8LDHA

Refined crystal structure of dogfish m4 apo-lactate dehydrogenase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
329
structure length
329
Chain Sequence
ATLKDKLIGHLATSQEPRSYNKITVVGVGAVGMACAISILMKDLADEVALVDVMEDKLKGEMMDLQHGSLFLHTAKIVSGKDYSVSAGSKLVVITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKHSPDCIILVVSNPVDVLTYVAWKLSGLPMHRIIGSGCNLDSARFRYLMGERLGVHSCSCHGWVIGEHGDSVPSVWSGMNVASIKLHPLDGTNKDKQDWKKLHKDVVDSAYEVIKLKGYTSWAIGLSVADLAETIMKNLCRVHPVSTMVKDFYGIKDNVFLSLPCVLNDHGISNIVKMKLKPNEEQQLQKSATTLWDIQKDLKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords M4 APO-LACTATE DEHYDROGENASE
publication title Refined crystal structure of dogfish M4 apo-lactate dehydrogenase.
pubmed doi rcsb
source organism Squalus acanthias
total genus 97
structure length 329
sequence length 329
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1988-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 8ldhA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 8ldhA02
5T6BA 1F14A 3DWFA 1E5QA 2RCYA 5CHEA 3GFBA 2CSUA 1WLYA 4PRKA 3BHIA 1TLTA 4OSPA 1GV0A 4Y8VA 2EGGA 4ZHSA 4FW8A 2W8ZA 4R69A 5BQFA 4NJOA 1JKJA 2QIOA 2UAGA 3B6ZA 1S6YA 3T7EA 2NU9A 3GAZA 5BR7A 5KTKA 4J0FA 2DKNA 3QY9A 2B35A 3ZV6A 4PLZA 3G0OA 3DOOA 4GSLA 5J23A 1H6DA 2DUUA 4OXKA 4TROA 1A9YA 4EEXA 5T5QA 3WICA 1ADCA 3K6JA 1LU9A 2FHSA 3GMDA 4Q3CA 4AL4A 1T2FA 2IZ0A 2F1KA 3DMTC 4CM9A 3WGTA 2NUAA 3C8MA 4L75A 3PHGA 5EN4A 2G1UA 4ZGWA 3O38A 1YQXA 3BHMA 4Q3EA 3IMFA 4R41A 1GUFA 4YEDA 1LSOA 4MVJA 4WPGA 1T1RA 5L7TA 5JCJD 4OXYA 4DQUA 2YFQA 1CJCA 4BNKA 1N1GA 2ZB7A 3ZDFA 3DBRA 1IPEA 3JQ8A 5TRTA 3PEFA 1I36A 4MDHA 3W4IA 4J2OA 2WSBA 1T4BA 1Z6ZA 3BMQA 2WTBA 3JTMA 2Z95A 1PZGA 4MKRA 1QRRA 3NUGA 2VHXA 4OKNA 1R0KA 4KTVE 3MZ0A 4TRNA 3E5RA 3PZRA 3GNSA 3GZNB 4Y6PA 5G0SA 1NYTA 4PLTA 2I76A 2IYOA 5TC4A 2D5CA 1PJCA 2NSDA 3PWZA 4IJVA 3RKUA 3GEDA 3INTA 4BKUA 1IHYA 1IY8A 1EDZA 2GN6A 4GMGA 3RSHA 1F8GA 1LSSA 3DAFA 3RBXA 1DB3A 2FPGA 9LDBA 1PJTA 4NNJA 2CDAA 3QSGA 1UXHA 4FDAA 3HFSA 5K9ZA 3ZWNA 3CTMA 3PZBA 2R00A 4DTIA 3BTSA 4GQAA 2H9IA 3GUCA 3LSYA 4JX8A 1K6IA 1B8UA 4DQVA 5IZCC 5A06A 5IDYA 1W73A 3RASA 1E6EA 3AFNA 3ZZNA 3E8XA 3W8FA 4OH1A 5TIIA 1KS9A 4OXNA 4UVHA 4EBFA 2Y1EA 1B8VA 2E37A 1ZK3A 1R12A 5A3VA 4QFCA 3BMCB 2YQ4A 4IS3A 3KSDO 3AJRA 4N5NA 4Y67A 2RAFA 1VJ1A 1DFGA 4AJJA 2OL4A 3PGXA 4XZ3A 5F21A 1C0IA 5AXDA 3GEGA 1JKFA 2VHWA 3C85A 4ONEA 4OO3A 7ADHA 3UICA 1DHTA 4J0EA 2BHLA 3AU9A 1LC3A 4YJFA 1KEUA 3PJDA 1NX6A 3AFMA 3DHEA 3R6DA 3X2FA 4CV2A 2DU8A 3WXBA 3FR7A 3IKTA 2EW8A 3MTJA 5G0TA 1D3AA 2HMVA 4UULA 1A71A 1SMKA 1HZJA 1U8XX 1ZUD1 4OOEA 3BA1A 1XG5A 3ROQA 4DBZA 2VTEA 3ZWYA 5CDUA 2C7GA 1XKQA 2J5QA 3HHPA 2YFHA 4Q9NA 2HUNA 5C7IO 1X7HA 1PR3A 4JJGA 1E3LA 4XYLA 1LQUA 2WWRA 2BI7A 3SC6A 5HBRA 1Y8QA 3BIOA 1BSVA 3R0IA 1EBUA 2IEDA 3FNEA 4CMJA 3HDHA 3ABIA 3QW2A 4CMIB 2WEKA 3I9MA 1BW9A 1KIFA 3QWAA 2AEJA 4RVFA 4WE3A 4BGUA 2CDCA 4YJGB 4DC0A 3TJRA 1XHLA 5G0VA 1UDBA 4MIYA 3I1JA 1WZIA 1HDRA 2W90A 4WEOA 3RD5A 4AJEA 1ZK1A 5CDSA 1MC4A 3LT0A 4BGVA 4ALIA 4BO0A 1E1KA 3ANLA 2DLDA 5HA5A 4JBHA 1FDUA 3KXDA 2NV6A 3NV9A 4G5HA 1WPQA 4J7UA 2AQIA 1F12A 3GZ4A 2NTNA 4BGIA 2PD4A 1U1IA 3F3SA 3L9WA 2CNBA 4I5GA 2IYPA 3W4JA 2VRCD 3RWBA 4R1UA 1SO8A 4S3MA 3RUEA 1NQOA 5JDIC 3U0BA 3OH8A 3QE3A 1RM5A 1NQTA 1NNUA 3NTRA 4J1TA 1QMGA 1YQDA 3HNPA 4E4YA 4JN6B 3GY0A 2GDZA 4PLWA 1OAAA 5TLSA 3MJTA 4NG5A 1AXEA 5L53A 2WD7A 5BSGA 1N7GA 4IZIA 4MKZA 4PZEA 5ENDA 5AQ1A 2PKQO 2JD1A 2Q2WA 1I2BA 2UVDA 1M6HA 1VJ0A 1Z75A 5G0WA 3WSWA 4Z3DA 3GQVA 3IL2A 1HSOA 2RH8A 5A5FA 4RF2A 1GDHA 4GGPA 1K5HA 3D5QA 5KVQA 3JQ8B 1G6KA 3V2UA 1UAYA 3H3FA 3TFOA 1QSGA 2B4TO 1GYRA 3ITDA 6ADHA 5BSFA 4GI2A 3VPHA 2VT3A 5EIOA 3BMQB 2P5YA 1EE9A 3RC2A 1T2EA 1GQYA 4XD2A 4ND1A 1PSDA 3JYOA 4OOFA 4NQZA 5TJHA 1GPJA 2Q49A 1UXGA 3PHLA 2X9GA 1RJWA 3DMTA 2HLPA 1ID1A 4BQPA 2Y1DA 3F1KA 3W4KA 2BI8A 1DC4A 1YB5A 4MO2A 5KJCA 1S7CA 4BS9A 1Y9EA 4FGSA 3FBGA 4J1QA 2O2SA 4LMPA 3DXFA 4E31A 3WTCA 3SC4A 3RC1A 1U7TA 1U3UA 4P8RA 1GY8A 1U3VA 2O7SA 3L4BC 4HXYA 3WS7A 1PL8A 2CD9A 1DLJA 3LF2A 4I5EA 1R4NA 4IZHA 3RUAA 4XQ9A 1AXGA 1ISIA 1EMDA 4PG4A 1C1XB 4Q3BA 3I83A 5DBGA 4YYZA 1J6UA 3GHHA 1Q7BA 4MVJE 1GYPA 3CKYA 3LVFO 3D1LA 1YOVA 2EKPA 4R1TA 1N9GA 1ZEJA 3TZKA 2BLLA 1E1NA 2I67A 5TSDA 5C5IA 4CR8A 4IS2A 4EGFA 3O26A 1HZZA 2CFCA 4J1NA 5BSEA 5TT1A 3EZYA 4BQRA 3ROKA 4A0SA 4BNZA 3GDGA 5TJ9A 3NT4A 4RORA 5T57A 3U09A 5IZCA 1Z73A 5FF9A 3ICCA 4AJHA 1HTBA 1QYWA 3OJ0A 4G65A 3O03A 1QKIA 1OBFO 5GZ6A 3BTUA 2X5OA 5KJEA 4O0LA 2WE7A 3PQEA 5EMHA 1C1DA 4GX0A 3IOYA 4A5OA 2PZLA 2PLAA 1MFPA 4FGWA 5A9TA 4XRGA 1HKUA 3GGGA 3LQFA 2X5KO 3G3EA 3NJ4A 2X4GA 3RUFA 1PWZA 4XGKA 1PR9A 2VZ9A 1GZ3A 4OAQA 4N54A 1VM6A 4BKOA 5IXSA 4U5QA 3ZWCA 5EL0A 1O5IA 2V7PA 3S2IA 3B1FA 2DBRA 3HSKA 3QLJA 4R51A 2C29D 2V6GA 4YBZA 1R4MA 3GG9A 3TRIA 2ILTA 1Y5MA 2O3RA 1W0CA 3ZU2A 4JJFA 3O8QB 2NWQA 5L4NA 3GF4A 1GTMA 2PY6A 4RQTA 2LDXA 5ICMA 3Q1LA 1PQWA 1GU7A 2JCVA 3QVSA 1PJSA 4I08A 1A5ZA 4U6SA 3PDUA 5EINA 4QSMA 4KMSA 1LC0A 1EUDA 4FJ2A 1U7HA 3FHLA 4NPCA 4L4SA 5GY7A 4WLFA 4DGSA 2VWGA 1DXYA 1LDBA 1YO6A 3PFFA 4PZDA 3M1LA 4YJHA 4CM1A 1P44A 5IF3A 2DTDA 3HWRA 4M8SA 4IJKA 4OJNA 3ZV4A 3AUSA 2C0CA 1NASA 3NDIA 4HNGA 5MDHA 4PG6A 1BVUA 1NAIA 1R15A 3BMOB 4XYMA 3TOXA 3WB9A 5DCWA 1MGOA 4W7IA 3OIFA 4D79A 5A05A 2W4QA 4PN3A 1LXCA 1WZEA 4LISA 4CV3A 1X1EA 2CY0A 3PHIA 2CZCA 5JS6A 1Y8RA 3H9UA 3NEPX 1E3JA 4DYVA 1FMCA 3PQDA 4GL4A 2YY7A 3QP9A 2C59A 2HKIA 3H8VA 4NI5A 1VKNA 2Q2QA 3ONDA 1HEUA 5JDIA 3WG9A 3JYPA 3PK0A 1MB4A 2PGDA 3WBBA 4IPTA 1ONNA 1CWUA 3TOZA 2BGLA 2GR9A 1HT0A 4FIZA 4RZIA 4MINA 4CQMA 1Y6JA 3HZZA 3NAQA 1MG5A 4MOWA 4BNLA 2CF5A 3GVPA 4OIMA 3JQ6A 4RV9A 1H94A 1ZH8A 1JKIA 5ILGA 2Z5LA 3KYBA 1VL0A 3A28A 3V1TC 1JWBB 3ZWVA 2B5WA 1ZNQO 3L6OO 3STHA 3U4DA 4G2NA 3ROPA 3I6QA 2A94A 4A2CA 2VTDA 2IZZA 2WE8A 2O50A 1IB6A 1HYGA 3ZWMA 1SNYA 1R4NB 2EP7A 4QX6A 1X0XA 1B14A 4IQGA 4O1MA 3OQ6A 1EDOA 1PQUA 3VTZA 4DMLA 3DTTA 1U8FO 4XB2A 5A9SA 3ZWWA 4CPDA 4CMEA 1ADBA 5L9AA 3OJFA 2HU2A 1YOVB 3DZHA 3Q6IA 4HUJA 2C2XA 1MXHA 1F17A 1W8DA 5AOVA 3UCXA 3VZSA 5L4SA 2ZIZA 1ULUA 5ITVA 3S55A 3UH1A 1BXGB 4OKIA 2HMUA 4YQZA 3OEWA 4AJNA 2P4HX 1UP6A 1D1SA 4WLUA 4D3DA 5DOZA 1PTJA 3L4BA 3L07A 4GLLA 1DDOA 7MDHA 3HB4X 3M1AA 2EXXA 4XQGA 4RPLA 1IL0A 2IXBA 1JN0A 4E2ZA 1Q1NA 1VPDA 3OJLA 2QYSA 3GVXA 3AW9A 1E3WB 1CYDA 1I3NA 2DBZA 3RVDA 4HV4A 3PLNA 4ND5A 4ZJUA 1K0UA 3D3WA 4NH4A 1TT5A 4FSHA 3Q3CA 1C1DB 2CVOA 4YT8A 1R0SA 4WECA 3R1IA 2H63A 1R6DA 4AJPA 1GCOA 2DQ4A 3KV3O 4TKLA 4GSKA 1PS9A 3SJ7A 1V35A 5JC8A 3Q11A 2Y1GA 1Q0LA 5C3MA 3LZ6A 4Z6KA 3FNHA 2B69A 1YJQA 5H82A 3I5MA 2Q1UA 2FPIA 3DZGA 3IP1A 3VDQA 1LA2A 4R4JA 2ZTLA 4JP3A 1UXIA 1PJBA 1Z45A 1ENPA 4K9DA 1NFQA 3PYLA 3GNQA 2PD6A 1X1TA 2HJSA 1V9LA 4BOYA 1GEEA 2EKQA 2GERA 4ND2A 2OMEA 4BB5A 5IZ4A 1E92A 4DUPA 4TVOA 1D4FA 4BO9A 3K73O 3DHYA 4IQ8A 5JYDA 1QLHA 4A10A 4TSKA 4JNKA 5BT9A 1IZ0A 1UR5A 2HRZA 2O3JA 4RGBA 5CEJA 4GBJA 3U9LA 3WJ7A 2C5AA 5EQFA 3I3OA 2X0RA 2EGHA 1IPFA 3N7UA 4KQXA 3FNFA 5GMOA 1T2DA 4Q3DA 4BO3A 4WK6A 4DWVA 3CMMA 1P0FA 3PJEA 3AM3A 3GUYA 1H0KA 4GKVA 3IC5A 3C24A 1NWCA 2NADA 1GZ6A 1DC6A 2O3UA 3WNVA 1NPTO 1I10A 2GN4A 2Y0CA 2EW2A 3EW7A 4L9RA 4H7PA 3A14A 1B8PA 5JY1A 2G76A 1HLDA 4K28A 1MV8A 3V1UA 1D1TA 5KVCA 1P0CA 4PVCA 1I2CA 5JBIA 3H3JA 4JP2A 4MVJM 1JWAB 1DJQA 2YDYA 5KWEA 1PL7A 3OBBA 1HDZA 3GGPA 1I30A 5KOIA 3FI9A 4GAEA 4B7CA 1KYQA 1Y8RB 3UVEA 5BSHA 3H6KA 4XWYA 3IJPA 1P31A 2BFMA 3I4CA 3VVBA 3CUKA 5TX7A 1U9JA 3RKRA 4BHTA 3WYBA 1NVTA 3JQBC 1P74A 1XEAA 3LT2A 4E12A 3ADOA 1GQQA 2QRKA 2ZTUA 5F1KA 3A1NA 5G4LA 5DNAA 3ST7A 4EUEA 1RYEA 3U4IA 4FPXA 4Y6SA 3WGGA 5A02A 1XU9A 3GDFA 1EFLA 1E3IA 4EITA 2UYYA 1T1SA 3EVTA 1QYVA 2CVZA 3JQAD 4BNFA 4GPD1 2HRBA 4R01A 2AE2A 2YHIB 4EJMA 4ND4A 4DVJA 4RJTA 4YT2A 4L4RA 4OL9A 4U0JA 3GH3A 1KY4A 4BO4A 4LSWA 4WLNA 2J3HA 4QEDA 1VC2A 4ALMA 1BVRA 1N2SA 2PZKA 3RC7A 5L45A 2XXJA 3UGKA 2DM6A 3RCBA 5FEUA 3HDQA 4YJGA 3GNTA 5EERA 1PGJA 4UUOA 3JQ9C 2OXIA 4BNGA 4J1SA 3PYXA 3BAZA 3A4VA 1ZEMA 4HFMA 1UZLA 3U3XA 3ETDA 4Z9YA 3H5RA 1E0DA 5TS3A 1P77A 3TZ6A 3QVXA 3PVZA 5L95A 4E21A 1ISMA 3C1AA 5F5NA 5JYEA 3D4PA 4UVGA 1O9BA 4MIOA 1WP4A 1YRLA 1WXDA 1EEHA 1H2HA 2XXBA 4LRTB 2Q46A 2UUPA 5A3JA 4TVBA 1LBEA 1PJQA 3HADA 4LGVA 3RU9A 3S2FA 1FXSA 4RVHA 4E30A 4WLOA 1DO8A 2NLOA 1MP0A 1VL6A 2Y1CA 4LVUA 5I9LA 2X8LA 3D3WB 2GF2A 4FFMA 1TT5B 1I32A 5JO0A 3DMYA 4AJ2A 1IUKA 1TEHA 4C7KA 4LCJA 3ON5A 1L7DA 4E2WA 3ASVA 3OA0A 4PLPA 2X58A 3RJ9A 4ZQBA 4BGEA 1RM3A 1DIHA 3C1OA 1GAEO 4ZU3A 3OJEA 1SAYA 2FN7A 2GZ2A 4L76A 1G0NA 2FP4A 2DPGA 1EVJA 4FD3A 4NK5A 3W8DA 2VYND 3PHJA 5CP8A 4NBTA 2A92A 2PGJA 1HDGO 1XU7A 1QR6A 1JU9A 2X7HA 1DOHA 1E5LA 2VNSA 4B79A 2YUTA 4WLEA 4BV8A 4E33A 3SVTA 1M75A 1NR7A 3CSDA 3AOEC 4J4HA 2EV9A 3D7LA 5AYVA 4N5LA 3DZFA 4J43A 4CODB 3RIHA 2F00A 1T26A 3DO5A 4WEQA 1R37A 4PLGA 1K3TA 2NQ8A 4YVFA 2EWMA 1CETA 1Q2XA 1ONOA 3W1VA 1GZ4A 4UAGA 4Y6RA 3H5AA 5IDWA 4DL9A 1LTHR 1ZVMA 3MJCA 1XLTA 1E3SA 3OECA 1R0LA 1UDAA 4LCEA 4BNMA 1E6WA 1BHSA 4E5YA 1EBFA 3HFGA 4ZQGA 5DP1A 2QRJA 2VHVA 3VZRA 1C1XA 3D64A 3JCZA 1L7EA 1TI7A 1WVGA 4IJWA 1E7MA 5K0ZA 3D5TA 3SLGA 4D3FA 1HL3A 3COSA 4AJ4A 1G1AA 5TNXA 4K1LA 4PZCA 5JAZA 4YT4A 2C54A 3F6YA 3L6EA 4CUKA 4D43A 5H81A 4B3JA 4WOKA 3V2GA 2DVMA 3VOSA 1NBOA 4H16A 1YB4A 3IIEA 4CLXA 2HCTA 1QYDA 1UZNA 3WJAA 3OEYA 4J3FA 2I3GA 2P91A 1AN9A 4EW6A 5KKCA 1P33A 3DOJA 2W2LD 2O7QA 1BMDA 1T2CA 3DONA 1Q7GA 1UZMA 3MOIA 2BFPA 3LT1A 1DC3A 3JQAA 4CLHA 1V3VA 3WGQA 1BRMA 2IXAA 4EDFA 1ENZA 4UVDA 1UAGA 2PTGA 3DC2A 5KKAA 4FB5A 2AA3A 2A4KA 4F46A 4LK3A 2OP0A 2WYWA 1CQIA 3NTQA 5F1PA 4BV9A 1BDBA 4YRAA 3AY7A 4W4TA 4RF3A 4RF5A 1M6WA 2OP1A 5CFZA 1NVGA 4ZQEA 4X54A 2GASA 2Q1TA 4BMSA 4UUNA 4BB6A 5CEEA 4HY3A 3S2EA 3ZV3A 2IDZA 4B8WA 1WDMA 2D4AA 1IULA 3AUAA 4KWIA 3WNQA 2H5LA 4A27A 3JQBA 4HNHA 4NDNE 2Q3EA 3JQFC 3KUXA 4FN4A 1PGOA 3G79A 1RM4A 4DQXA 3ZHYA 2OUIA 1Z7EA 4IDBA 5AVOA 4E5NA 3FR8A 3IJRA 4M49A 1XELA 2PZMA 2BD0A 2D3TA 4ZRMA 1C14A 3UHAA 2VNAA 2RHRA 4J4TA 1H6CA 2YV2A 4RQUA 4BIIA 4XJTA 3TSCA 3BZUA 4JXKA 5T64A 1YWGO 3O8QA 4CM6A 3RFVA 3FTPA 1OI7A 3FN4A 5HWSA 3TZQA 1CDOA 1OC4A 1HDXA 1PZEA 3FWNA 2AMFA 2VWQA 4MKXA 3V1YA 5I7SA 3CEAA 2HAEA 3RBZA 3RUHA 2RIRA 4R5HA 4WKGA 4D45A 2X0NA 1K89A 4Q3NA 4YDRA 3B1JA 3WMWA 2I65A 2J6IA 5HS6A 3MWEB 1KVUA 1N5DA 2J5RA 2XOXA 2FSSA 3F4LA 3OFSA 2EP5A 5EESA 4PGFA 4UEJA 1WDLA 2VYNA 1ZJZA 2EF1A 5COBA 5JCJA 5A4DA 1LLDA 3HE3A 1JW9B 3JQ9A 5HTOA 2P9EA 3KETA 4B4OA 5JAIA 2O4CA 3A9WA 4I8XA 3TL3A 4CLOA 4ZQFA 4GMFA 4YJDA 2ZQYA 5B37A 4LVCA 3BMOA 3GPDG 4E5KA 5ER9A 4W99A 2GD1O 2FR8A 3GT0A 1TA4A 1PIWA 1JQBA 2DPHA 4I9UA 4B8ZA 1NWHA 4AICA 2DFDA 1NM5A 3NGLA 2VHZA 1P1IA 2Y68A 4HADA 4PVDA 1ENYA 2X23A 1B15A 2B36A 4MVJP 1QV7A 3SXPA 5A03A 2VYVD 2PZJA 3LLSA 4FJ1A 2FR1A 1KEWA 1UUFA 2DTEA 3IQDB 3JQGB 4IIUA 3AM5A 4BO8A 4DLBA 4WOJA 4IBOA 3KTDA 1X7GA 3DOCA 2JKVA 1AUPA 4PLHA 3ZU5A 2R6JA 4BVAA 1VKOA 2DAPA 4BNUA 1J4AA 3C7CB 3FCOA 4J7XA 1MXFA 1W4ZA 1XQ1A 2D59A 3WFIA 1M2WA 3PP8A 1Y7TA 4L74A 4YXFA 3NRCA 4BNYA 2VN8A 1E1MA 1LJ8A 3P19A 3LU1A 3A06A 4NU5A 1O95A 5T8KC 4DBVO 4L8VA 3GN1A 2IZ1A 4C4OA 2EJVA 3PQFA 2Z1NA 4IMRA 3G1UA 1B3BA 1Z74A 2NM0A 5JC1A 2EERA 3JQEA 2CF6A 3AOEA 3JV7A 3PLRA 2O4UX 3DL2A 2WDZA 2NQTA 3JD1A 4FC6A 4D46A 1B0AA 1BTOA 2AE1A 1I5RA 3INRA 1U5AA 4WNIA 4E32A 3TF5A 5ADHA 1KERA 3DAGA 5F1OA 2Q2VA 3HB5X 1I33A 4AJLA 3VHRA 4FJ0A 2I5PO 4FR5A 1PL6A 3ZNPA 1BXGA 1VI2A 1VLLA 1ARZA 4XA8A 3CZRA 1V3TA 3KOUA 3JSAA 4ZQHA 2JCYA 4NBUA 1AHHA 5JDCC 3SEFA 3H9JA 2AEMA 4YR9A 1HF3A 3E48A 4TRMA 1H6AA 3QWHA 3GPIA 3JQAB 3KLPX 3ONFA 4KUHA 1GPDG 4O5OA 1DRVA 1SOWA 1ISGA 3K5PA 4IXWA 1B26A 1E3WA 4YCAA 1YL5A 1FK8A 1YL7A 2HQ1A 3KRTA 1Z7BA 1LUAA 4NZ9A 4A26A 2QG4A 4RPJA 4N7RA 2AHRA 3FBTA 2VWHA 4NJMB 4BNWA 3FRJA 3H9GA 1QLJA 1Q0HA 4BNIA 3GHYA 4J2HA 4CJXA 2VT2A 4P22A 3OSUA 4YPOA 5KJFA 4ND3A 1BWSA 4YTEA 4YB8A 1K6JA 2PR2A 4E2YA 4R3NA 1B3RA 1J5PA 4YAIA 3ZNQA 4JGBA 4M86A 4PG7A 1ULSA 4Z0HO 3TQHA 1JLLA 1RM0A 3QJ5A 4BNTA 2OHXA 2VRBA 4MVJF 4PFJA 3AUUA 5GZ1A 2BH9A 4TRRA 3C7DB 3EVNA 1NAHA 2V6BA 1R16A 2G82A 3B1KA 3DAPA 4U6QA 3BXXA 3D3EA 4CMAA 3ZN2A 5BNIA 1JAXA 2BMAA 3GOHA 3WGOA 5COAA 1H2BA 4I1IA 3K2BA 8ADHA 4CM5A 3QQPA 4KQWA 3F5SA 4XEHA 1QYCA 2VRCA 2H1SA 4PG8A 1NQ5A 1HXHA 3CPSA 4AFNA 1KY5A 3RUIA 1DEHA 4BL5A 3ZCXA 2WYVA 2FMUA 5I9MA 1AGNA 4DIOA 5B12A 4XQEA 2EG9A 2EJWA 4CQLB 3NKLA 3JQFA 4P4NA 1A7KA 3S1LA 3OETA 1T2AA 3WDSA 3VKUA 3GC6A 3I9OA 4WLVA 4EZBA 3JQCA 2BFOA 4CLDA 4XDYA 2AEFA 3TPCA 3K92A 1U4OA 1JVSA 4CLOB 3QWFA 2Y99A 2GGSA 2GN9A 3ANNA 1NFFA 2VYVA 1KOLA 5CAEA 4YAEA 3IUPA 4ILKA 3UUWA 4OQYA 1LRJA 5HS4A 1U28A 4ALLA 1N8KA 3UCFA 2J3JA 4XGNA 3KEOA 3EAGA 4WCFC 4AVYA 4PLYA 2JAPA 2OO5A 3LK7A 4RPKA 2FY8A 3WGYA 4DRYA 1SB8A 3LC7O 1GUZA 2VWPA 3QVTA 4KTTE 2J3IA 4XJSA 3JD2A 1DRUA 3I4FA 3K31A 3RQSA 3T4EA 4J6FA 2PGLA 3C7AA 4OM8A 4HX5A 1N92A 2HMSA 4Y9DA 3NT2A 5JFOA 3ZU4A 1H5QA 4U7WA 2ZYDA 3ZHBA 2WD8A 4CR7A 1PX0A 3VH3A 3SBOA 4D7AA 3HN2A 3G17A 2AQ8A 3CXRA 3ASUA 2NVUA 1U2DA 4U0KA 1Q7CA 4FFNA 4CLRB 1WWKA 1EVIA 5ITWA 1HETA 3S2GA 2RH4A 4QTZA 3QVWA 4XB1A 2NNLD 4EJ0A 4M55A 4KWHA 3UN1A 1C0LA 3WQRA 4LRSB 3MJEA 3RJ5A 4B4WA 4EI2A 3F9IA 5JW6A 1PS8A 4LW8A 3I6IA 2YHIA 4C7JA 4JK3A 5U1PA 4II2A 1U3WA 1VSVA 3E9QA 2PNFA 3JYNA 4XYGA 1ZSVA 3VDRA 4M89A 2ZTMA 3TWOA 4TMFA 5LDHA 5G0UA 2QZZA 5IAAA 1IZ9A 3AI2A 4GH5A 3VPGA 3GDOA 1X7DA 3ZWOA 2X9VA 3B20A 1XSEA 4NFHA 2V65A 4XKJA 3PWKA 2JAHA 4RLSA 3DZKA 3OM9A 1M66A 3E6AA 4A73A 1O94A 4XYBA 3U4HA 3ETEA 2PK3A 5T67A 2EHDA 2XAAA 1B16A 3QHAA 4DPMA 5JE8A 1ZK2A 3CH6A 4HFRA 2QQ5A 5IXYA 1ZSNA 5T8KA 2UDPA 5CDTA 2CVQA 4IY1A 1KVSA 5A5EA 3HJAA 1OFGA 2Y66A 1YXMA 4UEOA 3PRJA 3SLKA 5IDQA 1IYZA 2GPTA 2GZ3A 3GA0A 1BXZA 3TFQA 5B4UA 4CV0A 1ZK0A 3WLFA 4RVUA 1BGVA 5L7WA 4GWGA 4YWJA 1CIVA 1EQUA 4JLWA 2Q45A 3KBOA 1OMOA 2E82A 3ZWXA 3SX2A 5C7LO 3DZJA 4Z0PA 5JCXA 2FPPA 4DIBA 3I9KA 1XR3A 2NU6A 3TZCA 4DMMA 4URFA 1MG0A 2NU7A 2OGUA 4OQZA 5CDGA 4NBRA 4HBGA 3PYMA 3ITKA 3DR3A 3FTNA 5G4KB 3NGXA 1DIGA 2WYUA 4I9NA 3QA9A 2GLXA 1ZKMA 1SEPA 1J0XO 4XR9A 4M54A 1LX6A 1DAOA 1YL6A 1C3VA 1U3TA 4FC7A 1ZFNA 3NT5A 4RZHA 4LMRA 4B7XA 3R3JA 3ZNOA 1YGYA 2HDHA 5FWNA 1HE4A 3OJOA 5CEFA 2ZCUA 3LT4A 4DC1A 4BO5A 1YS4A 3G49A 5A04A 3KO8A 1X13A 1P1KA 5COQA 3F5QA 4J7CA 1LDYA 4WASA 2C20A 5U9CA 3C1TA 2OORA 5THKA 2XF8A 5AXCA 3IKVA 1I2ZA 4CM9D 3UFXA 4ALJA 2IRWA 1HE3A 2V6MA 2NACA 4JJIA 4GKBA 3JYQA 5TT0A 4MVJD 3TN7A 4CUJA 5IDXA 3FF4A 4UUPA 4QO8A 2HMWA 4IXTA 2Q4EA 1YDWA 3ICPA 2Q1WA 4KP7A 1EUCA 5I8ZA 1ISHA 3GVHA 1E7YA 1HDOA 4NU6A 1D7OA 4DPLA 2A9FA 4DIFA 4J9UE 4MP6A 4DXHA 2FOIA 3CE6A 1LDNA 3VH4A 4ITUA 4E13A 2X0IA 1GL3A 4RLHA 3MWDB 3WTBA 5B4VA 3KYDB 2PH5A 4JROA 2PD3A 3KSUA 3V5NA 4IUYA 3NX4A 1CRWG 1ZW1A 4BNXA 1XCBA 2GNAA 1A7AA 2I9PA 4Z9FA 3AOGA 3KM0A 5IJZA 1NTOA 3GVIA 3VPFA 1XYGA 2Y67A 5FYDA 4BMVA 5KVVA 4IGFA 5KVSA 3GR6A 1NP3A 5JMPA 4UVIA 1P1FA 3H7AA 3EYWA 1I3LA 5C37A 2BKAA 3P2YA 2NVUB 1BDMA 1YE3A 3WSVA 2SCUA 1SCUA 8LDHA 3KEQA 3BTVA 1EVZA 5JLAA 3UCEA 3WGIA 2G5CA 4W82A 3GGOA 4WCFA 3H9QA 1O8CA 4F3YA 1YJ8A 2LDBA 3E03A 1FDSA 4CM4B 4IDCA 4O6VA 2I99A 3EC7A 1XIVA 1TXGA 3LF1A 5IN5A 3RU7A 1F0YA 3MTGA 2TMDA 1EQ2A 2JD0A 4RVDA 2E6UX 4QUKA 4ZRNA 3HN7A 3H2SA 1Y9AA 2P4QA 3DHNA 2W2KA 2WMDA 3UOGA 3K9QO 3WGHA 1MC5A 2ZJ0A 5KIAA 1DBVO 1WAMA 2OFPA 1TVEA 2IEBA 4P4LA 2PA3A 2JFFA 4YQYA 3HDYA 3ZWPA 2PV7A 2GSDA 5L40A 4ID9A 1I3KA 3G1TA 5DZSA 4CL3A 4BNVA 1E77A 1EZ4A 1YQGA 3NDJA 2VHYA 3WX0A 3GMSA 3NYWA 4HP8A 1PZFA 3B70A 4O59O 4RVGA 2PH3A 3C3XA 4CMCA 4D42A 2YW9A 5DBFA 4HFJA 2FSVA 3D4OA 5ER6A 3OIDA 1O89A 4XR4A 4WUVA 1Y81A 4A03A 1V6AA 1XA0A 2C7VA 4NBVA 3I9JA 4NFYA 2G17A 3EK2A 3R3SA 4NK4A 1PJ3A 5I9NA 2GYYA 4MVJH 4RO0A 4B4UA 3TZHA 3ZI0A 4QECA 4CMKA 2VUSA 4CV1A 1ADGA 3NDRA 3GEMA 3MEQA 1DC5A 2QHXA 3PFWO 5JSFA 1F8FA 4UVEA 2VUTA 1ZBQA 2E49A 3OF2A 1LLCA 3AM4A 3N74A 1HE5A 1J49A 3H2ZA 3DBLB 3MCVA 1OZAA 1RKXA 2JD2A 4UEKA 3JQGA 3VPSA 3ZNNA 1SZJG 1RWBA 3K2EA 2Q50A 2C82A 1QP8A 2YV3A 3HDJA 1X15A 4AJKA 4K6CA 4Q3AA 3PHHA 1P9LA 1WMAA 2O3SA 4YAJA 2D2IA 3F4BA 3D4NA 1FDWA 3EGOA 4ALKA 1ZXBA 5L3ZA 4EUFA 3PGJA 5JNLA 3TL2A 4IM7A 3AI3A 1KEVA 5L51A 2ZYAA 5DBIA 3KYCA 2ZTVA 1B7GO 1ADFA 1PGQA 4MJLA 2YZ7A 5DCUA 4RDIA 4ZD6A 5ICSA 2QZ9A 1NHWA 1Y5RA 3E18A 4IDAA 3DBHA 4RF4A 2HK8A 4M87A 3L9XA 1ZSYA 1F06A 5L7YA 2GO1A 3ZGYA 2HSDA 3M2TA 5ILOA 4CM7A 5CG2A 4OGWA 1LSUA 3MJSA 3W6ZA 1NHGA 4GVXA 4XGIA 3X2EA 3W6UA 4CUZA 1YVEI 4K26A 1VL8A 4BO2A 1LRLA 1XWFA 4R9SA 2DFVA 3BTOA 3GVCA 2G0TA 3KZVA 1SBYA 3FSRA 2YV1A 1GFSA 1ORRA 3E82A 3UKOA 3EUWA 1QYXA 2J3KA 2HK9A 3H4VA 2ZJ1A 4GX5A 2ZQZA 3ZV5A 4Z3KA 3L6DA 3H65A 1LI4A 4CMBA 3E9NA 4RVSA 1R66A 2C2YA 3WQQA 5U4QA 1PQPA 1A9ZA 4YT5A 1YBMA 4ZN6A 4NJMA 1TT7A 9LDTA 2O48X 5LC1A 3OIGA 4W9NC 3Q2KA 4WCFB 1N1EA 2YJZA 1KVRA 1OC2A 2B5VA 5JMWA 4R5MA 4YA6A 2WJPA 1BXKA 4DYDA 4E3ZA 4PCVA 4EYEA 3E5MA 2Z1MA 4NMHA 1ZO8A 2HK7A 1KVQA 4FBGA 3PTZA 3PDJA 5LDGA 4ZA2A 3KB6A 4I9HA 1PS0A 3DDNA 2Y1OA 4P4GA 4II3A 1NR1A 4E0BA 3RBVA 5HRUA 1LLQA 2ZATA 2W2KB 1I0ZA 4UUMA 1FDVA 4OYRA 5ENVA 2XPCA 1QV6A 1L1FA 5BNFA 3WWYA 1ZMOA 4TQGA 2ZK7A 2QYTA 3AY6A 1ISJA 3OMLA 4L73A 4Z0TA 3JQDA 3LYLA 2V6FA 2X1HA 1PJ4A 4ZVVA 3VH1A 4E5MA 2VZ0A 2W98A 3F47A 3MJ4A 1UXKA 3GK3A 5F5LA 2OBNA 3GLQA 3PXXA 3QVOA 1GCUA 4NIMA 4CQLA 1ZXLA 3PPIA 4OHUA 5JPIA 1D8AA 4J90A 3Q2IA 4QT0A 4W7HA 1IE3A 1LLUA 3FPCA 2EKLA 3JD0A 5FI5A 2GCGA 4NBWA 3CINA 3K8ZA 5FFFA 4WCDA 1T24A 3ANMA 4RCVA 1O6ZA 3DBVO 3EHEA 3EDMA 3ONEA 3RROA 5DULA 4N5MA 5A9RA 4KUEA 3CIFA 2B4RO 2JFHA 1K6XA 4R1NA 3I9LA 2C07A 3IAHA 4IDEA 4J91A 4AJOA 1H93A 1JA9A 2FRDA 3CMCO 1JAYA 2FR0A 4FOSA 2CDBA 3KLMX 1NFRA 3MOGA 3U62A 1T4DA 3BMNA 1XGKA 1IOLA 1YKFA 2IE0A 3UF0A 1KC1A 1WMBA 4RPGA 1SOVA 4IGEA 3INGA 3JYLA 1GUYA 2ZB8A 4WGGA 2QRLA 2I66A 3EY4A 1ISFA 2D0IA 1BG6A 5I7EA 1HDCA 1DIRA 4AJIA 2D5AA 4MP3A 4AG3A 2CUKA 1A4UA 1PJ2A 1XDWA 5C7OO 4CLRA 3RAJA 4R54A 1GV1A 2VUUA 1H6BA 1ONPA 4NFSA 5A1TA 1UXJA 2Y93A 4FFPA 1EE2A 1V0JA 4QQRA 3DBRB 1PEDA 3U5TA 4J49A 4DLLA 3OHSX 4FS3A 4PIVA 2O2YA 2X86A 5DDIP 1U4SA 3I23A 1YBVA 3JQ7A 1DFHA 3WFJA 3KYCB 3ETGA 4PG5A 3ZH2A 4HWKA 3DBHB 3VTFA 1CERA 4CMEC 3S8MA 5CG1A 4F6LA 5K6AC 1K2WA 1A72A 1DFIA 1PGNA 2VCYA 2W2LA 4E6PA 2DTXA 3QWBA 4F45A 5TGDA 3HUDA 4LN1A 4NHEA 3I9NA 3IDSA 1LNQA 3ADPA 3JD3A 3RI3A 2WM3A 2YDXA 2JL1A 2PKQP 1Y1PA 1UDCA 3VVCA 1MA0A 4CM8A 4BKQA 5DT9A 4CQMD 5KNLA 1U2GA 4J4BA 4CR6A 2DUWA 1UP4A 4XX0A 1WDKA 4KZPA 5AXAA 3TNLA 3WYEA 2BFAA 2NU8A 2J5KA 2Y05A 2NTVA 4HKTA 4TZTA 3GRPA 2BF7A 3OQ1A 5DN9A 5AXBA 4KUGA 4JIGA 4XIYA 4E5PA 2DBVO 2I3AA 4B3IA 1H9AA 3VH2A 1LRKA 3E1KA 4YAGA 5I7VA 1RPNA 3FPLA 1KBZA 3JD4A 1VE9A 3WGZA 4KDFA 3UXYA 1VJTA 2X6TA 2ZYGA 3FWZA 2GRAA 4YJFB 2JHFA 2QW8A 4BO6A 5MGBA 3IS3A 5JO9A 2BELA 5CPBA 4FOOA 1HE2A 3L4SO 3RUDA 5G4KA 2P68A 2JCXA 1ZJYA 3BYZA 5EJ2A 4P38A 4B4VA 2B37A 3P7MA 3EMKA 4GWKA 1HWYA 4JCOA 1A4IA 4JBIA 3GG2A 1RYDA 1NPYA 3VZPA 2X22A 1WW8A 2PWZA 3DFZA 3EZLA 4WJZA 3VKVA 2E48A 4Q39A 1NQAO 1GR0A 1LDEA 1GD1O 1LSJA 4W9NA 3QRWA 4XQCA 1Y8QB 4Z9XA 5DF1A 2Q4BA 1MUUA 4E2XA 3OA2A 2Q1SA 1BW9B 4YRDA 5BNTA 2JJYA 2AXQA 1P45A 4IINA 5JXWA 3K30A 1E7SA 3AY3A 3WQSB 1DHRA 1YB1A 2O23A 4Y98A 1E3EA 1E7WA 2ZB3A 1EVYA 3DEYX 1NVMB 2HMTA 2ZB4A 3WOHA 2GN8A 4CMGA 3Q9NA 2DT5A 2AQKA 4YACA 1E7QA 3M6IA 5I7FA 3UW3A 4BUCA 1E6UA 5F3RA 2TMGA 1DJNA 2QX7A 4GGOA 4BNHA 3BHJA 4DA9A 3U4CA 4EUHA 2B4QA 2E4AA 4MP8A 5TQVA 3H5NA 5GZ3A 3KYDA 1DIBA 3BMNB 3VZQA 1HRDA 1PZHA 2D8AA 1LEHA 1MFZA 5EPOA 3WR5A 3T4XA 1LDGA 3AWDA 2RHCA 3GFGA 2BRUA 5TF4A 3RC9A 5IN4A 2O3QA 4JQCA 4H3VA 3WIEA 5CDYA 3ENKA 4N18A 4S1VA 1P1RA 2BGMA 2WD7B 1V8BA 4IDDA 4H15A 3FD8A 1B2LA 5G2OA 4ZICA 4FFOA 3DQPA 4W6ZA 1SB9A 3VPXA 1I8TA 5B4TA 1H9BA 1CEQA 3GRKA 1LQTA 4XDZA 4CM3A 2I6TA 3TDKA 4ALNA 1O0SA 4PRLA 1M67A 4ROSA 2O3TA 4BNJA 2YYYA 1UH5A 3K96A 1FDTA 5DP2A 3W8EA 3PWSA 4CM4A 3T7CA 1LDMA 3JQ7B 1HYEA 2OBYA 1YBAA 4U8GA 3KSZO 4RPHA 4L4XA 2P9GA 3OICA 3D0OA 4IJUA 5DOVA 3E9MA 3QWIA 1GYQA 3O4RA 2RBEA 2C5EA 4FCCA 1PWXA 2PFGA 3AU8A 3PIDA 2JFGA 3Q9UA 1TB4A 1X14A 4GLOA 5JY6A 2R2GA 1C0KA 3CZMA 4G81A 5IG2A 3I52A 2VZ8A 3WMXA 4TZKA 3ZWAA 4KDEA 4YAKA 2B0JA 3L0DA 5LCXA 2FWMX 1YH3A 4TRJA 4CM8B 1EK6A 2EEZA 4BMNA 1DAPA 3AUTA 4HFNA 3WIDA 2JHGA 3ZWBA 3DB2A 3GN2A 1SEVA 1JVBA 2HJRA 1C0PA 1UP7A 3LLVA 4QO7A 2OOSA 3DTYA 1I01A 4RL6A 2A35A 5K6AA 1N9GB 5FI3A 2B83A 4WNCA 4EJ6A 1P3DA 3LDHA 2PKRA 2UUOA 2NVBA 2Q99A 4D41A 5JAMA 2AW5A 1E1LA 4MPDA 2YHUA 4KOAA 2BGKA 1CF2O 1G0OA 2VOJA 2EIHA 1VRWA 2DBQA 2POQX 4B7UA 2P9CA 1EUZA 3F1LA 1T25A 3V2HA 4AJ1A 3ORFA 4NR0A 6LDHA 5I8WA 4BKPA 3N58A 4LSMA 1DIAA 4GVLA 4IQ0A 5JDCA 4PLCA 3HQ4O 1SPXA 2AG5A 4L0QA 5HM8A 2UV8A 3QIVA 2VQ3A 3H9EO 3LC2O 3OQBA 3AI1A 3V8BA 1QORA 2X0JA 1I3MA 5JAQA 1QXSA 4R16A 3DBLA 3RFXA 3MJVA 4YRBA 5ES3A 1VSUA 4MVJG 4BO7A 1Z82A 1JTVA 3ENNA 2ET6A 4DREA 3KVOA 3M2PA 3SJUA 4QFDA 4F6CA 3FNGA 4R1SA 4D0RA 1OOEA 3WYCA 4XIJA 4ESOA 4A7PA 2Y1FA 2IODA 2NVWA 2YQ5A 4DPKA 3WBFA 1FJHA 1HDYA 2DC1A 1ZZEA 3ZW9A 1KC3A 3DFUA 2R00C 3NJ8A 1P1JA 4O63O 4INAA 2AQHA 1XQ6A 4GX1A 1X0VA 1W6UA 3VC7A 2GUGA 4R9RA 1R4MB 4XRRA 3VAZA 3GZNA 3Q0EA 4DLAA 1DLIA 3UAGA 5THQA 1KEPA 1EFKA 1ZIDA 1ZMTA 4OSOA 4XCVA 1HSZA 1PGPA 4PLFA 1FF9A 1AE1A 4JBGA 1YONA 1GADO 1DRWA 3ZW8A 3PJFA 4FFRA 1CQJA 4D3SA 2AG8A 5KJ1A 4BO1A 4D44A 4QXMA 5IFLA 4EEZA 2P5UA 4FQ8A 1AHIA 1E7RA 3QV1A 1KVTA 4YJHB 2Y0EA 1HYHA 4XYEA 5EQDA 3OP4A 1Q0QA 3PJGA 4BNNA 4J16A 3GAFA 1M76A 2FZWA 2H6EA 2VOEA 3P5SA 3WWZA 3BMCA 5B1YA 4R68A 1PU2A 2P2SA 3O9ZA 4TKMA 3ROMA 3DZBA 1PJLA 3LC1O 3DZIA 4PLVA 1NPDA 2FZEA 4RDHA 2ZKLA 4IDGA 5DCYA 3KHUA 1ZCJA 5H83A 1P1HA 1EK5A 3ZHZA 2GZ1A 1MX3A 4MVJI 2X9NA 1N7HA 1KETA 3U49A 2NTJA 3RUCA 4OMUA 3ZU3A 4CL8A 1WNTA 1ML3A 1DPGA 4M1QA 5KCZA 4I5DA 4CLEA 4CQMB 3WLEA 4CMHA 5L4LA 4UREA 1V3UA 2D1YA 2OZPA 4I5FA 5CPFA 1SC6A 1ENOA 2CMDA 2ZCVA 3P2OA 4IIVA 3ULKA 1HLPA 4FFLA 1NXQA 4K6FA 5KJ6A 3HG7A 3L77A 3PIIA 1A27A 3NTOA 4D0SA 1IHXA 1GEGA 4MIEA 2HO5A 2Y0DA 1UJMA 3RFTA 4IDFA 2J8ZA 4BKRA 4IMPA 3AK4A 3PI7A 1QG6A 3ZHXA 4TWRA 4CMIA 1I24A 1GQ2A 2X5JO 1YDEA 3IP3A 1U5CA 4B3HA 1JDJA 4J9VA 5A9SB 1ZK4A 4GX2A 3F46A 1DSSG 3IUSA 4R3WA 1MLDA
chains in the Genus database with same CATH superfamily
4Q9JA 3A2KA 4L02A 1F14A 1XRMA 3DE4X 3CSSA 2RCYA 1E94E 4L7QA 4LXGA 1XVAA 3R20A 2WWFA 3V1KA 4MQEB 4EY6A 5HM6A 4OL0A 5JCZA 4PRKA 3CH5A 1GZUA 4J07A 1QM5A 8GPBA 5B7GA 1QIHA 4OSPA 1Y5LA 1XP5A 1G16A 4GP7A 4Y8VA 4EKDA 3ENQA 2W8ZA 2E87A 1ZD2P 2G72A 1PT9A 1PDVA 1TUBB 1W4LA 1S6YA 3BQ9A 1M2VA 1YIOA 3GAZA 1L5LA 2NZWA 4B82A 5BR7A 4KRGA 4R83A 1BRTA 1XV5A 5E95A 4EI8A 2WJIA 2DKNA 2F1RA 2OCAA 2C5BA 4UE6A 4TWZA 1P2GA 4UM5A 3ZV6A 3LX5A 4DEVA 4QOGA 4ZYUA 1ZD3A 3DOOA 4QYSA 3GV0A 4EEXA 3SGLA 4F1JA 5T5QA 3MCAA 4TGLA 1N8SA 1NG9A 1LU9A 1A98A 4RMGA 4KN6A 4O2AA 2Q7OE 3WL3A 3R75A 3ZJ5A 1LJLA 3GJZA 4Q3CA 1KMNA 4IX9A 2HWKA 4N41A 1M5UA 2C9OA 1KMIY 2FA9A 2NUAA 4G0NA 3KR2A 4L75A 1TF5A 4TMTA 1W44A 1BAPA 2FPIB 3HSSA 2IH4A 3O38A 4UDXX 5DH9A 3V6LA 4C7XA 1GUFA 4KN8A 1D7AA 1MO6A 5K8JB 2FPOA 3WC4A 4NG4A 4TUYF 2QTVB 4TL8A 1J1UA 3OO0A 3OO1A 4RIFA 1I7LA 2I4IA 4MHOA 3H5LA 4H1UA 3RVLA 1JLRA 4BBPA 3JZAA 3JQ8A 1T8RA 3M6XA 2CLIB 5TRTA 5HJ7A 1I36A 1L7QA 1R8SA 5B58C 5FWXB 4MDHA 1FFDA 4J2OA 2AZDA 5LR6A 2ZLBA 1IBLB 4HH0A 1J7JA 2ILVA 3BMQA 2ZI9A 3K1JA 3JTMA 4DCSA 2P9TA 5IVIA 2WNIA 4MKRA 4N8DA 1YOBA 2ZRNA 2WF9A 3QMPA 1RAEA 5EHGA 3VX4A 3OZCA 5G0SA 4BU1A 4PLTA 4S0XA 1C3JA 1IXSB 2A4MA 3RTAA 4DA0A 2QE7D 1EPUA 4UDOA 4KQFA 2D5CA 1PJCA 3FZQA 2CFTA 3PWZA 4EA8A 5BW8A 4LSGA 4Q9DA 4QGFA 3GEDA 3LFHA 5B3AA 4P36A 4BKUA 4BPRA 4GMGA 3R4VA 3OT1A 2H1IA 3SC2B 3TEMA 5FP0A 1V7PC 2XCQA 3GLGE 2WKSA 2SKCA 1BH2A 1DB3A 2ZUDA 4W5QA 1PJTA 5KWJA 2CDAA 2O2IA 1LCIA 3HFSA 3ZWNA 1QB8A 3DV9A 3Q0TA 3ZK8A 3BTSA 1HA3A 2H9IA 2YXLA 1BD4A 2G4LA 3DB1A 1U8CB 1M34A 3KZXA 4DQVA 5IZCC 3ZGZA 3TSWA 3K1AA 5A06A 4IVPA 4K6GA 5DB4A 5IDYA 3RASA 3LKVA 4M7RA 4MV9A 3E8XA 1THTA 3W8FA 4LE0A 2Q7XA 4X6YA 5B1DA 3PPXA 3UK6A 1JYSA 1KS9A 4UVHA 3FUVA 3N0VA 2Y1EA 3D2LA 3ZDZB 4CG3A 2E37A 3QPBA 2HYDA 3KQTA 2HXYA 1IUPA 1M9NA 1T9CA 2IP4A 3OUUA 3BMCB 4Y67A 4N5NA 3AJRA 2EX1A 3EXFA 1O9GA 3PT9A 4JEHA 4NCNA 4HB2A 4ABTA 2XGOA 3NHPA 4OJYA 2CE2X 4JQZA 1C0IA 2A0FA 5E38A 4YFYA 1L1RA 4GO1A 2JIMA 2H2GA 3CZPA 5EE9A 1HMYA 1QNFA 4GI1A 4MPPA 4KR9A 1IEVA 2E5WA 2GBPA 2Z6VA 1OKKA 3M33A 3UICA 5T4HA 2B82A 1WMSA 2WU1A 2WV9A 5B1IA 3K1ZA 4F84A 4B2YA 5EMNA 1Y3CE 3I8OA 1I9CA 1Y34E 1RRFA 4YJFA 2C3YA 4URUR 3AFMA 3UJAA 1EG2A 5AVQA 4E3WA 3BBLA 2J08A 2TECE 3WLTA 3P5BA 1T3HA 4L85A 2OXRA 3BCHA 3PEVA 4LPSA 1RMYA 4DDTA 5CBPB 5G0TA 1D3AA 1SMKA 4GEKA 2BMEA 1WUYA 1ZUD1 2OKGA 4OOEA 1GPLA 1FNDA 1PBTA 4DBZA 1OH7A 3VHXB 2C7GA 2J5QA 1D5CA 3HHPA 4L15A 4AG6A 2F2TA 4Q9NA 1E99A 3EPJA 2I34A 4A0FA 1KO8A 1Y1KE 2JGAA 1X7HA 3EZ6A 3MMXA 4YJ2B 4YCMA 4KE7A 4Y2RA 1E3LA 4MQ5A 3L0PA 5LLDA 3PICA 3MGGA 2YX1A 3GA7A 4PF1A 3SC6A 1NONA 4S12A 2C31A 3WOVA 3C8HA 4K2AA 1Y8QA 1TIKA 4YLGA 2OCGA 5BV8A 2IEDA 1FRFS 3FDFA 3FNEA 1GSHA 2WU8A 1VB3A 2OUKA 3R41A 4IDQA 3CN7A 5BV2P 5PNTA 4I6GA 1VCMA 3ZDYB 4QXRA 4B7ZA 1KIFA 4EYGA 5KB3A 3I5XA 4RVFA 2FUG6 1TCUA 5TB5A 5CA0A 1UBEA 4GHWA 2XWSA 3KPYA 2Y1WA 3AJ8A 3BWVA 3FYHA 1ID8A 2V7EA 4W1RA 5EP2A 3VU9A 2R25B 1T5IA 4UHJA 5F5XA 5IX8A 2OO7A 1YCGA 3TNFA 2NP6A 4WEOA 2IUYA 5AJWA 2P30A 3RD5A 2RDMA 3LKBA 3EH1A 3PQ4A 4AJEA 1ODJA 1LNZA 1MOQA 4GRIA 3A3YA 1CUIA 1B4DA 3AZQA 5AIAA 4PTZA 3ESAA 5CB4B 5KTTA 1E1KA 4AG5A 2DLDA 5HA5A 4JBHA 3H83A 2B99A 2B1IA 1FZTA 1B74A 4J7UA 2C1EA 1Y3AA 4HGZA 4UTNA 4BGIA 2NTNA 4B32A 1VP3A 1OROA 4UFPA 1N25A 5IEBA 1IBCA 2PD4A 3EFHA 3F3SA 5I3ZA 2F55A 4I5GA 3O2QB 3W4JA 3GP3A 5I9IA 2H7CA 4R1UA 5TV2A 4UEQA 2QW0X 3P1JA 3UA4A 4S3MA 4WXMA 4MIKA 2WIFA 5JDIC 3ITNA 2GCNA 2YN0A 5ETJA 3SXJA 4RY8A 1RM5A 1R4ZA 2B7BA 3NTRA 4LFCB 1T36A 1FVFA 1FRVA 1N7IA 3HNPA 4R31A 4A3SA 4WGFA 2GDZA 2F3PA 2Z6UA 2BSAA 1OAAA 4M9ZA 3PCRB 4RZUA 3H8WA 4M38A 5BSVA 2QR2A 2WMYA 5L53A 4GE3A 4Q9KA 1EKXA 4PZEA 4MKZA 3EOBI 4RV4A 5E6UB 2PKQO 4QTXA 1DV2A 2JD1A 2YNMD 1GM5A 3I2FA 1ZJJA 1I2BA 1M6HA 1VJ0A 4OB6A 3T5DA 1G17A 1K27A 4IGIA 4Z3DA 2C2HA 2E5FA 5KOHB 1BMFD 2QE7A 1TYZA 3UJ8A 3W2EA 1EK2A 2X15A 2W2QA 4OK6A 5KVQA 3T5MA 3WSTA 3ZY3A 1VJ5A 4AZVA 1T5OA 5ALLA 2OA0A 5KOJB 9MHTA 2B4TO 2MU1A 4Y2HA 2AOUB 5A62A 3VPHA 1W5EA 4ZO6A 4PZZA 1YI8A 5EIOA 2P5YA 5DNDA 3DXXA 3TG2A 1GGFA 1A9TA 5M34A 1TD9A 1GQYA 4HDMB 3DVQX 4K5QA 1NW8A 5EC8A 3LXUX 4A4DA 3JYOA 4DLSA 3FDIA 1GPJA 2QN2A 4HEHA 2X9GA 2D5IA 3DMTA 3NJRA 4ZO8A 1CJTC 2V3VA 3QGMA 2Y1DA 3DEAA 5LQNA 1IJEA 2CXRA 2OILA 3W3AH 3QX3A 2BI8A 4MO2A 3QVGB 2R4TA 2RGBA 3PUHA 1J8MF 1SBTA 2PRKA 2XQJA 4J1QA 4LMPA 5F77A 2MT9A 4PQEA 3BMXA 2VDUE 3R5XA 5LP6B 1G7SA 1PTJC 4OMDA 4PAGA 1J97A 1YQEA 1YVUA 3L4BC 3QFTA 3O8RA 4HWGA 3EGXB 1TM7E 2CD9A 1SVWA 3DMGA 5I51A 2QAJA 5JASA 4KPUA 3SYKA 4B33A 2OMKA 4Q16A 2IGBA 3RUAA 1R18A 2QV0A 3FZGA 4F3NA 3W5DA 4LHYA 2EU8A 4G9GA 1KEEB 1HTWA 3KT0A 5DBGA 4OATA 1FP4A 2RBGA 2ZG6A 2FG7C 1GYPA 4U2FA 3P2KA 3A1TA 1YRBA 3EGDA 3B9PA 4GOND 4Y2TA 1N9GA 2QENA 1N36B 1IBKB 3EQZA 3FTDA 3P71T 4L8LA 4QSHA 4BLRA 1CF4A 1GWNA 3QF4A 1OZHA 4MGEA 2BLLA 1YFLA 3OQJA 5TSDA 5IKEA 3K6KA 1VJGA 4FYMA 5EXXA 2FX5A 3NFRA 2IHKA 2OV1A 3FKQA 3SLRA 4FDVA 3V55A 4I99A 2C4MA 3PD0A 3ZCTA 1K9SA 3C48A 3HVKA 4KWEA 4MQFB 3TUIC 4BNZA 3A2MA 1Y1TA 5TJ9A 1RRPA 3NT4A 1SUBA 2PJRA 2PRJA 4PO1A 3U09A 1Z73A 4D74A 3O82A 3ICCA 5A3QA 5LD2C 2QTTA 2WF7A 1Y6GA 3ZIAA 4YRPA 4Y9SA 1VHQA 3LSTA 4KB5A 3V4OA 3WIBA 4V0KA 3O03A 2VAXA 4YMSA 5AH0A 1XJQA 2YWHA 5EWMA 5TPZD 4C3OB 2X5OA 3CLSC 3MUNA 1GFIA 2ZIEA 3BE4A 1NI3A 1RHQA 2WE7A 1C1DA 4XARA 4GYWA 5JXJA 3N53A 5C31A 3H5WA 1QP7A 2PZLA 1Z22A 1S4MA 1NUHA 4TLLB 1U2QA 1V96A 1E2KA 3IAS6 4FGWA 3ASYA 4V3BA 3M7IA 5DSZA 3U81A 1E9AA 1U0TA 1X7YA 2XQKA 5JD3A 3G89A 2WK1A 4QUGA 5CRIA 3LQFA 2X5KO 1RJ9A 3TLGB 3NJ4A 2X4GA 2VJPA 1RQGA 2XEXA 1F9EA 4RX1A 1NSYA 1ODFA 2VZ9A 4LRQA 4N54A 1RXEA 4R40A 4U5QA 5TR9A 5EL0A 4N5DA 3FCYA 4C06A 1KDVA 2Q4TA 5HDBB 3TSZA 2IKQA 1Z62A 1AOXA 4R6XA 4V0SA 5KX5B 5E2IA 1L5MA 3HSKA 1QWOA 1TECE 2FEWB 1G8KA 5CFQA 4JJEA 2V6GA 3HL0A 1CCWA 4YBZA 1TLLA 3FPKA 4LZPA 1ZCFA 3FMPB 4WNAB 1NSTA 1Y5MA 2HU7A 3NIGB 3C70A 5AW5A 4G97A 3ZU2A 4ARCA 2V45A 1XF9A 3DCJA 1DS6A 3MAJA 3QV2A 3SKXA 5L4NA 2PY6A 4WY8A 1TJNA 2LDXA 2RHWA 4BNDA 2BSXA 2JAXA 4FFVA 2ZAYA 4P7KA 1GU7A 3WNCA 1IB0A 1QUFA 1MW9X 4XIFA 5CIQA 1A5ZA 2XAUA 2JLWA 4WA7A 1FPQA 3K09A 3VNRA 3NEAA 2EZUA 5SZIA 3DE2X 4YRTA 5EGSA 2AD5A 4QWMA 5JNTA 3LQQA 2DPYA 1MOSA 2PZFA 4GD3Q 4ER3A 1P73A 3A6HA 5ERYA 5JRDS 1LDBA 5HIMA 3B38A 3W2TA 4OU4A 5LDDC 1BMFA 1YDGA 2I7XA 3M1LA 2X4DA 4CM1A 3DCIA 3RTDA 4CKCA 2O8FA 4BLQA 2PM8A 3BWCA 1ST3A 2ZRGA 4IJKA 3R6WA 3ZV4A 2R1TA 1YR2A 2YRFA 1I2DA 1IWPB 4MS4A 2HA0A 3BMOB 4PG6A 3TOXA 1MGOA 2ZW9A 2CVHA 2X8JA 5IDVA 4C03A 2R8BA 4N0DA 4D79A 4PQFA 5C7YA 2IV7A 2WQ6A 4L28A 3REFA 4G1CA 2HI0A 2FN4A 3LX4A 1OF1A 1WJGA 1SVKA 4DQDA 3H9UA 1ADYA 1XUOA 2F62A 4DYVA 4PFQA 1DI0A 3QP9A 2C59A 1VYVA 3CUTA 3G9XA 2HKIA 4PZUA 2Q2QA 2ZJBA 5DLPA 1FSSA 2C83A 3A4NA 3R44A 3WG9A 5DLQC 3LK6A 3PK0A 5FNVF 4BMZA 4CG0A 2CXOA 2PGDA 1U0BB 2BR5A 2HIAA 1AKYA 3WJ2A 1WQ1R 3ANYB 1DBPA 4P54A 3AIKA 3TOZA 3EEBA 3AESB 3M3DA 2I9KA 1QH1A 1N2IA 1OHHD 2VSFA 4AN4A 1TUEA 4MOWA 4U9HS 2CF5A 4Y18A 4E14A 2JFPA 4PGHA 3BFXA 3WWCA 1JKIA 4IKOA 4F11A 5DX1A 2MCFA 2OCYC 3NOOA 2B5WA 1DCMA 1IATA 2F67A 1D2MA 3ACCA 4HDNB 5SYMA 2GJ4A 1OLXB 3CX3A 3IQWA 1USUA 2KQUA 4H18A 3I6QA 2W48A 1RYZA 4G4SO 1Y1QA 2O0KA 3DYVA 3FJYA 1KE1A 2C61A 3PNYA 5FUYA 4EJ2A 1X0XA 2GO7A 3L1VA 4FFWA 3OQ6A 1QFYA 4X63A 4FI3F 3M6AA 4EK9A 5BMVA 2PX6A 3VTZA 5KYGA 3KOZA 4HXEB 2J0SA 8MHTA 1ZD5A 1R9GA 3K0FB 2XIJA 1ADBA 2DKFA 5HQJA 1YOVB 1BH6A 2XKKA 3VZSA 1MXHA 3LP6A 1SU4A 1WB5A 5IRCD 3ZZMA 1XD8A 4NWIA 2AJLI 3IPAA 2ORIA 1UXOA 1AO0A 3ODPA 4AJNA 4POAA 3U3KA 4B3CA 5FH9A 3MA0A 2N47A 2VNKA 1EBBA 3L07A 2HREA 4H6WA 3WMEA 4U2EA 7MDHA 4C0LA 4WZBB 2Z2XA 4K03A 2P2LA 3ZQ4A 4EHIA 4PGAA 4G0VA 4PPQA 1I7NA 1JN0A 4CN8A 1FDOA 1VPDA 3NNNA 3PNPA 4JY7A 3OJLA 3BXHA 3GVXA 2FF5A 3N0WA 3SQNA 1II9A 3FAKA 1HFWA 3BC1A 5IJAA 1RXYA 1PUXA 1RLOA 1CP3A 2N9UA 4JHXA 3RVDA 4N76A 1IN1A 1G8HA 1O0CA 2C8KA 2X1VA 1TT5A 5CTAA 2PVCA 2CL7X 1R0SA 4FVTA 4WECA 3DTNA 4U2BA 5D5PA 2VP0A 3FPJA 5JC8A 3KV3O 4GSKA 4Q34A 4QHTA 1V35A 5CVCA 4WH0A 2P41A 1VCNA 2B69A 5C4MA 3G6KA 4B74A 5C34B 3MS4A 4AT1A 4X60A 2CNOA 1JLLB 4FT4A 2ZI3A 4MGHA 5AJTA 2ZTLA 3IO3A 3LKZA 4JP3A 4OBXA 1R00A 3U3RA 4CQNA 3ERCA 3V34A 4YMUA 5A4FS 2GA9A 3KEGA 1Z45A 1ENPA 4ZVNA 3SDSA 4KPEC 4K9DA 3C5CA 1LLFA 3NBKA 2OC9A 3WLSA 5JSZA 2JFQA 4LOIA 5LQJA 3MPUA 3THYA 1QK3A 1X1TA 2VA8A 3SIWA 5AQEA 2HJHA 2JCGA 4BOYA 3AJDA 1QGED 3HWX1 3RIXA 2F8LA 2GERA 4ND2A 2WMOB 4FNAA 4L4YA 4ZVPA 5GONA 5IZ4A 3PC2A 3FVRA 1C4KA 4TVOA 4E1BA 2AC2A 3LL7A 1QLHA 4E4TA 4LZOA 2G8NA 2H1CA 2IOFK 5BT9A 3R9WA 1H69A 5BN3A 4RGBA 5FDFA 2O3JA 4GKAA 3VC2A 4IIJF 3VGPA 3IA7A 3GPCA 3JVIA 4PBTA 3NIDB 4FDTA 2Y3IA 3BS4A 1B1CA 1U9YA 2EGHA 1IPFA 3E3NA 4HMQA 3FNFA 3QUTA 2FZ5A 2XF2A 4KQXA 5FUWA 2ZJ8A 2BC9A 5AP9A 1JJVA 3DH0A 4FZ3A 3AB7A 3AM3A 3GUYA 2PUBA 3IMKA 2EVWX 3C24A 4B44A 4NYJR 2O3UA 3RHZA 4D25A 4G9EA 3KQOA 2XZTA 1KZ7B 3EW7A 3C3EA 2MYTA 1G5QA 2F3UA 3BB1A 3ONVA 1D2RA 3TCNA 3K9HA 4RHXA 4LOAA 5E7MA 4FS8A 4LY0A 3L0CA 4WV3A 4JLSA 4D9IA 3V1UA 4N6OA 1D1TA 2P9ZA 1AF7A 1P0CA 1K08A 3SI7A 5ITZA 3H1AA 4G5SA 1P2DA 5JBIA 3N70A 3Q3JB 5GIPE 1E61A 1DBSA 1ZR4A 5I7UA 3OBBA 4IEFB 4DMCA 1I30A 5ILQA 4TTSA 1UJ4A 3FI9A 4H0NA 2EFCB 4D99A 1DJOA 2EJBA 3DE7X 3OVMA 1KYQA 1LWNA 1Y8RB 2J9XB 4FW9A 1DQNA 1PT7A 4PR3A 2C7QA 1YMUA 2D2FA 2LBPA 3IJPA 3LQ4A 1KMCA 3LWNA 3QNMA 2OFWA 4I4IA 4IHQA 1U9JA 2A9JA 5TX7A 1IN5A 3U13A 1G59A 4BHTA 3WYBA 3CEJA 4HRXA 2QNBA 2OXFA 4PO9A 4QREA 2OKCA 4FYYA 3ADOA 2IPLA 3MQFA 5T3YA 1G19A 1Q95A 3F5MA 1GQQA 2BGJA 3L05A 5G4LA 2P8JA 3EQ9A 4UDYX 1B0UA 1VCIA 3D0RA 4QEKA 4RMHA 5FL7D 3MB5A 1U2TA 2E9SA 3H2JA 3U4IA 2BHSA 3AKDA 4FPXA 3ND9A 1K7FB 4RZXA 4DJDC 2OWDA 3PA6A 4OLFA 5T7BA 3FNQA 2X8WA 5H9VA 3ZUGA 2FQQA 5JQWA 4F93B 4U3JA 2XVXA 4TM7A 4BYMA 1XL1A 4QT4A 5DHFA 3HN6A 3EVTA 4S0ZA 2CVZA 5AJUA 4H7EA 3QY0A 4G0PA 2Z8XA 5TS2A 2HRBA 2QMQA 2C1XA 2VJYA 3UUGA 3P26A 4DEYA 1QP4A 4OHYA 2ZRBA 2VP5A 3SJCA 3ZY5A 4YT2A 1E64A 1T9BA 5L3QA 3GH3A 2ZYRA 2JIRA 4RD6A 1OU0A 1V1MB 3EISA 3ELDA 3K94A 4QEDA 5BN5B 1N2SA 2ZREA 2MSCB 3OX3A 2XXJA 4KW7A 1DCTA 3DLAA 3RCBA 2BLNA 2IOYA 4YJGA 5GINE 2HNBA 2HEGA 2JLBA 4IVNA 4G8DA 1V5GA 2AF3C 2YMQA 2RJNA 4OJTA 3PYXA 4M0DA 3G5AA 4KIWA 5I7WA 2Y9PB 3IMGA 1CZHA 4AUMA 1R5BA 1M2EA 1O9HA 2CCJA 1IXZA 1ZKDA 4EFLA 1KJQA 1P77A 3QVXA 2XA2A 4E21A 5F5NA 4F71A 4RHCA 2FR8C 2R6ZA 4MIOA 4EGSA 1WO8A 1KSJA 1ORIA 4S24A 1WXDA 2HUPA 2JIQA 2PS9A 1BCRB 1PW7A 1ZC3A 3LBHA 2RB4A 2Q46A 4Q7EA 1W2GA 5A3JA 1D03A 1O3YA 2WC1A 3HADA 3RU9A 2M6RA 2HFKA 1QHHA 5DYTA 4RVHA 3IAUA 2R9VA 5GTDA 4J2TA 3DDHA 4E30A 1DO8A 4HH1A 3HRIA 4OLJA 4OA5A 4NZZA 4REOA 3B9RA 5D86A 4C76A 1VYHA 1I32A 2IA5A 1IUKA 1TEHA 3V97A 2PCJA 1C8LA 1USWA 2FW6A 1L7DA 4JOBA 5IVHA 2G9VA 3LNCA 4ZAFA 3N3AC 5CU7A 2GM9A 3RJ9A 1YZYA 4G5GA 4ENWA 3ELBA 1ZJWA 2AVDA 4ZU3A 1AV7A 4R1OA 1E1CB 1SAYA 2FN7A 2G36A 2NU7B 3FUCA 3OIWA 4IIFA 2WA2A 3NB0A 4Y2QA 3HPRA 1XTZA 1TL7C 3HKCA 4E11A 1P9WA 2BTQB 4PYKA 4NBTA 4CU5A 2BYTA 3GRAA 4KMRA 5CT8A 4CKWA 5JS1A 1SA0A 1FVHA 2QS9A 1HDGO 1XU7A 2YHAA 3JQPA 4O4LA 1QR6A 4TXHA 4BFXA 3IH5A 3LIIA 4DCCA 4BLSA 2HY7A 2QUKA 1XKTA 3HO8A 3TR0A 3QG5A 2HH9A 1E1QD 2PUJA 3D7LA 4OHCA 3ET4A 4CIWA 4BLUA 2Q21A 1Z2AA 1Z39A 4M9QA 2IITA 4AX4A 5ARBA 3MJHA 1GAWA 3QYPA 1T26A 3I4LA 4YJ3F 5C52B 1ODSA 4L2IB 4LNUA 3KVYA 3PKIA 1R37A 1K3TA 4I4LA 1NGSA 4FMDF 1Q2XA 3UWKA 3ZX4A 4DW8A 1CJMA 1GZ4A 1SKQA 2PN1A 2FDCA 5BXQC 2AFIA 1QJ4A 4Y6RA 1RXUA 3ZU6A 2WUVA 3UTCA 4DLVA 2REOA 2UYOA 1TNDA 1OFHA 4LCEA 1UDAA 4YASA 1BHSA 1N6HA 3VO9A 1NMSA 4E5YA 5A2QA 2IFTA 3FFTA 5H59A 1C1XA 4DIEA 1JQDA 2E3JA 4W1QA 1TW2A 1L7EA 1EUCB 1DWUA 1HDIA 1QHSA 1TI7A 1WVGA 2QX9A 3BXOA 1L7XA 4IJWA 4NJEA 4PWYA 4W7SA 2X3FA 3K05A 1A9QA 3SLGA 2RK6A 4RHFA 2JC3A 3BX1A 3UJPA 2C54A 1YCDA 1OSNA 3MBKA 1L5HB 4JUDX 1EFUA 1SKUA 3B7WA 3F96A 4ZC8A 4G63A 1PI3A 2I8LA 4B3JA 1U5BB 1M8PA 1NBOA 3F2IA 1L1QA 4GE0A 4D82A 1UZNA 1S2DA 3WJAA 5ICEA 2I3GA 2WOJA 1K7SN 3IAAA 1WXWA 2ANBA 3PFKA 1XRPA 1YI0A 1T5SA 1OYWA 2JS7A 3H16A 1J8FA 2W0SA 2W2LD 1OI3A 4N5HX 2DFPA 5FBVB 3D6NB 1S3IA 2EATA 3DZ8A 3NVDA 4HDCA 4EHDA 1UT8A 1YCFA 3MOIA 1M6YA 2JHCA 4CGYA 4CLHA 1PFGA 3OCWA 3OUTA 5JXGA 1G5FA 1PSWA 3KXIA 2HWWA 1X1CA 3A0RB 3NG1A 3CKKA 5KKAA 2H4WA 3V4LA 2OLJA 3DV0A 3GB9A 4ZVQA 4EY4A 2HXSA 2ADOA 3PPYA 1N3IA 4C3UA 4F46A 2GEFA 1X19A 1H2YA 3UO8B 1EUYA 4RYDA 2WYWA 4MVWA 3NTQA 5F1PA 3QZUA 3TUZC 3W06A 4WXPA 1VFPA 4XQ0A 5HQTA 5JZMA 1QX4A 4PX5A 1W0JA 3ND7A 3VMMA 2GASA 4HLDA 5D3MA 3JWEA 4UUNA 3LRTA 3JAKA 2OQRA 2VPQA 2B6HA 4B40A 5AK6A 4M7WA 2FG5A 2WKWA 3HVJA 4F3CA 4JI0B 3TSYA 4HYTA 2Y4NA 3OZSA 8ADHA 4RETA 4ZOBA 1CULC 4ETWA 1UM9B 4U7DA 2FUNB 1NYLA 5A3RA 2XNSA 4AKIA 2WTXA 2H48A 3KUXA 1PGOA 2ZUUA 2OBXA 3G79A 4ND7A 1UK8A 2O2ZA 3ZHYA 4Z1MD 1ZGJA 3QFCA 3QHQA 4FKBA 4IDBA 5K01A 5IKXA 4E5NA 2GAAA 2H5IA 1WMDA 3O5AA 1QJCA 4INOA 3V8PA 2PZMA 2BD0A 4DS3A 3K71B 2CNNA 4COOA 2I1QA 3AR8A 1QC5A 3UHAA 1TQ4A 2WF5A 4J4TA 4OP3A 5F73A 2YV2A 3R7WA 4LVOA 4X44A 5CK4A 3SSMA 4W8HA 4XJTA 2RGUA 2YVUA 1II8A 3NXKA 1GUBA 1CVIA 1MTZA 3FN4A 3C3BA 5IJXA 5HWSA 3PLAE 3EZ2A 4IV5A 1T4CA 5ECGC 5IT0A 3TMAA 4X3CA 3RIMA 1NDQA 3ECSA 2GBIA 4KV9A 1ZD8A 4TLAA 2CJFA 3RUHA 1XZ8A 4GLBA 4WKGA 1U3DA 3S1AB 1SQGA 2WT9A 3C3KA 2BHTA 2J6IA 4MWCA 2IZ5A 3MWEB 4N7MA 4NEHB 5HS6A 1U3GA 2FSSA 4B09A 2EP5A 2PV0A 5AW8A 3V8RA 3E22B 5EESA 4JVNA 4UEJA 1FP1D 3GRYA 1WDLA 2INGX 1ZJZA 3TDMA 2XOKD 3HE3A 2C2WA 1TMOA 3KETA 1H05A 1SXHA 1VI5A 4JT9A 4MR8A 3D6AA 4URWR 3SHTA 4E70A 3A2NA 2D2VA 3DHVA 4CLOA 1JTEA 1TC1A 1XROA 2ZT8A 3TQOA 3GJ8A 5E4TA 2ZQYA 4M1KA 5ALZA 4L0CA 5JSKA 4BV3A 5DGIA 5FPTA 3L8YA 5JJBA 4E5KA 2H11A 4U1RA 1E1QA 5TY0A 1OXBB 1JDPA 2HU8A 3L8ZA 5DYNA 4BZPA 5J2TB 2GXSA 2X1LA 1K3UB 1TA4A 1QOPB 4ZCMA 3TRJA 2DPHA 3ICVA 4I9UA 4TQUS 1NWHA 4LXYA 2NZ2A 4ZOLF 5TMEA 1PK7A 1DKQA 1W9HA 2P2YA 5CNJA 3ACBA 2ZFUA 5DNCA 1Y1LA 4HADA 2XTJA 3H2IA 4PBSA 1UIRA 1ENYA 3LH5A 4UHHA 1ZS9A 4Z4CA 5K3OA 2LCFA 1XJWA 3TB4A 2RE8A 3SXPA 1TEXA 4YRIA 1HQCA 3DEIA 4RTRA 3FB4A 2PZJA 4G8CA 4HNAA 2FR1A 3JQGB 2QAGA 1U0HC 2F6RA 3P45A 3AM5A 1E63A 1J8VA 2HJWA 4GP6A 4IBOA 4LMAA 2LIVA 5E9QA 5GV8A 3DOCA 4IOMA 4TS9A 3IQIX 4Z51A 5BVGA 2OAP1 3U1TA 4K8OA 4EGAA 1OT3A 1XTUA 1YB7A 3MQ2A 4PLHA 3GIDA 1UOEA 3BQNB 1UKAA 3KZNA 7REQA 3MQ4A 4BNUA 3UC5A 3C3AA 2XKBA 4J7XA 2FH5B 4Q1VA 2D59A 4NZOA 3SJ7A 1M2WA 3PP8A 1Y7TA 4I1RA 4YROA 2HW8A 4DR6B 3L6RA 4BFSA 1Z5ZA 2NN3C 4LRXA 2BBSA 3VAAA 4JI2B 3A06A 3L1UA 4PC7A 5JS2A 3HV0A 2G67A 4DBVO 3GN1A 3BICA 3I12A 2IZ1A 2AB0A 3KJIA 5CA1B 2O2DA 1QZZA 3G1UA 1B3BA 2XMRA 3KUDA 2CF6A 2ZWPA 3AOEA 4MV3A 3PLRA 2O4UX 1INLA 4PE5B 4D9HA 3LP8A 4FC6A 1MDFA 4PC3A 4LQCA 3RVBA 1XMQB 4D46A 4A15A 2Q29A 1OVMA 3SDBA 2CV0A 1D09A 4NCAA 2JGFA 3OFJA 3INRA 3IP5A 1W88A 3I8XA 5LXTB 3CFYA 1NLYA 3G0HA 1KERA 2C5FA 3W3AA 3CLRC 3DMHA 4PONA 3HB5X 1YZFA 4PSKA 4HAYA 5F1OA 4AJLA 2HT1A 4DZRA 2QRQA 4TMKA 2IWHA 4FR5A 1ATIA 1BXGA 1MQAA 3ICWA 3LA6A 1VI2A 4OXQA 4ON9A 4DWJA 1Z6YA 4XVUA 1FLNA 1V3TA 3GCXA 2R68A 5EEHA 4JXZA 4BZZA 4ZQHA 1XXHB 2JCYA 2I2FA 4GOXA 1Q1GA 2ISCA 5JDCC 4UE3S 1SZCA 1DCFA 1Q14A 5FBHA 4BP3A 4NEGA 3KKPA 3JQAB 1KTVA 3OKPA 2D0DA 2FSHA 4KUHA 5KWIA 2VTBB 3WKEA 1W48A 2PTHA 1SVSA 4MYUA 4E2FA 3ZKWB 3P2EA 4IXWA 1P62B 5LZ9A 2OAGA 1E3WA 1NP6A 2BKVA 2WUEA 4P7FA 3RTBA 3SPXA 2VP6A 1U7DA 1Z7BA 1JDBB 4ENUA 4RPJA 1UMCB 2ZU6A 1CQIB 1BEEA 2WYOA 3IAXA 4NJMB 2GCOA 3BOSA 3UA3A 3FOEC 1WUJS 4M36A 4Z1MA 3WK5A 1CG6A 1Q0HA 1YK0A 5AWFC 4RV5A 4EQZA 4P22A 4YP0A 4YPOA 1MKYA 4MX8A 2QRZA 1A1SA 1KMHA 4LDPA 1NTRA 2V7TA 3C7KA 2A6PA 1J5PA 2QBYA 2FEKA 2VATA 4F91B 5BORA 4HJXA 1ULSA 1NBMA 4Q18A 3TQHA 1AUOA 1RM0A 2J4CA 4BNTA 5IS2A 2OHXA 2ZRKA 2OORC 2Q0SA 4LC0A 2ID8A 1JLSA 1JIUA 4TSRA 1J9EA 1F0NA 2W5UA 5K03A 2G82A 3TR5A 3BXXA 3SQMA 4MDYA 1JAXA 3L0ZA 4W8OA 4X1KB 2IH2A 5CCBA 1H2BA 4KL8S 3R9XB 3NP7A 4D26A 1K97A 1LBIA 1RMQA 1WZNA 4HXFB 4IP0A 2ACKA 1P4SA 1QYCA 3HR7A 3CPSA 1BHO1 4ZAVA 1K8YB 2P69A 4P0TA 1E2PA 4TTIA 2C2ZA 1DEHA 1JH8A 1SXIA 4P2BA 4BL5A 3NOXA 4MA0A 2FMUA 2NT4A 3HFJA 3LD9A 4HYQA 1TTTA 4RMNA 1VCOA 2EJWA 2WF6A 3PUZA 1R8JA 5DHTA 4AZ0A 4ECAA 4LF5B 1PE0A 5HCUA 3LHKA 2VDPB 2AUTA 1A7KA 2DULA 1CP2A 4UMDA 3S1LA 3H3XA 4MUGA 1SXPA 1QQ5A 1LB1B 1GA6A 4E13A 4V0NA 3I9OA 1GVHA 2QD2A 1XCMA 1ZGZA 4GU5A 3T6KA 1FMTA 4XDYA 4CLDA 3I8SA 1R6AA 1J8YF 2REQB 5CK5A 2JNWA 3CB2A 3JVEA 5BSRA 4ZHQB 3QWFA 2BZGA 2UUCB 4DM3A 1HM5A 2GN9A 3C87A 2VHQA 3OIUA 3ZCPA 2GXQA 4PNHA 3UUWA 3KK0A 3ICOA 1OA1A 2VQ6A 4WKCA 5BNWA 3EAFA 1TVKA 3QM1A 1OLSA 4XGNA 2IH5A 2GCEA 2NYAA 3MC1A 4AVYA 2ZUFA 3KE9A 2OO5A 3NEJA 5KHOC 3LK7A 2LKDA 3LC7O 4EKEA 3W2HA 2O8CA 5B6PA 2J3IA 3I4FA 1ZR2A 3KB8A 2PGLA 3JALA 4OHVA 4GI3A 1F2VA 5G1PA 4DKXA 4ZKDA 1N92A 5EHZA 5FTMA 3L7MA 1IZ8A 3DJYA 4TWIA 1H5QA 3GJYA 2HA3A 1NVAA 4PGGA 4S1OA 2WD8A 5DWVA 2WY2D 3PXGA 5C1OA 4M0EA 5KTRA 5REQB 4D7AA 3OESA 3HN2A 4L08A 1YRYE 4IDNA 4ENVA 1IQUA 1U2DA 2NVUA 3A31A 1JFVA 4JODA 4NESA 4TUYA 3I42A 1TYAE 2AVNA 5LBUA 3B89A 2YXEA 4ZI5A 1WWKA 1EVIA 5K0SA 1EYZA 5HNKA 1Y6FA 4AKHA 1Z6AA 4XB1A 2XUHA 3QVWA 3FOBA 1HK7A 3GLVA 3TLBA 4AXBA 2ECQA 1EFRD 4M55A 4KSYA 4KWHA 4DLNA 3I5YA 3MSXA 4O8CA 3MJEA 4M0MA 4Y2PA 3SP1A 1SKBA 3RRXA 1CE8B 4JWTA 4LW8A 4QTUB 1ZWLA 3W1WA 1L2TA 2CFSA 3OQHA 5IULC 2XRZA 4DBLC 2H1OA 5JIBA 3CJQA 1XRNA 3BL6A 5EIBC 4Z7NB 4LBZA 1XI2A 1KJ9A 1U3WA 4E7OA 3PGMA 4JOQA 3VDRA 2HM7A 5LDHA 5IAAA 1A5BB 1IZ9A 1V95A 3VPGA 1AF4A 1EWRA 3GDOA 1X7DA 4GR9A 4R2WA 2XT9A 4F2PA 1G63A 2FSVC 5KREA 1HY3A 2ZI4A 1AHNA 4GPTA 4NFHA 5DO9A 2V65A 1W36C 2UU9B 2QF7A 1AKEA 3PWKA 3HY6A 2YVQA 2W2XA 4YGXB 2QTLA 2ZE7A 4PM4A 4YRLA 1L4BA 3E6AA 1GQSA 1NI4A 1X6VA 4A73A 4HGRA 4QJ5A 4Y30A 3U4HA 3UAOA 4S05A 3IELA 2EHDA 2GVNA 3G5TA 1SHLA 5AKHA 3RUPA 3WFZA 2X4LA 5JE8A 4WBNB 4UTOA 3CCCA 3CH6A 2XUKA 2B3TA 3A70A 2F3QA 4TTJA 1ZH6A 2AFHE 3WYGA 1CHNA 1FX1A 5CDTA 5IXYA 5LN1A 2QMOA 2GVDC 3X2SA 5A5EA 4EO7A 2Y66A 1KMMA 3DSRA 1YXMA 3VISA 3QYFA 1AHPA 1YZUA 3PRJA 2G40A 5E7QA 2AXPA 3TFQA 3LLMA 3TRKA 4RTNA 1UEIA 1JAIA 4DMRA 1R0YA 1Y0BA 3HR8A 4A10A 3OTOB 3FZNA 2PKEA 1K86A 1GFZA 2XUAA 1JPUA 3E84A 2Q45A 3EXEA 2UZ0A 3W5CA 1A8SA 2G9RA 4MULA 1K0FA 3N05A 3ZWXA 1VL5A 5EZYF 4LYFA 3SX2A 5LWHA 3KPWA 4Z0PA 5EIXA 3HABA 2FPPA 4O4JF 2PGOA 4NV0A 3MAAC 3L02A 3QVLA 4RKQA 3NI2A 3CF0A 2NU6A 2FX2A 3ZDDA 1K5PA 2K2QB 3DE3X 1JAHA 4HBGA 1XDUA 2P78A 1KZYC 2IIBA 4G4SP 5BVHB 2AMLA 3TIXB 3D6HA 4JVOA 1RHKA 2PWAA 3GLGA 1SBCA 3KUUA 3AVYA 1N2CB 2HHLA 2C5HA 4H7DA 4UUBA 3PG5A 4XR9A 1JSRA 5JFGA 1BO6A 1LX6A 1U3TA 2MINB 4L5AA 3WGJA 3ESCA 1ZFNA 3A4LA 1A3CA 1A77A 1RKUA 3NT5A 3P97A 3GELA 5KCMA 1TA9A 3BGSA 2H4FA 2OV8A 3BKXA 4IO1A 2YWXA 4DXAA 4L22A 2ZR8A 2CBZA 3R3JA 1YGYA 2HDHA 4JLNA 3MYYA 2VXYA 5CEFA 2PAFA 2ZCUA 3HSYA 1O5TA 3I32A 1F8YA 3UGTA 1OB2A 1KDPA 3OQMA 2CVPA 1XA3A 4XTRA 5D6NA 4DC1A 1MC1A 4R84A 5A04A 5COQA 2AG1A 2B94A 1IN8A 1L5GB 5DLEA 3OM1A 1YT5A 2VJBA 1Y6QA 3UQYS 2BEVB 3IKVA 4J0GA 2WIGA 4KLNA 3HU1A 5EPUA 3U9TA 3U7QB 1QHNA 2IRWA 3WAKA 4KIGA 4EG7A 4JR2A 3VNQA 5FFNA 4R71A 5CFNA 3PQ2A 4TTRA 3A3KA 4X65B 3HXTA 5JD5A 2H07A 4B43A 2JB9A 3LCCA 1FOEB 4DN6A 3ROFA 5F2OA 2MDTA 1ZVVA 5DLDA 2R5FA 3MWLA 4CCYB 2XXAA 5I8ZA 1X87A 3UG6A 2EKZA 4AU1A 3CVVA 2VK1A 4NU6A 5ESWA 4DABA 4DPLA 3KQUA 1RXWA 3ZLJA 2I87A 3WL6A 4DXHA 2GBLC 3CE6A 5LKRA 5AHOA 1VE3A 2PYDA 2K5UA 3HA7A 3QLVA 1FVOA 1OIVA 2YWGA 3QOWA 4L57A 2GX6A 4NTZA 4X8LA 4YECA 3R7NA 3F49S 3RYHB 1B23P 2YWDA 5B4VA 4QGHA 2PH5A 4I50F 3SIPA 1I3CA 3C8UA 1Z15A 4HQLA 2G83A 4HZGA 4K2HA 5ALIA 1TAUA 1IG3A 1J7KA 2Q4RA 3NX4A 3FPEA 2DUNA