X 4RTKA 3U60B 1PEKE 1UZUA 5KNCH 2I4TA 4ZT2A 1IL0A 2Z57A 3CZPA 3FUUA 3LI2A 4I1YA 3TAXA 2VSYA 3FGPA 4ZMRA 3MRSA 1FDIA 4O3FA 4QUDA 3ET5A 1UC9A 2WSYB 3RAJA 1OXSC 4E13A 1TTPB 3FKSA 3OWXA 4X7PA 5F7JA 5L3QA 3L4SO 1H4QA 5B1IA 4IDCA 1XRRA 2QYTA 1A2QA 3FBWA 1XTKA 1OLSA 2OXRA 2PMKA 1YVRA 4IWXA 5IJAA 3V7WA 4DWJA 1OPXA 4BECA 1P6QA 2I3GA 6NULA 1XWWA 3C97A 1XL1A 3B13B 4BIIA 2DE0X 1X77A 4HPXB 2IP2A 2OCLA 3TAUA 3W7AA 2OQIA 1A5TA 3LHKA 2RGUA 3EY4A 3BM5A 3FD8A 3ZU3A 1CP2A 1MNAA 5CLLA 4HQ0A 4PF1A 2MINB 5AXCA 2V9CA 3QXXA 1IJKA 1KKUA 1ID8A 5JCJA 1LI4A 2XUKA 2PO5A 2PGDA 1M67A 1SURA 2CKMA 2VYCA 3A4NA 3A6EA 3CSSA 5TEVA 3RDPA 3SE7A 1QV9A 2AMLA 4BLOA 2FPGB 4EJ2A 5DW0A 5B1HA 4DKJA 2QN3A 2OLJA 1L5GB 1R0WA 3KP1A 3L7IA 5DGDA 3VZQA 2R4TA 2RJOA 1HTBA 3Q3CA 1W0KD 1EB9A 4PAQA 1M1YB 2R4UA 4JZYA 4WESB 4F5YA 4W5NA 5L4SA 4TLEA 2PLWA 1A8UA 1B0AA 4BCBA 3I30X 3MFYA 4KWHA 4L5YA 3SF8B 2YMLA 1PUXA 5EUMA 4Q3NA 1DC8A 4Q4HA 4EX6A 4YT2A 1U2GC 4NCBA 5K8JB 2WPDA 3LHFA 3L1JA 4HH0A 1KOJA 4UVIA 4NYMQ 3EUFA 4O5OA 3KKEA 1KH2A 2EJUA 1CDDA 3DBHA 1ESMA 1L7XA 4LE0A 3HLTA 4LDRA 4LRWA 5I7FA 2UUOA 4KXUA 3A3PA 3V32A 2WSBA 2GCOB 5EJEA 1EESA 5B4VA 4IDEA 1PJ3A 2OK7A 1Z0UA 1SG9A 1TO1E 2W48A 3TEFA 4KFCA 3LF1A 2WB4A 2HHCA 2IHTA 2W4IA 4IDDA 3BSSA 2WYUA 3O1IC 4KCGA 2ZFUA 1KQ3A 3DVAB 2YCBA 3G88A 4E2YA 3M6WA 3IA2A 4CCAA 2C8KA 1L6IA 1QSGA 4RTJA 2YYSA 2JJ2A 3T9CA 2XMCA 4LGYA 4QTZA 3TLGA 3TAHA 1C29B 3CCCA 1T3ZA 2RHMA 3PHGA 2I71A 1Y6FA 1BMDA 1XQ9A 1F06A 3QLEA 4GPZA 4MGYR 4EG8A 4NBRA 1PZFA 2XRMA 1QTQA 2QTWB 4FJ0A 3MXTA 2GPNA 3ANMA 4PX9A 2PGNA 3RQSA 1G8MA 3L43A 4IIVA 1PNRA 2A9QA 2VEDA 4LX0A 5BOVA 2HA3A 1KSHA 1XQ1A 3L7YA 4HRAA 1J2EA 3ACDA 3HCCA 1YS7A 4IJMA 4DARA 2MINA 4ZCTA 3B7PA 2BIFA 4US1R 2JFOA 5DGXA 1FRQA 1RXVA 1KKMA 2X0NA 3CC8A 3FFBA 2HBQA 3QI2A 2Q7OE 4P34A 1SD1A 2JIOA 2NU6B 2QLBA 1DRUA 4DB2A 2VC2B 1HETA 5GP1A 3VYTB 4U7HA 4A26A 2I34A 4P0TA 4ALLA 5DNYB 2QQFA 3GN1A 4XDGA 3UB4A 4OX9B 4MRRA 3AGPA 3DQPA 3ABIA 3WMFA 5TIIA 1U2QA 4B87A 1WU8A 2GTPA 2WTEA 1ACJA 4LWQA 1NBEA 3U4AA 3H0EA 3WDKA 3IA7A 1SK8A 1A72A 4C20A 1PK7A 4D9IA 5A62A 5LLDA 5CR9A 3KJNA 1EM8A 2W6PA 4P83A 1GTJ1 4NHEA 1ML4A 2OBYA 4CMCA 4OHKA 4ZQBA 3R7SA 3CPSA 3C8ZA 3FPCA 2ZJFA 3U80A 3ZLUA 1YS1X 2HR1A 4WJLA 2JLSA 1XYVA 3IUYA 4LECA 1VIYA 2C3YA 4DCJA 4JASB 1O5IA 3FMIA 1V41E 4HUJA 3F5FA 2O2EA 3KPUA 2WJPA 3MT9A 1ABEA 2IDZA 5L3ZA 1A71A 4JQOA 4PXYA 1LBHA 2RHWA 5HW0A 1XJWA 2AQ8A 5ARBA 2J5KA 3BGWA 4F5EA 2WFMA 2P6RA 2E55A 1O5OA 1MVLA 4A9AA 1ATIA 4B9EA 3D6HA 5JVDB 2VBCA 1MJ5A 1RAHA 2C9CA 2FR1A 4OL0A 1PJZA 1EWKA 4CEJB 5KS2A 4JP8A 1B76A 2CVOA 3O0TA 1O7JA 4H1TA 4X60A 1G291 4RGYA 3CVJA 3N74A 2R6AA 2G6BA 3F7TA 4AJNA 4I5IA 4RPGA 2PV0A 3A6ZA 4BP1A 1CUIA 2XCUA 3TIIA 5JTTA 2CD7A 4I5FA 2IRWA 3CZCA 2ECPA 3QPDA 3OJ0A 4DIKA 1NI3A 4PG6A 4D3ZA 1GGKA 3BE5A 3VBEA 3BXEA 2HRQA 4G8BA 1MV8A 4N9WA 2FSGA 2P2GA 1JIUA 3ZWNA 3NZEA 2Z4RA 1H9CA 4N49A 1BEEA 2CL0X 4MINA 2A33A 4MA5A 3ON5A 3VKWA 4D6XA 4EUHA 4FR2A 4FFPA 4X85A 1GTG1 3L7DA 5C8XA 1MO2A 2GEBA 1DAMA 1D2CA 3G6KA 1EBBA 3KOZA 4OUKX 3AGQA 5ALJA 2QY6A 3ABOB 4DLYA 1LRKA 3PGMA 1CVIA 2IYWA 2WVHA 4O4HF 3TL6A 5H4GA 5J2UA 1D4ZA 4EF4A 1Y33E 1GAXA 1UC8A 3RRXA 5CB4B 1T15A 3GXOA 4QG3A 1K9VF 5A5DA 1HNWB 4QBTA 4AL4A 4QPJC 3AI7A 4X65B 1MO4A 5AXAA 4BE7B 2A1UA 3HUTA 3IUSA 2UVQA 4RVUA 4DCUA 3CX7A 1G60A 1N9ZA 1UL1X 2IYRA 4KQHA 3M4XA 5JDIA 1EMDA 4AIRA 4G85A 1JSXA 1R9JA 4E11A 5GOZA 5JXJA 3JPWA 3L0BA 1VL8A 5GM2A 3G5TA 3RSLA 4PQFA 3DBOB 2IJGX 3NCHA 3ZWQA 4B4WA 4QTXA 5F76A 4BZWA 3PTAA 1WF3A 1E0SA 2BZGA 3MWGA 2FX2A 2ZE5A 3NUQA 4YK7A 3T7DA 2CDNA 4HLDA 3ZCUA 3O8BA 2PGJA 4TRNA 5BR7A 3GLRA 3H8JA 1J90A 3S1LA 2JEYA 3GP5A 3Q8LA 3LSTA 1CUFA 3MJFA 5C5DA 1Y5NA 3ZD8A 1K3TA 1PUIA 3NHZA 3M4YA 5GIPE 2JCGA 4KRXA 5ABPA 1X7HA 2H7YA 4FBLA 2JIPA 2VPPA 2RONA 1KZ7B 3OZBA 1GZVA 4GAEA 4HQRA 4MQEA 2R1UA 2RH9B 1JHOA 1NVEA 3RVSA 1I7DA 4AKIA 1RT9A 4JC0A 1TB4A 1VI2A 3LBAA 4MJXA 3OU7A 3VGPA 2VDPB 3L4EA 2UZ0A 3L8CA 3NKLA 2VHCA 4I3FA 1TQ8A 5EEGA 3VPDA 3FFAA 3ZI7A 1LFAA 4DCNA 3L8HA 4XWOA 3OPVA 4KI7A 1G8PA 3J80A 4LW8A 4BVGA 3P9NA 2FPIB 5LMUB 1RHRA 2D1TA 1C9KA 1CQJA 2O6LA 2P91A 2F6RA 1R74A 2QVXX 4DCCA 5HZKA 2CF5A 1Q21A 1B16A 2NV0A 5I7EA 1IUPA 1P7VA 3D81A 1ZSYA 3OZVA 3CX6A 3VVCA 1B1AA 1QQ7A 3G9XA 4IOMA 4F97A 2BGJA 4PIVA 1FS6A 2FR0A 4MWOA 3KC2A 3VFDA 3D7NA 1RWMA 1ZUWA 2GEVA 2A0WA 1MDFA 3A4MA 3QPCA 5ITWA 1YL6A 4QXOA 3RGWS 1ZJ4A 4FYMA 5L3RA 2Q28A 2EJTA 4LMPA 4IX1A 4J1QA 4D3FA 3I34X 5G3ZA 2FPWA 2LDXA 2OBFA 3UJPA 4DMFA 3BIFA 1I7QB 3F0TA 1VJTA 2VS1A 2Y76A 2ZE7A 3BD9A 1HC7A 1BFKA 1PCXA 1XB2A 3PR3A 5GAJA 3SQDA 3VKUA 4BV8A 4EY5A 3F4KA 4OQXA 3TO5A 1O97C 4D9HA 2MCFA 3FTNA 1UJMA 2XEXA 3TZ6A 3DCYA 4RKRA 4QSHA 3PWTA 4HN2A 3RVNA 2V1XA 3KM0A 2CXHA 1E1CA 3ZHRA 2BM0A 3C3EA 4QTUB 1IN4A 3PUIA 4BBPA 4RL4A 4ZKDA 2AG6A 3N8GA 4D98A 5EIXA 1R4MA 4HNHA 2A9FA 4WK6A 3DCNA 3LLMA 2ZDHA 1Y3AA 2Y9PB 3KLOA 1YMQA 4A92A 3DF7A 1ACMA 3OZIA 2P3QA 1TK9A 4EVSA 2ZT7A 1K66A 3GZ4A 4NV3A 4U02A 1ZAYA 4BO1A 1QV6A 5DK6A 1AKMA 2EOAA 2P5UA 2WIBA 3KVYA 3ZE7A 2H00A 1E58A 2GESA 4M1TA 4C4XA 1NXOA 1I3LA 1O77A 3GT0A 4F5ZA 4Z4HA 3U16A 3I0ZA 4G65A 1ZICA 3OJWA 1YS9A 2OL4A 2IOFA 2DY1A 2EZ4A 2HF2A 5AI0A 3A36A 2F55A 5IULC 2Y6UA 3PUVA 4JR2A 1LU9A 3BFKA 4KACA 5ALEA 4QGSA 4CM9D 4FZVA 5F23A 4FDLA 3KVOA 4E5NA 2XGMA 3I9FA 3OJXA 4JP2A 3WYBA 4CT0A 1XQVA 3BBLA 2K2WA 3ZY6A 1RM3A 2EFCB 5AW6A 1HWYA 3L8FA 4BWGA 3IJPA 4KAAA 5JWOA 4NZPA 4P4GA 5AK5A 1M8KA 4D3XA 4K9LA 4EEXA 1Y48E 1TA4A 4GM0A 3D8HA 3STUA 4XKJA 5TPZD 1PL7A 3RHSA 5K0FA 4JUBA 1P4HA 4ES6A 3PXDA 3FRHA 1JDNA 1F4VA 2P4UA 1I1HA 3K96A