9LDBA

Design and synthesis of new enzymes based on the lactate dehydrogenase framework
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
331
structure length
331
Chain Sequence
ATLKDQLIHNLLKEEHVPHNKITVVGVGAVGMACAISILMKELADEIALVDVMEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSRLVVITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKYSPNCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWILGEHGDSSVPVWSGVNVAGVSLKNLHPELGTDADKEHWKAVHKEVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKENVFLSVPCILGQNGISDVVKVTLTPEEEAHLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase(choh(d)-nad+(a))
molecule keywords LACTATE DEHYDROGENASE
publication title Design and synthesis of new enzymes based on the lactate dehydrogenase framework.
pubmed rcsb
source organism Sus scrofa
total genus 100
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1991-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 9ldbA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 9ldbA02
1X7DA 5EESA 3V8BA 4CV2A 4F46A 3I1JA 4NK4A 5L53A 1Z6ZA 2GZ2A 3AOGA 2AE2A 2QIOA 3GEGA 5KOIA 3OQ6A 4JN6B 2EKQA 4RL6A 1C0LA 1EFKA 3ICCA 2WE7A 3CTMA 1M66A 1MLDA 1QLHA 1TT5B 4J49A 1W0CA 2VWQA 2D0IA 1EBFA 1BW9A 1W8DA 1XR3A 1ISHA 2OP0A 3FNEA 1H93A 1LC0A 5L9AA 2H5LA 5L3ZA 3GMDA 4PZEA 3RUAA 3EZLA 2A9FA 2ET6A 1P31A 3L4BA 4KTVE 4CQMA 4RVFA 3BIOA 2B69A 4RGBA 4AJ4A 1NQ5A 4BMVA 1WMAA 3PWZA 5F3RA 4EUHA 1PJ4A 2VYND 5TSDA 4BO0A 4B3JA 3FI9A 1YJQA 5A9RA 2VWPA 1CDOA 1ARZA 1RYDA 2BI8A 2Q99A 1XQ6A 2GPTA 3GR6A 3IOYA 4BGIA 9LDTA 1KS9A 5HS4A 3U3XA 4UVHA 3NAQA 2X0NA 1D3AA 3DWFA 3JQBC 1XHLA 1JVSA 5EQDA 4CUKA 3HSKA 3HFSA 3GOHA 3KXDA 1VL0A 4TRRA 4XYBA 4J7UA 4KWIA 2AE1A 1FDVA 2J5QA 2TMDA 3ZHBA 1GQQA 3GAZA 3V2GA 3ZV5A 3GZNB 1V3UA 4Q3NA 5I9LA 1LNQA 4Q3EA 4CMGA 5IDWA 1YQDA 4PFJA 1K6IA 1VI2A 1UXHA 1Y7TA 3D3WB 3OICA 4PG4A 1DIHA 1I2ZA 3H5AA 3RAJA 4RF5A 1QV7A 3QY9A 2HCTA 3OM9A 1XG5A 2DTDA 4Y6RA 1NVGA 3DHYA 4PIVA 1Z73A 1N1EA 2JAHA 3DAGA 4TKMA 5A04A 1QYVA 1YBAA 4JXKA 2PFGA 2E48A 4UUNA 4Y6SA 1I2CA 2X58A 4U6QA 4ZQBA 3MWDB 4CM4A 4D42A 2VRCA 5GMOA 1UP7A 3FHLA 3TQHA 3RASA 1E3LA 1T1RA 1SO8A 4O5OA 4LMPA 2GDZA 4TQGA 2PV7A 1HE4A 2AEMA 3KSZO 3DBHB 4Q39A 4YJFB 4QECA 1RM0A 4EDFA 4JLWA 1XDWA 1SCUA 3L4BC 4GKVA 4BO9A 1B8PA 4J7XA 4OHUA 4TVBA 2I5PO 3WIEA 1WMBA 1PZEA 4TRNA 3RUFA 1DB3A 3ZV3A 3DBLB 2O3SA 1LSUA 3EVNA 5BQFA 4CM9D 3OBBA 3CMCO 2DC1A 4RPJA 4I08A 1YOVA 2JFFA 1R37A 1CEQA 2QHXA 3LLVA 2A92A 3IQDB 4L76A 4XRGA 3KUXA 4W9NA 4A7PA 5JAIA 3FR7A 1A72A 2V6GA 4XZ3A 3KTDA 3UN1A 4RV9A 4YT8A 2G82A 4B7CA 3LC2O 4BNZA 3ASUA 2NWQA 1Y8QA 5AYVA 4ALKA 4NU5A 3FTPA 3WGIA 4E13A 3VVBA 2GCGA 1T2EA 2JAPA 2CDAA 3WJ7A 5CAEA 5L4LA 3PLNA 3JYPA 2DFVA 1H2BA 4W6ZA 1U3TA 3WNVA 4NJMA 4E4YA 4J91A 4ZICA 5CG1A 5I9NA 4XQGA 1XLTA 3BZUA 2Y1DA 4J2HA 3OP4A 4IXTA 1RM5A 1HDCA 1JWAB 1JAYA 4L74A 3QA9A 3KBOA 2NADA 1PR3A 5CP8A 4Q3BA 1YL6A 1X13A 2P68A 2HMSA 4P8RA 1E7SA 1ENOA 1FF9A 2GASA 4G2NA 1LLUA 1P1IA 1RWBA 3IJPA 4QO8A 1PJ2A 1DAOA 4RVHA 2HO5A 1B3RA 5F1PA 4BNXA 4FJ1A 3K73O 1BTOA 3DMTA 1E3IA 4Z0TA 2AMFA 1B0AA 1G1AA 3I4FA 4LCEA 4F45A 2W2LA 4IXWA 3RQSA 2EP5A 4BMSA 3I9LA 3BMCB 1W6UA 1E3WA 3QWHA 1FDUA 3JQEA 1I8TA 2G5CA 2DBZA 4R51A 1BDMA 1AN9A 4Z3DA 3RUEA 5JC8A 1UZLA 1JKIA 3GN2A 2RIRA 3Q0EA 5JNLA 3ZWCA 2R6JA 3KSUA 3L0DA 4Q3CA 2Y1CA 3KZVA 2FY8A 3HN2A 3TJRA 1PS9A 4LVCA 1IZ9A 3UVEA 5IXYA 2VOEA 2B4RO 3E8XA 1PZFA 3TPCA 3C3XA 1Y8RA 3L77A 4IJWA 4W9NC 3K2BA 4D0SA 4DPKA 2JL1A 3Q9UA 1DJNA 4UVIA 4AJKA 4OM8A 2W4QA 2ZYGA 3UXYA 3P2YA 2Z95A 3D5TA 4PLHA 2B0JA 3ETDA 4A5OA 1J6UA 1QP8A 2X86A 2PZKA 4XQCA 4AJEA 4DQXA 2CVQA 5G4KB 1L1FA 1VSVA 5DBGA 2HJSA 5EJ2A 2OBYA 2PD4A 1ZXBA 1YDEA 3GPIA 4ND3A 1JU9A 3AM4A 4OOFA 3JQ7A 4MJLA 1GPJA 1GZ4A 2J6IA 2Y1EA 1DRVA 1I33A 3D4OA 3I6QA 3PEFA 4IQGA 1VPDA 3EHEA 3KRTA 4KUHA 1PQUA 1VSUA 2ILTA 2Q1TA 3DHNA 4YAGA 4EUFA 1RPNA 2EIHA 3H5RA 3Q11A 3DOCA 2AEJA 1IY8A 3DMTC 2IYOA 4YAEA 1P74A 5CDUA 2WTBA 1QYWA 5HWSA 2NVUA 3E6AA 2C07A 5TS3A 1ZMOA 1XCBA 1HYGA 3ADPA 1KERA 1DFGA 4MP6A 4PN3A 4YJDA 2WD8A 4FFPA 2YYYA 1GEEA 1IPFA 2FPPA 3QWAA 4ZQHA 4F6CA 1DO8A 4JX8A 2DAPA 3ONFA 5C37A 1A27A 1QR6A 1NFQA 4ZD6A 3IDSA 3H7AA 2ZB4A 4DYDA 1P33A 2NVWA 4YRDA 3AI2A 2RCYA 2DUUA 4QO7A 2YQ5A 1NAIA 1VM6A 3P5SA 1E5LA 1Q1NA 2HK9A 4P4GA 5DP2A 4CMEA 2NV6A 1ML3A 1Q0LA 4Z9FA 1ZK2A 4XWYA 3GC6A 3HZZA 1DHTA 2BFMA 4ZHSA 5B1YA 3RKUA 1LSSA 4GL4A 4NFSA 2ZTUA 4EUEA 4YCAA 5JYEA 4IDFA 1LDGA 5T64A 3RJ5A 1XSEA 3HN7A 4IDDA 5ER9A 3VVCA 2VZ0A 4JK3A 3IP3A 5JMPA 3PYMA 4FQ8A 1GUYA 1HTBA 1JW9B 1HE2A 1SB9A 1NPTO 3CPSA 2YFHA 3LDHA 3MEQA 4FBGA 1EBUA 4WPGA 4BNGA 3FN4A 3I9OA 4IZIA 3ROPA 2P4HX 5F1KA 3WNQA 4J3FA 1PL6A 1KVRA 3F3SA 1C14A 2FWMX 3VZRA 4Y9DA 4JBHA 1F06A 4BGEA 4PLGA 1ZZEA 1O0SA 1F8GA 2QQ5A 4FW8A 1YJ8A 1BW9B 1C0KA 3H9QA 1M6WA 4AVYA 3GPDG 3QWBA 4KP7A 1YRLA 1EZ4A 3PGJA 4DGSA 3RCBA 5L40A 3PHJA 3IP1A 1PJTA 5H81A 5TNXA 4CQMB 4D3SA 1HSOA 2WDZA 2YV3A 4FD3A 5IN4A 3WQQA 3E5MA 2D3TA 1I36A 3PDJA 4WLEA 5T67A 3SLGA 2PZJA 4YAJA 1X0XA 1MUUA 3P2OA 1K3TA 4TRMA 4J2OA 4CQMD 3D4NA 4MO2A 2ZJ0A 4JIGA 2EW8A 4HWKA 3UICA 5U4QA 4R1UA 4TMFA 4LW8A 3ZCXA 1K5HA 4U0JA 1ZK4A 3O8QB 1J0XO 3GDGA 2Y1OA 2QYSA 1O8CA 4WEQA 2Y1FA 1HE3A 5IZCA 3HNPA 1HETA 3D3WA 1O94A 1T24A 3GG2A 1B16A 1V3TA 2CY0A 4QX6A 2WE8A 2X6TA 1SZJG 4CMEC 1IB6A 3EZYA 3FWZA 4BV8A 3WBBA 3INTA 4QTZA 4HP8A 3TSCA 2FR1A 3O38A 3H9JA 1H0KA 4LRTB 2AQ8A 3KHUA 2GZ1A 2HK7A 3ZZNA 5JPIA 1PZGA 3W1VA 2NU7A 2ZCUA 3NKLA 4FDAA 1YB4A 3WXBA 2X0IA 3IJRA 3C8MA 3S8MA 5JBIA 2BFAA 3MJVA 1GCOA 4AJHA 4R1TA 1EE2A 3DFZA 1PJBA 4RPKA 1XYGA 1IZ0A 3VKUA 1EMDA 2Q2VA 4RF2A 2NU6A 1ZW1A 3AU8A 4CM4B 4RVGA 2WJPA 3DOOA 4BO4A 1WAMA 3HB5X 1H2HA 1VJ0A 1LU9A 2BFPA 1Z7BA 1DOHA 3OIGA 3WMWA 5IDYA 4GBJA 3ZWVA 4DLLA 1WDMA 3GK3A 1ISGA 2HMWA 1HLDA 3IS3A 3LZ6A 3CH6A 3WTCA 4YJFA 3UCXA 5CDSA 2J3JA 2VRCD 1R4MB 1G0NA 3R3SA 1X0VA 4I5EA 2Y99A 3L6EA 1U3UA 1KIFA 3ZU2A 5COBA 3DB2A 1C0PA 2O2SA 3OFSA 4ZQGA 5GZ3A 2Q2QA 4XX0A 5I7EA 5EIOA 3DBLA 3DTTA 3K6JA 2P5YA 1OFGA 3K31A 2DPGA 2I65A 1HZZA 5KIAA 3U4IA 1IHXA 3VPSA 1F14A 4J9UE 4Y8VA 5ENVA 4EYEA 4BO6A 3D64A 5CPFA 3DDNA 4WECA 5KTKA 1BVRA 3JQCA 4CQLB 5IZCC 5KWEA 2BI7A 5CFZA 5I9MA 4WNIA 3UH1A 1HDZA 4C4OA 4Q9NA 3LQFA 4J16A 4IQ0A 2EGHA 2C5EA 3H9UA 4EJMA 3W4KA 5DDIP 1UR5A 3L6DA 4BNJA 4CMKA 2FOIA 4DQVA 5CDTA 4NJMB 4N5MA 4N5NA 3OH8A 3OEWA 1HZJA 2BHLA 4BKQA 5ILOA 1E6EA 1NVMB 4UULA 5I8ZA 3O03A 3O26A 2YW9A 4ILKA 4IM7A 5JE8A 2VZ8A 4WNCA 3GEMA 3GVCA 5FI3A 5THQA 4CV0A 1ZSNA 4DIFA 3F47A 3U62A 2O4CA 1E0DA 1MG0A 2CMDA 3E82A 2FRDA 1SMKA 4FFOA 4NBUA 2J5KA 1HYHA 1RM3A 3GY0A 4KUEA 5FFFA 4ALJA 1QSGA 2O3RA 4RORA 2PK3A 4BNHA 5KJCA 4NK5A 5AXDA 2Y05A 3BMCA 4PLTA 4W99A 4QXMA 3ROKA 5T57A 3TRIA 1O9BA 1YWGO 3G49A 3WSWA 4CL3A 2V6MA 3ST7A 4EITA 1FDTA 5CEJA 3OIDA 3RC9A 1U3VA 1M6HA 2TMGA 2NVBA 4M1QA 3ZW9A 2OHXA 5TGDA 1YB1A 2W2LD 4MINA 3OJFA 3WGHA 4O6VA 1C3VA 1EVJA 1F17A 1T2CA 1T26A 2IXAA 4B3HA 2Y0DA 3U4CA 1NXQA 4NBVA 3H5NA 2BF7A 3JV7A 4XRRA 4E5NA 5A1TA 2HAEA 2UYYA 2B83A 4GX0A 4YVFA 4P22A 3B1KA 5COQA 1Y8RB 2BD0A 3QE3A 2V7PA 4YBZA 2QYTA 1BDBA 3INGA 2WWRA 4IGFA 2NTNA 3JD4A 4DYVA 4NZ9A 1BSVA 2RHCA 4PLYA 3TL3A 3WX0A 4YXFA 4PLVA 1V35A 4M54A 5BSEA 1WZIA 3JSAA 3ICPA 3UF0A 3OECA 4R5HA 2NNLD 1I2BA 2YV1A 1ZEMA 3WG9A 2IODA 1ISIA 5G4KA 4WUVA 3PTZA 1EQ2A 3NGXA 3NUGA 4B8WA 3DZBA 5A02A 1NQOA 3JQAA 3A06A 4CUZA 4RPLA 1R0SA 3U09A 3G3EA 1GFSA 3LYLA 2ZKLA 3JQ7B 4R16A 4DBVO 4HFMA 4OQYA 4UEOA 1TT7A 2HMVA 2PKQP 4WLOA 2X8LA 3TZ6A 4KQXA 4CR8A 2ZYAA 2FMUA 2Z1MA 3NJ4A 1AXGA 1XKQA 5KJ1A 4FC7A 2P9EA 4D7AA 4PZDA 2JHFA 3FD8A 2JCYA 4NDNE 1K6XA 2RAFA 3ZNNA 3N74A 2Q1UA 1NYTA 4GMGA 3U4HA 4BS9A 4LRSB 3W6UA 2QZZA 2XF8A 3OJLA 1WVGA 3W8DA 4IY1A 4PGFA 3WGZA 4TROA 1HDGO 4DUPA 4I9HA 3I3OA 1PGOA 3GRPA 2CD9A 1B15A 4L0QA 2VNSA 4JBGA 4WOKA 1XGKA 4M55A 1H6DA 4BHTA 3C24A 1WW8A 4N5LA 5LCXA 2FSVA 3HE3A 3PHHA 1AE1A 1ULSA 2Q1SA 1QLJA 1U9JA 3CUKA 5CDYA 3TFOA 1UXKA 2CVOA 2HRBA 2OXIA 4J90A 3JYOA 3HHPA 5DT9A 1LJ8A 2IXBA 3D1LA 4CLHA 4EEXA 4KZPA 3O4RA 4BNFA 4D0RA 2AW5A 2WYWA 1NFRA 3TDKA 2CDBA 4OSPA 2DLDA 4OQZA 1QRRA 8ADHA 3GUCA 3UUWA 5FWNA 2PGDA 4YJHA 3ZI0A 3SVTA 3DZIA 1FMCA 2DT5A 2VHWA 1I5RA 3I9JA 1LLQA 4IMRA 1FJHA 4IDBA 4BL5A 5IF3A 3T4EA 1JDJA 1W73A 3PI7A 1I24A 1U2GA 1PGNA 4J0EA 4NU6A 4R68A 3WDSA 3ZWWA 4CLEA 3A14A 4WASA 5FYDA 5TF4A 2I66A 2VWGA 3RKRA 3DC2A 3OETA 3UCFA 4DWVA 1LSOA 1ZJYA 2PZLA 1ZK0A 3ZHYA 2E6UX 2RBEA 3PFFA 3H3FA 4AJPA 3MZ0A 4CL8A 2HDHA 2DM6A 4E32A 3DBVO 2EERA 3VOSA 3WSVA 2J3KA 1UXIA 3UAGA 5KVCA 3PHGA 3NGLA 3C7DB 1E1NA 1GYQA 1WLYA 3PDUA 4CMIA 3VTZA 4YQYA 4URFA 5T8KA 1WZEA 3O8QA 3VH3A 1QYDA 2O50A 1I3LA 3H2SA 2GLXA 4MDHA 1KY4A 5KVQA 3RFVA 2PD3A 2EGGA 1UDAA 2UDPA 1DFIA 1Z7EA 3VZPA 4L8VA 1EQUA 3FSRA 5JO9A 3LF2A 4GGPA 3RUDA 1ZO8A 5G0SA 2P9GA 4GVXA 4XIYA 1ZIDA 3QVXA 3LT0A 1HDYA 4IJUA 3CIFA 1LDYA 2I67A 4R1NA 3G1UA 4IDCA 4F6LA 5ER6A 1K2WA 2AG8A 3GAFA 2C59A 4OXNA 4EEZA 4JBIA 4BNLA 3ANNA 4II2A 2I3AA 4O0LA 1R12A 2FPIA 2VHZA 3DBRB 5AVOA 4CM8A 1VKOA 1VJ1A 5C7LO 1R6DA 2AXQA 1DBVO 1SOVA 1BXGA 2YY7A 1JA9A 3X2EA 4EBFA 1X7HA 1NHWA 3VTFA 4A10A 1E3EA 3C7CB 2CF5A 4MIYA 3WQSB 4L4RA 1I0ZA 3MJSA 2RHRA 3RBXA 3V2HA 4N54A 2VT2A 4FR5A 4FB5A 4OGWA 1NR1A 3NTQA 1R4MA 3PWKA 3VH2A 4XR4A 4BB6A 2JCXA 2DQ4A 3F4BA 3PPIA 3QIVA 4U6SA 4OXKA 1S6YA 3AI1A 1ZVMA 1PGQA 3EAGA 4XCVA 3DQPA 2OUIA 3OEYA 1A7KA 2J3HA 2BLLA 1H6AA 4AJ2A 2NQTA 2XXBA 3PQEA 5MDHA 3FF4A 4EW6A 2ZTLA 1R0LA 4DPMA 3OA0A 1AGNA 2Z5LA 4NBWA 5FI5A 1KY5A 5T8KC 4B3IA 3TN7A 5JMWA 1EVYA 4CQLA 5DOVA 1EUCA 5AXBA 4B7XA 1MGOA 1YONA 1NWHA 3GVHA 4TWRA 3AY3A 4DLBA 3SC6A 3V5NA 1GDHA 4IJVA 2GN6A 2PD6A 1CIVA 1SBYA 3Q2IA 1M75A 2IDZA 3NTRA 1JN0A 4FFRA 3BA1A 4N7RA 3AJRA 1OC2A 4IS2A 4G5HA 4FOOA 1BVUA 5TT1A 4BNTA 3K8ZA 3ABIA 2GR9A 4K6FA 1CWUA 1VJTA 4NQZA 3LT2A 2C20A 3NX4A 2NACA 3ENKA 3Q2KA 3LK7A 3E5RA 4P4NA 1T4BA 4OKNA 7ADHA 3GRKA 3PP8A 7MDHA 1DC3A 1UZNA 4OO3A 4D79A 2YFQA 3CMMA 5BSGA 3BTUA 3E03A 3M2PA 4YT2A 2ZB7A 1N9GA 2GO1A 2WSBA 2WM3A 4ROSA 4ID9A 4JJGA 3WGGA 4DQUA 2UV8A 4YAIA 4B79A 1UXJA 4HFNA 3WIDA 4HFRA 3E9NA 3C1OA 1TEHA 4CMBA 4E5MA 1NM5A 1WDLA 3JQDA 2QZ9A 1X1EA 3GUYA 2B4TO 2R2GA 3PJEA 1QV6A 3FPCA 1X14A 3DAFA 3BTVA 1GZ6A 4JGBA 2VZ9A 1UDCA 4ZA2A 5JAQA 2BGKA 4WCFA 3GGPA 1PX0A 3HFGA 4DLAA 1DC4A 1NHGA 3WMXA 3WYBA 3DO5A 1WXDA 4DL9A 4RLSA 2QRKA 3DAPA 4RVDA 1LDMA 4BNNA 1LDEA 2NTJA 5IXSA 5EN4A 3K92A 3GQVA 4CJXA 5DOZA 3R0IA 5L7TA 1QKIA 4OXYA 4U7WA 3W6ZA 3OHSX 3H2ZA 5G2OA 3PJDA 3UOGA 3B70A 2OFPA 2RH8A 1P1FA 4CV3A 4KWHA 3W4JA 3PJGA 3R3JA 4BKPA 3PRJA 3V1YA 3JQAB 2JCVA 1YVEI 5IZ4A 3RROA 1JTVA 1U7HA 3ZU4A 1QG6A 1HSZA 2Y66A 3NEPX 1LXCA 4J4BA 2FZWA 3NYWA 4J7CA 1EDOA 4JP3A 3FNFA 2V65A 3GFGA 1IOLA 3R6DA 2EEZA 4PVDA 1IL0A 1IHYA 3BHMA 2GN8A 3JQAD 3PQDA 1H5QA 4DTIA 1VLLA 4GGOA 2GN4A 3GNQA 2NUAA 5H83A 4ALMA 5H82A 3ON5A 1A9ZA 4PLZA 4R3NA 4CM6A 4E33A 4NR0A 1UZMA 2EKPA 4UUMA 3FPLA 3VH4A 1PJCA 5T5QA 1ZEJA 4J1SA 4IIVA 4RQTA 4XEHA 4U5QA 9LDBA 3HDQA 3DHEA 4MVJI 4AG3A 2OO5A 2JFGA 5JLAA 2ZCVA 5JDCA 2VTDA 1E1LA 1JAXA 1G6KA 4CODB 1PJLA 4AJOA 3GVIA 2C0CA 2XXJA 4CMJA 2AQIA 3SX2A 3WFIA 1MB4A 4BNWA 3RUCA 4GLLA 2NU9A 5A3VA 5A3JA 4J4HA 4BNMA 4CLXA 4X54A 2BGLA 3OSUA 5A05A 2D8AA 3C1AA 4WCFC 1EUZA 2GN9A 3B1JA 4IMPA 1H6CA 4LN1A 2IE0A 3BHIA 1ENZA 4ESOA 4B4VA 2OORA 2PKQO 4LGVA 2FR8A 4IDGA 1ORRA 4ZRMA 3WTBA 4NFYA 2JD1A 4BO5A 1O5IA 5B4TA 3S2IA 1KEUA 3I9MA 2GUGA 5JS6A 1GQYA 3GMSA 2O7QA 3B20A 3QVOA 4XYMA 2G76A 5TX7A 4H15A 1T2AA 3WR5A 4J0FA 2I76A 4K6CA 4PVCA 1TA4A 1YL5A 3DTYA 4YJHB 2CVZA 1NQAO 5HRUA 3AFMA 2EJWA 3OJOA 4PLCA 4NHEA 4M8SA 4NNJA 3DFUA 1BG6A 2VQ3A 3GZ4A 1E92A 2X9GA 2DBQA 2D4AA 1CERA 3V2UA 5ENDA 5I8WA 1ADGA 1SPXA 4AJLA 5JC1A 1D7OA 1ZBQA 2YUTA 2AA3A 1P1RA 1S7CA 3MJ4A 4I5DA 4IZHA 1JLLA 1YS4A 1GTMA 4GH5A 3OA2A 1D4FA 2D2IA 2O48X 1BGVA 2FZEA 1PZHA 3DZHA 1ONNA 1RJWA 1Q0QA 4BKOA 2X5JO 3GGGA 3KEQA 1V9LA 2IZZA 2E37A 4PRLA 2X23A 3X2FA 1CYDA 5BR7A 4CM1A 3ANMA 3D4PA 4WE3A 2VUUA 4C7KA 4CMIB 5JDCC 3BHJA 4YRBA 3I6IA 1TI7A 2B5WA 4GWKA 3GN1A 4BO7A 2YHUA 4R3WA 2ZIZA 5U1PA 1ZNQO 2OP1A 3RBVA 3U9LA 2AQHA 1DLIA 4GX2A 2O3TA 2PGLA 5F21A 1H9BA 1JKJA 2F1KA 4XR9A 5KKAA 4HFJA 5KNLA 5ICMA 3IIEA 3H9GA 4E0BA 4I5FA 1J49A 2IYPA 2JD0A 3A28A 3RI3A 2Y68A 2H9IA 4FCCA 2OZPA 3IC5A 4MKRA 3DBRA 3KSDO 2EKLA 3FBTA 3P19A 3RUIA 3W4IA 4GMFA 2VWHA 1YXMA 3G79A 3PFWO 4IPTA 2XOXA 5EMHA 4CM8B 3QP9A 4XYGA 1F8FA 4NG5A 4K26A 4A0SA 2UAGA 1BXGB 3VKVA 1P77A 4CLOA 1T1SA 1MP0A 1VL6A 3RC1A 1NQTA 3JD0A 1EVZA 4LVUA 1LDBA 4PG5A 3U5TA 2DKNA 1HYEA 3M2TA 5U9CA 2E49A 3AI3A 1Q7CA 5ITWA 4L4SA 3I5MA 4IUYA 1HL3A 4MVJG 4D3FA 4YPOA 4EI2A 4IDEA 1QXSA 1ZUD1 4Y98A 3GF4A 4AJ1A 3TZCA 1ID1A 1WDKA 5L95A 1ZH8A 4FIZA 2D5AA 4MVJF 4YR9A 1SOWA 1YB5A 3NT4A 4KDEA 3GH3A 2YJZA 4M86A 2I6TA 1XA0A 1E77A 1RM4A 1P9LA 2G17A 4H3VA 3ZDFA 1LDNA 3QLJA 3VPXA 4A73A 4Z6KA 1EK6A 4OAQA 4H7PA 4W4TA 4WKGA 1GL3A 1E7WA 4MVJA 2R00A 3HQ4O 5LDHA 3JQ9A 5BSHA 1ZKMA 3KYBA 1R0KA 5JCJA 4E2WA 2C2XA 2EXXA 4XQEA 1PSDA 1YGYA 5LC1A 1H6BA 4KDFA 4OJNA 1I10A 2IEDA 4FJ2A 4GPD1 1CF2O 3DXFA 3GVXA 4FOSA 4JQCA 2HQ1A 5I7SA 1QYCA 1CETA 2W8ZA 4W7IA 1O95A 3E9MA 3K9QO 5KCZA 4YTEA 3ZWXA 3DONA 3AOEC 2V6BA 1DIAA 1UJMA 4O1MA 4RVUA 3AW9A 1MC5A 3K30A 4HNHA 2DTEA 4EJ0A 2BMAA 5A03A 3VHRA 3ONEA 3EK2A 2VYVA 4FPXA 5A06A 4CLDA 5BNFA 1WPQA 4J1NA 4DBZA 3WFJA 4QQRA 5GY7A 4JNKA 4OIMA 5KVSA 2BELA 2QW8A 4ND1A 2GYYA 2Q46A 4YRAA 4UVEA 1AXEA 4D3DA 5JY6A 1EE9A 4HBGA 3RFTA 4CR6A 4CPDA 4PLWA 3HADA 5HS6A 3GDFA 1HDRA 1U7TA 3BYZA 4ZQEA 1HE5A 1DJQA 1N9GB 2B5VA 3LT4A 3EUWA 1KVSA 1M2WA 4BUCA 2VTEA 1QMGA 4IIUA 1H94A 1BHSA 5TQVA 4E3ZA 3PHLA 1SAYA 2POQX 2FP4A 2I99A 3HB4X 4EZBA 4PZCA 2DFDA 1N2SA 1ENYA 4PG8A 1CQJA 1JQBA 4NH4A 2C7VA 3FNGA 3BTSA 4E5YA 3STHA 1MA0A 1SEPA 4K9DA 3S1LA 3FRJA 3UHAA 2DBVO 1V3VA 2WMDA 1EUDA 2YHIA 3IKTA 1B3BA 2J8ZA 3KYCA 4GX1A 3HDYA 2PA3A 2VHVA 3BTOA 4BOYA 2GF2A 3C1TA 1DIGA 2GERA 2R00C 4GAEA 2Y1GA 4HXYA 3ZWAA 3JQ9C 4WCFB 5HTOA 2CDCA 1ZJZA 3NRCA 3NT2A 1MC4A 1SC6A 3HUDA 1JWBB 2PH3A 4DMLA 5DP1A 5B37A 4O63O 3F46A 4C7JA 1XIVA 4A03A 1P0CA 2O2YA 3AFNA 2IRWA 3AWDA 1FDWA 1R4NA 4HADA 4QEDA 3UW3A 2AQKA 3RFXA 4CMAA 3ZWYA 2GNAA 3KO8A 3MWEB 4OL9A 4NJOA 5TIIA 3GNTA 1R15A 2SCUA 4UUPA 2JKVA 3ULKA 1DEHA 1SNYA 2BKAA 1X7GA 3VDQA 4ND4A 4NMHA 5TC4A 5KVVA 3JQGA 1I32A 3LC7O 2YV2A 1MFPA 2VNAA 3WGTA 4E31A 1YKFA 3ETGA 2ZQYA 4BO2A 3CINA 2HJRA 3PIDA 3WBFA 2X0RA 4L4XA 1HRDA 2DTXA 3WGYA 1PTJA 4ZN6A 2Q2WA 2CUKA 3IUSA 2Q1WA 3JQ8B 1PU2A 5L45A 4FC6A 5JO0A 2IZ0A 1R16A 1DXYA 2HSDA 3MTJA 3AUSA 4MVJE 4XB1A 2GD1O 3KYDA 4R9RA 3EW7A 3GFBA 1H9AA 5K9ZA 1XU7A 2FHSA 3ZV6A 3OF2A 4YWJA 3FWNA 5C5IA 4RVSA 1ZSYA 3INRA 1LLDA 1DAPA 1OC4A 4MKXA 3HDJA 5EERA 1RYEA 3PIIA 1I01A 4G65A 1MXFA 4YJGB 4I9UA 4XYLA 2W2KA 1KVQA 2GSDA 1PS0A 1KEWA 4GKBA 3GT0A 3FNHA 1NTOA 1PJSA 3PHIA 1E3SA 3L9WA 2RH4A 4H16A 4GWGA 4II3A 3QVWA 3S2GA 5ES3A 4BQRA 3QSGA 3JQFC 1YDWA 2EJVA 4NI5A 3EC7A 1Y5RA 3F6YA 5JW6A 4BGUA 4S3MA 3ZV4A 1L7EA 3MCVA 3BMNA 2VHYA 5CEFA 4Q3AA 1C1DB 1E7MA 3ZU3A 3WOHA 3A9WA 1GU7A 4WLVA 3L6OO 1DIBA 1VL8A 1VC2A 5JSFA 4MKZA 3T4XA 4GQAA 1IYZA 3GNSA 4GSLA 1SEVA 2GZ3A 1MX3A 2B36A 3DR3A 1U1IA 3NDJA 4XKJA 4BNUA 1UP6A 4LSMA 1I3MA 1PGJA 2PLAA 4YB8A 3QVTA 3P7MA 3GDOA 4OMUA 3ZHXA 1U4SA 3RUHA 4AJNA 4GX5A 3TF5A 5AQ1A 3ZW8A 3VH1A 1E1KA 3QWIA 4GI2A 1P44A 4D43A 2C54A 4WEOA 2O7SA 1P1KA 4NBTA 4R1SA 3HJAA 3ORFA 4B4OA 5CG2A 2D59A 3UCEA 4QFCA 3ENNA 3H6KA 3PWSA 5COAA 2X7HA 2X9NA 5ADHA 3KV3O 2HU2A 2F00A 1LRJA 1N7HA 2ZTVA 3G17A 3NJ8A 2A94A 4BNYA 6ADHA 1YBMA 2FSSA 3RWBA 5DNAA 2VRBA 1P1JA 2PH5A 1GUFA 2VN8A 5F5LA 4CV1A 2BGMA 3OQBA 4DA9A 4E2XA 1U28A 3I4CA 4XDYA 1T2FA 1DDOA 4I8XA 1G0OA 2NSDA 4BV9A 4ND5A 4WK6A 2NU8A 3IKVA 1UUFA 3VZSA 4I1IA 3ZNPA 4XD2A 4PLPA 4BMNA 4E2ZA 2C2YA 5GZ6A 1J5PA 4YEDA 4B7UA 4ZVVA 1P1HA 1YBVA 2OL4A 1D1TA 2AEFA 4MOWA 2C5AA 1U8XX 2D1YA 1U5CA 4HKTA 3BMQA 2EP7A 4XB2A 3ZN2A 3RIHA 1PR9A 1EFLA 4BGVA 3OIFA 4HX5A 4YACA 3VPFA 4CLOB 5JFOA 3LSYA 1V0JA 4XQ9A 1E6UA 3W8FA 1E1MA 1DHRA 3GGOA 2W98A 1ONOA 3QRWA 1GAEO 3EMKA 1RKXA 2YDXA 1MV8A 4MP3A 1E7QA 4JP2A 5C7OO 3I9KA 2WD7A 1WWKA 2YZ7A 3I52A 4K28A 2O23A 3E9QA 4R69A 2X5OA 3ROQA 1L7DA 4B4UA 5A9SA 1HXHA 1F0YA 1ADBA 4BIIA 2J5RA 2CFCA 4E2YA 1UXGA 4I9NA 5AXAA 1N8KA 3ZNOA 1OAAA 4GSKA 1T2DA 4M89A 1PWZA 3K2EA 4KQWA 5KJEA 2Q45A 1E5QA 5GZ1A 4G81A 3LC1O 4WCDA 4XGIA 2HMUA 2IZ1A 2DBRA 4PCVA 1NVTA 1ZCJA 1B26A 4HUJA 1MG5A 1XU9A 4U8GA 3PJFA 5ICSA 4MVJD 5KJ6A 1UAGA 2VCYA 3BMOB 3F4LA 3M1LA 3L07A 1Q7BA 1YL7A 3PZBA 3SXPA 1NP3A 4RCVA 5JCJD 5JXWA 3GLQA 2BFOA 5HBRA 1Y81A 2CZCA 1VKNA 5TJ9A 4E12A 3DZFA 4MVJM 1IE3A 4TSKA 1R66A 2CSUA 3JYLA 2A35A 2VUSA 5FF9A 3RU9A 5ITVA 3NDIA 2HKIA 3SEFA 1QYXA 3VPHA 4ND2A 2XPCA 4GLOA 4F3YA 3TNLA 4MP8A 2O3UA 2Y67A 1KETA 3RBZA 2VYVD 5CDGA 3UFXA 3D5QA 5CHEA 4INAA 1Y1PA 3KB6A 3CZRA 4RDIA 4BKRA 4BNVA 4L73A 4XYEA 2PTGA 3WQRA 3RC7A 2AHRA 5I7FA 4W7HA 1DLJA 1LBEA 2E82A 4ZGWA 2OOSA 1IUKA 2G0TA 3GHYA 3SBOA 3ZWBA 1TVEA 4XJTA 1N92A 5J23A 1WP4A 1O89A 2IEBA 3B1FA 2I9PA 2EG9A 2DPHA 2ZB8A 1XEAA 1TLTA 4Z0HO 2EF1A 4J43A 1UP4A 2YHIB 4UREA 5ILGA 4P4LA 3KYCB 5L7WA 2BH9A 4WLFA 2C29D 3CEAA 4YDRA 3WYEA 1Z75A 1SB8A 4EJ6A 1IULA 3T7CA 3HG7A 3MJCA 5A9TA 4RZIA 2OGUA 5TT0A 1E7YA 1UH5A 4UVDA 1EK5A 4NPCA 3S2FA 4ALLA 3H8VA 5I7VA 5L4NA 3KETA 4RDHA 4E30A 1Y9EA 1DSSG 1ONPA 1EVIA 3FCOA 4JCOA 1V8BA 3ZH2A 3ASVA 3Q1LA 5F5NA 1R4NB 1YE3A 2X0JA 1E3JA 3JD1A 1OZAA 2PZMA 4IJKA 1K89A 3VAZA 1AUPA 4RPGA 4PLFA 1KC3A 1ULUA 4B4WA 1XELA 4FFMA 1KBZA 3F9IA 4DRYA 4BKUA 3WWZA 2CF6A 3Q9NA 4D45A 3JQGB 2JJYA 2H63A 1E6WA 5DBIA 1HLPA 3CE6A 1M67A 1PQPA 3V1TC 1OI7A 1PWXA 1B2LA 3JQ8A 3ETEA 1YQXA 1ZSVA 2PKRA 3OMLA 4A27A 3S55A 5G0TA 3LU1A 4UUOA 1GD1O 2DU8A 3OQ1A 1OMOA 2I3GA 4D44A 2HLPA 2JFHA 4Z3KA 3ADOA 3E18A 1NPYA 3AUTA 4FSHA 3N7UA 2QG4A 1PJ3A 3MJTA 3KYDB 4OH1A 5A5FA 3HWRA 1WNTA 1J4AA 4R9SA 1LI4A 3L4SO 3L9XA 4ZQFA 4CM5A 4WLNA 5IFLA 4ZRNA 4L9RA 5JCXA 3VC7A 3VDRA 1B14A 3C7AA 4JJFA 4ZU3A 1KOLA 1PIWA 2DUWA 3H3JA 4YJGA 2EWMA 1U2DA 2YQ4A 3DZKA 4AL4A 2VOJA 1ISFA 1D8AA 2ZATA 5C3MA 3ITDA 1E7RA 1M76A 4RLHA 2W2KB 3SLKA 1ADCA 3RJ9A 1I3NA 2LDXA 2BRUA 6LDHA 1PJQA 1B7GO 1ZK3A 2EW2A 2J3IA 3C85A 2W90A 1X1TA 3WYCA 4ALIA 1LRLA 5A4DA 1C1XA 1Z45A 3PXXA 3ZWNA 4IBOA 1Q0HA 4KTTE 4CMCA 4WJZA 4CLRA 4BB5A 1B8VA 1N5DA 4R54A 3AK4A 3EY4A 1C1DA 2GRAA 3K5PA 1F12A 3D0OA 3R1IA 4XIJA 3BMNB 2OMEA 1KC1A 3E48A 5BT9A 2PGJA 3AY6A 3AUAA 3SC4A 1OBFO 3EDMA 3BAZA 3TWOA 3H4VA 4N18A 1NPDA 1A71A 2FPGA 3PLRA 4TKLA 1UAYA 3RVDA 4XGKA 2ZYDA 3JYNA 1U4OA 3EVTA 4LISA 4WOJA 4BO3A 3GA0A 5CEEA 1O6ZA 3M1AA 3I83A 5DN9A 4YT4A 2ZTMA 3IL2A 1V6AA 1Q7GA 3DEYX 1ZK1A 2EHDA 2UUPA 4FS3A 5A5EA 1TT5A 3RU7A 4FFNA 4XGNA 5G0UA 4FGWA 2UUOA 4TVOA 3A4VA 1DIRA 4RQUA 3ROMA 1DC5A 3IMFA 3IUPA 4DVJA 1U5AA 3RC2A 3TZKA 4DMMA 3QV1A 2G1UA 2NTVA 3BXXA 4OOEA 1MFZA 2VYNA 3U4DA 4U0KA 4A2CA 1GEGA 1D1SA 1C0IA 3DMYA 4FJ0A 5IDXA 5MGBA 5EINA 1GR0A 4QFDA 1HDOA 1LRKA 3VZQA 1NBOA 1BWSA 1GV1A 1BMDA 5TJHA 2B37A 1CQIA 5IAAA 3HDHA 4M87A 3AOEA 1LQTA 2B4QA 2PWZA 5EQFA 4O59O 3T7EA 4UEJA 2EV9A 2HMTA 3JD2A 3WS7A 4NFHA 1MXHA 1DFHA 4CMHA 1GQ2A 3CXRA 4LMRA 1NWCA 3PYLA 2VT3A 4RZHA 3GZNA 3B6ZA 3CZMA 5DULA 4LSWA 1GCUA 4MIEA 1DC6A 1NNUA 5CPBA 2WYVA 5THKA 3WLFA 5IDQA 2YDYA 3BMQB 4IINA 2LDBA 4HY3A 5G4LA 1FK8A 4ALNA 2VHXA 3WICA 3GG9A 3PZRA 1CRWG 4UAGA 3JQ6A 3KVOA 1Y6JA 3GEDA 4PG6A 1ADFA 4AICA 3QWFA 1TB4A 3F5QA 3JTMA 3WB9A 5FEUA 1P45A 5BNTA 1LA2A 3NTOA 4MVJH 4Z9XA 5L7YA 4UVGA 4XJSA 2GGSA 2NLOA 3TZQA 3H9EO 3TOXA 4R5MA 2HRZA 4CM7A 1X15A 4DPLA 2A4KA 5JYDA 1YQGA 2WD7B 3WJAA 3F5SA 3I9NA 4S1VA 1KEPA 2P9CA 3A1NA 2P91A 2NQ8A 4DIOA 4E5PA 1HT0A 3EGOA 3RSHA 1U3WA 3AY7A 4DIBA 2Q4EA 4IS3A 5A9SB 3TFQA 2NM0A 5BSFA 3F1LA 3U49A 2CNBA 1FXSA 1Z82A 2X4GA 4MPDA 4UEKA 3RD5A 3DBHA 4Y67A 1A7AA 2C7GA 3FR8A 4WGGA 3ZNQA 4YQZA 2B35A 1XWFA 5IG2A 3ONDA 1Y5MA 4CM9A 4AJIA 5JDIA 5JAMA 2ZQZA 2O3QA 2PY6A 1NASA 1TXGA 1BRMA 1U8FO 3G0OA 3WGQA 4Y6PA 3ZWOA 5L51A 3BMOA 1PS8A 3OJ0A 1IPEA 3E1KA 3EYWA 4RO0A 3ZGYA 5TLSA 4RJTA 5IJZA 5G0WA 3DZJA 4MIOA 5DZSA 1HKUA 5DCUA 2QRJA 4R01A 1N7GA 3QVSA 2E4AA 1YOVB 1T4DA 2HK8A 4DREA 1NX6A 1GADO 5G0VA 4OYRA 3OJEA 1GV0A 1LSJA 4QT0A 5IN5A 3M6IA 1NAHA 3PYXA 4LCJA 2O3JA 1UDBA 1A4IA 4NBRA 1LLCA 3QHAA 2ZJ1A 4CM3A 3COSA 4Q3DA 2OBNA 4PG7A 5LDGA 2Q50A 2FN7A 1Y8QB 3ZHZA 1K6JA 4YAKA 1AHHA 1Z74A 3O9ZA 3TZHA 3JD3A 3ANLA 5TRTA 1BXZA 1FDSA 3LT1A 2PNFA 4DC0A 1YH3A 2Q3EA 5KKCA 2DVMA 4K1LA 3SJUA 5JAZA 1A4UA 1PEDA 2X9VA 4D46A 2H1SA 2PR2A 3I23A 1QORA 1Y9AA 2Y0CA 3PK0A 3ZWMA 1N1GA 2QRLA 1I3KA 3NDRA 3NT5A 5L4SA 1PQWA 2AG5A 3LF1A 4TZKA 4WLUA 3TL2A 3IAHA 4IGEA 3PVZA 3PGXA 1A9YA 2HUNA 3DZGA 4OKIA 5EL0A 1HWYA 3MTGA 5DF1A 2Y0EA 3AU9A 1OOEA 1LTHR 4R41A 4J4TA 2JD2A 5K6AA 1HF3A 4D41A 1T25A 5JY1A 4KMSA 5DCYA 1ISMA 1DRUA 3ZU5A 4RF4A 4P38A 1E3WB 4I5GA 4QSMA 2X5KO 5EPOA 3AM5A 5JDIC 1GY8A 3JQFA 4KOAA 4TRJA 1PL8A 4JROA 5T6BA 4J9VA 3V1UA 4BNKA 3NV9A 1KVUA 1P0FA 4BO8A 1B8UA 1LUAA 2P4QA 3GVPA 3MOIA 3WGOA 3ITKA 1EDZA 3QQPA 4MVJP 4GVLA 5B12A 3Q3CA 4FGSA 5DCWA 4DC1A 2D5CA 3FBGA 1PL7A 1XQ1A 2V6FA 4IQ8A 3CSDA 3DL2A 5BNIA 4JJIA 2Q49A 3K96A 4ITUA 4XA8A 3KOUA 4OSOA 2Z1NA 4XDZA 1LX6A 1W4ZA 2FR0A 1YO6A 4FN4A 3KLMX 3MOGA 2VUTA 1HEUA 4BNIA 3U0BA 3G1TA 3D3EA 3D7LA 3SJ7A 4Z9YA 4KUGA 1LC3A 4BO1A 4CR7A 5HA5A 2O4UX 1Q2XA 1K0UA 4YT5A 1DRWA 3AUUA 4YYZA 1HDXA 3Q6IA 1GZ3A 5HM8A 1LQUA 4NIMA 3ZWPA 1NFFA 2X1HA 2Y93A 1DPGA 4J6FA 1LEHA 3LVFO 1NR7A 2WYUA 4ZJUA 1GYRA 1CJCA 5C7IO 4AJJA 1GUZA 5F1OA 3JCZA 5AOVA 1ZXLA 1AHIA 3GHHA 5B4VA 3WWYA 1ISJA 2C82A 4A26A 4J1TA 2UVDA 4EGFA 3QW2A 4E6PA 3QJ5A 1P3DA 4W82A 5K0ZA 2WEKA 8LDHA 4RPHA 3MJEA 2NVUB 1KVTA 4RF3A 4DXHA 4M49A 4HV4A 1I30A 1KYQA 1ZMTA 5K6AC 1KEVA 4Z0PA 2ZB3A 2P5UA 2ZK7A 3CKYA 4J1QA 4B8ZA 4BVAA 3JQBA 3F1KA 4LK3A 1EEHA 4HNGA 3KEOA 3DOJA 4E5KA 1GPDG 4IDAA 4CUJA 4PRKA 3KM0A 3AM3A 1JVBA 2Q4BA 2QX7A 1C1XB 4AFNA 1JKFA 2P2SA 1PGPA 1A5ZA 1ENPA 4YA6A 3S2EA 5B4UA 3WLEA 2X22A 3LLSA 4TZTA 4CLRB 1BXKA 3W8EA 1VE9A 2JHGA 3N58A 3H65A 5KJFA 2H6EA 1GYPA 4L75A 3UGKA 3UKOA 4R4JA 3VPGA 4FFLA 4QUKA 2XAAA 3JYQA 3FTNA 1VRWA 4BQPA 5DBFA 5AXCA 1ZFNA 3KLPX 3TOZA 4E21A 4ONEA 3PQFA
chains in the Genus database with same CATH superfamily
5DHUA 4YLEA 5EESA 1QPBA 3KT6A 3B82A 4EF4A 4ZAYA 1T9BA 4CV2A 4MWBA 3I1JA 4ER3A 3D2AA 1F1JA 2IU4A 2GZ2A 2PANA 2AE2A 2QIOA 4NICA 3T4PA 1L5HB 5BV2P 5EGSA 3OQ6A 4KFRA 4JLKA 4D81A 1E2IA 3ICCA 4J49A 1M66A 3EXEB 1W0CA 4JITA 4L6IA 3RNOA 3V3TA 1L8QA 1P2GA 5AKYA 5IKOA 2G9RA 5JSUA 1XR3A 1YV9A 1IAVA 1P61B 1H93A 1USWA 3OZDA 4A92A 3K5IA 3EX7C 2NO9A 2BONA 3GH1A 2W7TA 3FMOB 3GMDA 4EARA 3DKVA 3B1YA 3EN0A 1IDN1 3EZLA 5AUNB 1X7YA 3HMKA 2ET6A 1PZMA 1R0ZA 1P31A 1QJCA 2PKWA 2YHBA 2PMCA 3L4BA 1B6SA 1NXOA 4KTVE 3UNXA 2OSBA 3FYUB 4OQ4A 2YMQA 3OC0A 3V1NA 5F2KA 3DNFA 4Q24A 2JI8A 4BMVA 1K92A 1GO2A 2CBZA 5HMMA 1NJ2A 2VYND 3A1SA 4QLAA 3DMHA 4BQNA 3FDXA 4B3JA 3D6AA 4B73A 1MZPA 3LHFA 1A8HA 1RYDA 2BI8A 3IOYA 3GR6A 2QL5A 2PS3A 5J2UF 1KS9A 5HS4A 2VFAA 2X0NA 4J0JA 3OMXA 1IK4A 1JVSA 1B00A 1G16A 3GOHA 1TUGA 2WA2A 1TZBA 3ESZA 4JLAA 4M1KA 4TRRA 4CT0A 2QR5A 2APJA 1O03A 1TC2A 2FEOA 3L0CA 3GLGB 3FLEA 2P40A 5TPZA 3ZV5A 3AETB 1AQ6A 2WUEA 3LIIA 4L4XA 1Z0ZA 4Q3EA 5J2UA 1TUEA 3HBJA 4MS3B 4K8RB 1UWLA 1UXHA 1Y7TA 3D3WB 3OICA 3FIJA 1DIHA 1I2ZA 3H5AA 3Q6NA 3T94A 1Y4ZA 2ACVA 1QV7A 2WWGA 5FB3A 4BAZA 1EG2A 5DISB 1L7PA 2HFKA 2QF7A 4LI3X 3NAGA 2DTDA 4Y6RA 1YHYA 1RI3A 5LQKA 1Z2OX 2IIPA 2GK6A 3DHYA 1Z73A 1ABBA 3O8LA 1QANA 1IJFA 1EI9A 1ZWLA 1EM6A 1QE0A 3DAGA 4TKMA 2H51A 4F71A 1FFXB 1C9YA 1VSBA 5F7XA 4MITA 1XPUA 1X94A 3K09C 2PFGA 2NU7B 4LMBA 1JH9A 1Y1TA 2HX1A 2ZJ5A 1W5FA 4OXXA 1YZHA 3KVYA 1SHLA 3AVQA 5AW0A 4ZQBA 4D42A 1FLNA 1Z13A 1W581 5GMOA 3WRVA 3WLRA 1XZHA 4BP1A 5I9IA 1CUDA 3T06B 2G7ZA 5CDHA 3EF3A 1D2HA 2WKPA 5FA8A 3RASA 3S27A 1Z0JA 2DCUA 4EYOA 1T1RA 5AVRA 5LLTA 4LMPA 1R27A 1HX7A 4QDUA 2CLLB 1VPEA 1Q0PA 3MRXA 2JGEA 1KXJA 2PV7A 4GM0A 4WCVA 1V7ZA 2QSZA 2CNNA 1M6NA 1JQ3A 1YA4A 2PMEA 3TR6A 2A1TS 1IN8A 5LXTF 1ZESA 2GJ9A 3CISA 4OQNA 4W1SA 1ZUHA 4YJFB 1ZRSA 3UJ9A 4Q4AA 5IX8A 2ZDHA 3K2IA 3BK7A 1AQIA 3UPDA 3CCCA 3HJFA 2NXWA 3WHLA 3N3BC 5FO1A 4BO9A 4J7XA 1CS4C 4OHUA 2PRIA 3GV0A 1PZEA 1LVUA 4CTOA 1QHSA 4XX0B 3RUFA 1QPZA 3I73A 4XLZA 3U4MA 4C30A 4RSRA 2ONJA 1AVTA 5LXTA 3E23A 1MAWA 3CSUA 1Y7HA 3R3YA 2IZOA 1S9HA 3I09A 2B34A 4G8CA 4HLNA 1DDGA 3CMCO 4HWGA 4RPJA 3RADC 5MF6A 2ZSKA 1R37A 1OCEA 4V0KA 1CEQA 4MR8A 3KE8A 2QHXA 3IQDB 4L76A 4N3CA 3VC3A 4DWJA 4Y1RB 4XRGA 3Q7IA 2PPLA 3KTDA 3HXPA 2AOUB 4GDFA 3PUVA 3IE2A 2ARKA 3BCRA 3UYLA 2AFIA 1WB5A 3C15C 3JRNA 3VKGA 4ALKA 1Y8QA 1WDWB 5KREA 1JR2A 4UM7A 1Y6RA 5KQPA 5BP7A 4ZJPA 3I2YX 4RLFA 4XCXA 4XXHA 3S68A 3WJ7A 5CAEA 5JTTA 5FULA 2DFVA 1H2BA 3I72A 4ZICA 4JB0A 4TS3A 5EKSA 2MSNA 5I9NA 1UF9A 3BZUA 4NRDA 1E9BA 1SXGA 1XNJA 4J2HA 1HFKA 3OP4A 1PSZA 1QOQB 2OQIA 2X9LA 3E3LA 4IXTA 4L16A 1RWWA 4TSRA 5DMHA 3QA9A 3CGWA 3KBOA 2NADA 1PR3A 4RD0A 1IXRC 3BWXA 2WF8A 4KMRA 1X13A 1T3HA 1JYFA 4P8RA 1SC3A 5JSHA 1KEEA 3ONWA 5DHSA 5DX1A 4RJKA 2RI6A 1ZWKA 2V7VA 3H8JA 3IJPA 4QO8A 1PJ2A 3TLBA 4Z53A 4J94A 2H52A 2CKMA 4AMGA 1OXKB 1H69A 4BFTA 2HB6A 4KLRA 3K73O 3W1WA 5HKKA 1JQDA 3DMTA 1G8PA 1QE3A 2DYKA 2H5IA 3H4IA 2XWJI 5JYBA 2C5LA 2AMFA 2YNMD 6Q21A 1Y48E 5AVUA 3OVMA 4HUTA 3I4FA 3FPGA 4JKYA 3O1LA 4WX2B 2W2LA 2GF9A 3CKKA 5D2CA 2EP5A 4GXTA 2DP4E 4RUKA 3RQSA 3IO5A 1O5OA 3BMCB 3JZIA 1FDUA 1N6IA 1NF8A 5ARDA 3BE6A 3T1QA 2ZWAA 1SRRA 4UBJA 5EJAA 3ZDYB 2ZJOA 2P78A 4PHHA 3X1WA 3ZVLA 4ZZ1A 4CCAA 3VU9B 3QVUA 3CLKA 2VKQA 3FRIA 5HKOA 5L3SB 1SWVA 3Q3GE 1XVIA 2R6JA 3KSUA 4IIEA 4Q3CA 2BKXA 2Y1CA 2XE7A 2FY8A 2IUYA 2R6CA 2AN4A 4ZO6A 4JMLA 4PGGA 2IF0A 3UVEA 3T5TA 1RXUA 4U2DA 5IXYA 1UMKA 3AKYA 2PSJA 3AHEA 3E8XA 5KAPA 4IF6A 3VBEA 4EYSA 3IVRA 1RRVA 2J9YB 1E2QA 2Z8XA 3ETLA 4HATA 4OQPA 3TPCA 2PLRA 3L77A 4JYCA 1VJ5A 3FHOA 4JSTA 4LNUA 4N39A 1UM9B 3K2BA 3SXUB 1SD5A 1W76A 2E1PA 3Q9UA 1I4DD 4WNYA 1DJNA 3E2MA 3MAJA 3NJRA 4UVIA 2G9QA 3B5IA 4S05A 1JDBC 2FX2A 1YSCA 3EQ9A 4OM8A 4DRZA 4B3MB 5EE3A 3UXYA 2Z95A 4KH1A 4LJ7A 4NESA 4PLHA 4Z86A 1Z3CA 3QOYA 4L5JA 1YCFA 1XRPA 2EZUA 3H75A 4A5OA 5LD2C 3LHIA 1FP7A 4EY6A 2IV7A 4AYWA 2C3YA 3CKMA 4HEA6 3PA6A 4ZVUA 4CIVA 1S2GA 3P2MA 2WNIA 4DQXA 1XLTC 2CVQA 2VH1A 5DI9A 5H59A 3FUCA 1U8UA 4F2WA 5DBGA 3CZQA 1Q11A 1ZXBA 3L1UA 1J0CA 1NLUA 2RGRA 1E4OA 1A5TA 3IEKA 3D9QX 1BC5A 2CWDA 5CXXA 4FEAA 2Y1EA 3TSWA 3I62A 4L9WA 1I33A 1YK0A 2LRHA 1E2KA 1XMPA 1VPDA 1ZOPA 3D4OA 3ONNA 4MR9B 4KUHA 4YAGA 4QGHA 3DHNA 1TF2A 1UPUA 2PLNA 1KI1A 1BNCA 4AURA 5GONF 1DRJA 2G1JA 2W6MA 3DOCA 2AEJA 1EYZA 4EY7A 1V5FA 1X9HA 2IYOA 1E0SA 1WKCA 2BCGY 4FYKA 5CDUA 1JZTA 1P4HA 2WTBA 1QYWA 2OV6A 1XDDA 4UOZA 3E6AA 4A6PA 1ZMOA 2AKEA 2I6SA 1FU7A 1PZXA 3WKEA 1KERA 2XA2A 3G13A 1RVV1 1D5WA 4PN3A 2CMGA 5GONA 4EZEA 4Z54A 1IPFA 2XODA 4UM5A 3FOCA 4JX8A 4F6CA 1QR6A 1NFQA 1PBTA 3QLVC 2WT9A 5A6SB 3KTOA 3H7AA 1QGUB 2ZRLA 3EEOA 3NNNA 2CL6X 2GHQA 4X6YA 2KWIA 3EA4A 3F9RA 3TTVA 4MMZB 5REQB 1NAIA 2PL3A 4CEJB 5M29A 1Q1NA 3ET5A 1WB6A 1XJQA 3UAVA 3UQYS 3AP2A 3C3PA 3CH5A 2NV6A 3KC2A 1Q0LA 4CMEA 4FP9A 4UNQA 4BJ5A 5HJEA 2CHGA 4UCFA 4R0MA 3MQ4A 5HF5A 4TV9B 9GPBA 1GRVA 3HZZA 5LDDC 2WJHA 1RYZA 2DRIA 3DD5A 4NFSA 2ONYA 4EUEA 2VATA 4GXNA 3RJ5A 3QKRA 3T5PA 4INPA 4UDYX 1H8EA 3EOBI 4QTYA 4M1SA 5ER9A 1YB2A 3AVXA 1SRQA 3IP3A 5JMPA 3FAZA 5EGNA 5D5QA 4RZQA 3GP3A 3Q0TA 1BHQ1 4RZ3A 1QHHA 2Z98A 1F5SA 1SB9A 3CPSA 1QIMA 4FBGA 2J9RA 5CIQA 1NXWA 4ZEXA 4BNGA 5JCZA 4EGAA 3FN4A 1QZZA 4IZIA 4ASUA 3CWZA 3DQZA 2M6SA 1DEXA 1PL6A 1KVRA 3ICVA 3S28A 3V8QA 3N2KB 2P3LA 3BREA 1D1PA 3OAAA 2QVGA 4ZCMA 4NS1A 4PLGA 1ZZEA 4WA7A 2FWAA 1AXRA 1ES9A 1NJ8A 1C0KA 3CJQA 3U3OA 5IVKA 2VO1A 4ZO8A 4LFCB 5DNDA 3DW3X 3BEDA 2C2MA 4P36A 4QSHA 2MSEB 2WYHA 1W29A 3FWHA 2J4CA 2Q1YA 2QR2A 1PJTA 3FWYA 3L8YA 2BMEA 2WDZA 2UVPA 1IN7A 1YE8A 2BGUA 3WQQA 5A4FS 2D3TA 1LQ2A 2CW5A 3PDJA 2Q3FA 1DU4A 1Q7RA 2F7SA 4TKVB 2CBXA 5FLKA 2PZJA 1CFJA 4IF4A 1OIXA 2ZSEA 3RPEA 4CQMD 2JA2A 1CQZA 4M22A 3GARA 4AY6A 4RJ2A 1FNCA 1PD1A 2P0AA 2QXYA 2R7LA 3L5OA 2ZI9A 4X7PA 5U4QA 4R1UA 1N2CB 4TPKA 1K5HA 3LPDA 2FDXA 4QPCA 4U0JA 5DI3B 1J0XO 1XALA 5DEOA 1HE8B 2HJGA 2V9CA 1NULA 3BF8A 4F5WA 2A5FA 3IQZA 4P80A 4XTCS 2VDLB 4MLCA 3Q5EA 1V3TA 2HZ7A 4XM2A 3ZKWB 4KYUA 2F59A 4UPEA 4U7HA 1MVOA 2VP5A 3L5KA 1QFSA 2FZCA 2P0EA 2P69A 5LP6F 3TLYA 4BV8A 3H1TA 5LMNB 2G08A 3WBBA 1S8NA 4QTZA 4RNCA 1FFWA 2R8OA 1GTG1 3G0HA 1P62B 3O38A 3QX7A 2OFWA 5D87A 5JISA 1HDIA 1E9EA 3H9JA 4B09A 2PH1A 3N59A 4R71A 5LP1A 2HK7A 2QJOA 3ZZNA 2B3DA 4NCNA 5IBRA 3W1VA 1P5JA 4PAQA 5LP6A 3ZXSA 2FPIB 3DO8A 1CXZA 3NKLA 4YCBA 5LWHA 3WXBA 1QO9A 3OU7A 4WW0A 4V0SA 3T5AA 3ND8A 2GXSA 1M2VA 1EE2A 3GJ6A 1P0IA 2ODTX 3VFDA 4TMZA 4TMWA 3DG9A 5CVEA 4Q34A 2R9VA 3D4LA 2K7FA 2JB9A 1JSXA 2WJPA 2XMGA 2PT7A 1THTA 4BO4A 2V45A 4M9CA 2FH5B 1U7PA 3RVSA 1SZDA 4B6GA 1IAQA 1CDZA 2PXXA 3OIGA 1BDIA 4DLLA 3WMWA 2ZTSA 3C5CA 4MQ5A 2B6NA 1ISGA 2HMWA 3IS3A 3LZ6A 1SU8A 3FVVA 3KQWA 1J39A 2W6PA 2LKDA 4AM8A 4OJMX 1OAOC 4D9MA 1R4MB 3H2JA 1LKZA 2QV7A 3ZXXA 3K70D 1I2AA 5BUQA 2AUMA 2ECOA 1YCHA 3RARA 1Q83A 2NW6A 4I5EA 1YVRA 2GT1A 5CCBA 4ZVOA 1KIFA 3FLMA 2O8EA 2V98A 3ZU2A 1C0PA 1GKKA 4N0MA 1TKRA 4BCBA 5GZ3A 3C3EA 2BCJQ 3T3NA 4W5HA 5EIOA 4CDRA 2RHDA 1J0EA 3STVA 2GCNA 3K6JA 2P5YA 3C5VA 3K31A 3CNNA 3G7UA 4ZEMA 1Z17A 4DV5B 2QM3A 3H87A 3DFMA 2YS7A 2BM9A 3HDVA 3LO5A 3IA2A 4QOHA 3U4IA 5TVKA 3VPSA 1F14A 2VDUE 4J9UE 5IAOA 3X1MA 5ENVA 1CTQA 1EP1B 4Z51A 3EXIB 3R6TA 3GELA 3UJNA 2WJJA 3A6PC 3TBFA 1PNQA 1S1MA 2LCIA 2VDOB 5EZ6B 1QDUA 3LDAA 4YIHA 1V26A 2DT8A 5IZCC 2PUBA 4X95A 1SUEA 1PDOA 2IYAA 3U9TA 1CQPA 4IO1A 3ZPXA 3LQFA 4J16A 1ZJ6A 1OLOA 4JYZA 3N8NA 4XCQA 3ENVA 3PX7A 5BN5A 5AUQA 2VK8A 2ZPUA 4KYTA 5DDIP 3SVLA 1ZCBA 2OYSA 4BNJA 3F6CA 1AZLA 4B7ZA 5E1DA 1NW7A 3IELA 1KYZA 1MO2A 2ISCA 2PEYA 2YWCA 5AJYA 1BIFA 5CBPB 2I62A 4K0RA 1FW8A 1S2NA 3OEWA 1IQUA 5K3OA 2WP8J 4AYXA 3IHLA 2ZBPA 2J9ZB 2PSFA 3O03A 2G09A 2ENUA 1OU4A 2VZ8A 3OQVA 4KXYA 4WNCA 3KPVA 2J30A 3GVCA 5FI3A 3DT9A 3U62A 3FDZA 5JD5A 1D7AA 1MKYA 3LBNA 1E0DA 1MG0A 1M5TA 3IQXA 3OLYA 4WERA 3V8MA 1T3TA 2DWQA 4UFPA 1KFCB 5K0GA 2O3RA 4RORA 4D80A 4EKGA 1G2QA 2F3UA 2PK3A 5AJTA 1JA0A 2IPNA 3OZRA 4H4CA 5FBKA 2P6NA 2QQEA 4N5DA 3M33A 4TN5A 5AXDA 1XD2A 3UKJA 5LQJA 2PQ0A 1G9TA 4W99A 2BFCA 2HWUA 2EIXA 3CB2A 4W5JA 3JATB 4C0WA 1YWGO 1QIJA 2ORED 2PIAA 1KMQA 3HHEA 5F7ZA 3WSWA 2XT6A 2OQVA 1FDTA 2FMTA 1AF4A 1JKXA 2Q8NA 3LBHA 3UMJA 5CEJA 5HQ3B 3IT0A 3FMGA 1CC1S 2Q2NA 2TMGA 3KKMA 3VHQA 3ER9A 1ZD9A 1VL1A 4M6WB 1B6TA 2BEVA 4RGYA 2HBQA 3S40A 3TBKA 3B5EA 3LDGA 4C4XA 3HLTA 5F9HA 5HVNA 5EZYA 2WHXA 3WGHA 1EVJA 1RXCA 4HYEA 1FFSA 2HMAA 1ZY2A 4RS3A 2IXAA 3V48A 3DEJA 1HKHA 2VHUA 5I3ZA 1IY2A 1J9ZA 1L4MA 2B8WA 3Q6MA 2P2DA 3RH0A 2HA2A 2HAEA 4TMTA 2B83A 1SOMA 3KAKA 1VA4A 2J7PD 5D3MB 1G3MA 1SUWA 2G25A 5COQA 4Q93A 1SELA 3JVVA 1L2TA 3TIFA 3TXAA 4YBZA 2Y92A 2GFIA 4Q1FA 4OU4A 3IVCA 1PI3A 4XUGB 5B30A 5JANA 1T4CA 3CN9A 4IGFA 4QC2A 1XTBA 2OBXA 3FPSA 3JD4A 1S3GA 4NZ9A 4B31A 4D9EA 4PLYA 4EL5A 1PFWA 3JPWA 1HLFA 3Q40A 4PLVA 4A1OA 4M54A 1ECGA 5BSEA 3JSAA 4XIFA 3T54A 4R5HA 1I2BA 1WEHA 2JFXA 1L5RA 3GFRA 2MMGA 5LUBA 1ISIA 1N6RA 3PLAE 3BCHA 4FDMA 2XIJA 4JT8A 5AVKA 3TRDA 4JOSA 1W6RA 1MN6A 3ZK8A 3FF1A 3KXLA 5A02A 2B9VA 3I6BA 2XBMA 1UKCA 4RFSB 5DYIA 4LZZA 4QFBA 4Q7JB 4UTOA 1JDSA 2DQKA 4XWAA 3SYNA 1MHTA 1R0SA 3U09A 3G3EA 3I12A 3A1DA 4HEQA 4I1UA 3QKTA 3RS3A 3WLSA 1CYEA 1JG6A 4HL6A 1UBSB 4Y2UA 2XCSB 2G36A 5FWAA 2QKYA 3QYPA 3UY4A 3AFHA 4DBVO 1TT7A 4RXTA 1CKEA 1W0JD 3H0KA 3QVMA 1RRKA 2X8LA 5EQJB 5PGMA 4AQYB 4OHFA 1U6KA 1ULHA 4LE0A 1SM4A 5BYKA 4QA9A 5H1YA 1P9WA 3CURA 4HRYA 3AFOA 2VXBA 1XKQA 5AK5A 2CUNA 1U4NA 3PHBE 3HR4A 4FC7A 3LQRA 3ZIUA 4E14A 5LNK1 2D00A 3HFJA 3AFGA 4CTMA 3IVGA 2XCTB 2Q6OA 1EGHA 1A8SA 2E9SA 2EZ4A 2JCYA 3FD8A 5EYPB 4LXYA 3N74A 1GRQA 3ZY4A 3IV7A 4KVAA 1T0UA 3X1XA 2QJWA 1ISRA 2ATIA 1ACMA 4AX8A 3B8EA 4F4JA 5BRJA 2IHNA 3L7NA 1HDGO 2IHZA 1PGOA 3HBMA 5G53C 1WP9A 4ISCA 1WBBA 5FP0A 1B15A 2CXPA 2WJ4A 5SZIA 3HY6A 3O82A 2DPYA 2QGNA 4DLPA 2OCAA 1XGKA 3KHKA 4LC1A 2O2CA 1V39A 4FYWA 3U4GA 3WYAA 3TAXA 3C24A 1FY2A 1QG4A 1P1CA 1X8KA 4N5LA 3E70C 5LCXA 2FSVA 2UUCB 2QBYB 2RHOA 3D54D 1L4KA 4V0OA 1EUQA 3M6XA 1ULSA 1JHDA 4OAOA 3UGJA 2C31A 2HRBA 4J90A 1E6LA 3HHPA 5FWXA 2Q5HA 4FINA 5DT9A 2BFNA 3D1LA 3FOEC 4N0EA 4X66B 1G8HA 1SQFA 3QLUC 1IVNA 4Q82A 4AZ3A 2GKGA 4UM9B 1GTZA 3TI7A 1B41A 5JNRA 4B35A 2V54A 2WHPA 1NUAA 1WE2A 3TDKA 2NO1A 4DY4A 1M0WA 4K40A 4JXXA 3DW1X 4WN9B 1DAEA 1F6WA 3F6EX 4OYHA 8ADHA 3QTTA 5G40A 1P29A 3UYKA 3SVTA 3SICE 2XITA 4MRVA 2JBHA 1BO6A 2PU7A 1GG9A 4FOLA 4TT3A 4P33A 3VDXA 5A3RA 2NP6A 3I9JA 3ICOA 5DLYA 4QUJA 1M1ZA 1XL1A 1DMSA 4A8HA 4EW2A 1NXXA 3EFOB 4RELA 1U2GA 4NU6A 4J0EA 3D3QA 3IH5A 3ZWWA 5B3JA 3QFSA 2QSYA 4WASA 2XB9A 2WQZA 4B6PA 3RKRA 1E5VA 2IW1A 2Q62A 3OETA 3W9BA 2ROQA 1CY4A 4PZZA 4MLZA 3RYFB 4YDSA 5G02A 4V0LA 2AG0A 2HSZA 4QBKA 3K0SA 3EGEA 1XYYA 2E6UX 5DBHX 4DJ5X 1CZRA 4PXYA 5EJ5A 4CL8A 3FOAA 3LHDA 3HU1A 1FLVA 2WWIA 4MPTA 4YP6A 4RSGA 3WSVA 3I05A 3UAGA 1UXIA 1YDGA 1H05A 1Q1BA 4IIXA 1EXVA 1T3GA 3PHGA 3SHWA 4CMIA 5LOVB 2ZRIA 3PDUA 3T41A 2OCIA 1X2BA 2R8YA 4URFA 5T8KA 5CLHA 3VH3A 1MJFA 1I3LA 2REOA 4MDHA 2GLXA 4AP5A 1DBPA 2DWUA 2QRNA 5KVQA 2DSNA 3JY6A 2QLLA 3VZPA 4AB1A 1Z7EA 4JSYA 4HDNB 2FK8A 2XCOA 4L8VA 3DDUA 4B1FA 2IZ7A 4MYDA 2WMYA 1E4VA 1ORHA 3LF2A 5I48A 1U5BB 1GPYA 3DWIA 5G0SA 3BMXA 1AURA 2QVCA 4EBBA 2CV1A 4P2GA 5ANRB 4GZ6A 4L4ZA 4NKRA 1JYSA 2DQYA 2VS1A 4R1NA 5KWSA 2WVJA 5I01A 1PWYE 5AJHA 1N6OA 2DWOA 3RRFA 1OXSC 2QE7A 1SCNE 1ZN9A 2FFHA 1O94D 1L0BA 1J8QA 2X5XA 1FFAA 4QYWA 1T0JB 5AVOA 1FYEA 2JLSA 1VKOA 4P86A 3IV9A 4B44A 3DXYA 4C6TB 3EVBA 4P5EA 1DBVO 4CCWA 4CDGA 3U19A 3MWJA 2BFWA 4BLUA 1NHWA 3IUQA 3OEHD 3BK2A 3MOSA 4NY1A 4ZC8A 1L7XA 5HCIA 4MIYA 4XJVA 3UAZA 3T3PB 3EH2A 1I0ZA 2NU6B 1V1RA 3SGLA 4LEIA 4B4KA 4DWOA 4QGFA 3ERCA 2Q4TA 2X77A 3RBXA 3V2HA 4B6RA 4BDSA 3AHHA 3EVEA 3SKXA 1OLUB 1O2DA 1GU1A 5G41A 4FB5A 4GOJA 4AF6A 2CGEA 1W30A 5AW6A 5AJZA 4ANFA 4XWGA 4ESVA 4GE3A 3PPIA 2EDAA 2P8JA 4ZV9A 4F97A 1W2WB 3SR4A 4U6SA 2N1MA 3FFXA 5BMVF 2K87A 1Q0SA 3L0ZA 5JEDA 1UBOS 1I6LA 3I01M 4I2NA 3EAGA 4XCVA 1IXSB 2R11A 1N5OX 3KAQA 4HS9A 5ELXA 2NV2B 4N8EA 1JS1X 2H4WA 2BLLA 3H05A 2YXLA 3HVUA 1WD7A 1SBHA 3NIFB 5FOWA 3CNQS 3DP9A 3VQTA 2QV0A 5AQEA 1BAPA 2ZRCA 5BMVA 4D9KA 2FFAA 1I1QB 4EF6A 4NECA 4BJHB 1KO8A 3PKZA 4NBWA 1GLNA 4PEVA 1KY5A 2DOKA 1YULA 4B3IA 3VNVA 1NXSA 4LBZA 3ND7A 5JMWA 2WJYA 1PT5A 4CXMA 2EEPA 3IUEA 5DWQA 3REQA 2HF8A 1HOXA 1NYRA 1YONA 3KQQA 4LZJA 3O1JC 3SC6A 1RLJA 2BFFA 3V5NA 2GN6A 2IJGX 2OOKA 3Q2IA 5T4EA 1MB0A 2QX9A 2A8YA 3KV1A 3NTRA 3LL4A 4I36A 2ZU0C 3BA1A 5CJPA 3H42B 5GAJA 1Y3CE 1I7DA 3RVBA 4TM8A 1BVUA 1XTVA 2JLRA 2XADA 3K8ZA 3ABIA 3KSRA 4MMXB 2GR9A 5TT1A 4K6FA 3TX6A 1K6MA 5HFJA 3PFIA 1TC1A 1CBUA 1UADA 1FP4A 4L5IA 4K9SA 3DFKA 1CVIA 1C3OA 4F4FA 1CSEE 2OMKA 4YCMA 2NACA 2C7QA 1MT3A 1X86B 3LK7A 2OCXA 2UZ0A 1X39A 2ZJFA 1F2UA 4P4NA 3ZDBA 4BUJA 4LDJA 1Z83A 3AEUB 5DHPA 1TM2A 4OKNA 4G24A 1FE8A 1YU9A 4ICIA 2HI0A 2AC7A 2QSUA 1G6Q1 1ZU4A 3GRKA 3GW8A 5FWYB 4C7MA 5EE9A 1MOZA 4YRPA 1HLGA 3K0EA 4IZ6A 3R7DA 4MARA 3NBKA 3L7BA 1VCIA 4BAGA 1JGTA 1YS7A 2FPOA 2V8BA 2X6RA 3Q41A 1XZQA 3WKDA 1S5PA 4BLQA 1Y1LA 4C2BA 5JHGB 4MVWA 5JV5A 1YQWA 3JAWA 2WSBA 1SFRA 2ID7A 4ZMBA 5IUKC 3PPYA 2XZLA 4TUYB 2CEKA 4C1BA 5ICEA 3DPSA 1P6UA 1P8AA 4ROSA 4PRYA 3AHIA 3BWDD 1FJXA 1O6FA 1VCNA 2NYRA 2F48A 4HFNA 5CFOA 4QOJA 4Q21A 5GJVC 3UJAA 3TOCA 2JFNA 3E9NA 2GAFA 3NHKA 2W58A 1SXHA 2P27A 4TV8F 3SHTA 3ZE8A 4A91A 3JQDA 3RAFC 1TMGE 2WSIA 4EVRA 1CQJB 1ZAYA 1PEYA 4QZVA 1F5NA 4WIAA 3PL1A 3R24A 1KTIA 4BLPA 2UU9B 1XJCA 5CT6A 3FPCA 3DAFA 4EQ6B 1DQSA 2VZ9A 4JGBA 4JT2A 1P4GA 4ZA2A 1ZA1A 2Q0XA 3AVWA 4ARUA 3VSAA 4HVLA 4X84A 4TV8A 3W90A 2V58A 2AMLA 3DL7A 5HF6A 4D3ZA 5DLPA 1G18A 3MC1A 3JVIA 3DDCA 3G5UA 4X1KB 1NJ1A 5AKGA 4L8YA 4MV0A 5A2GA 1G60A 5IXSA 1W36B 2ZUDA 4DOMA 1FRQA 1KAHA 1CZOA 4GG1A 4ZAVA 4E70A 2LIVA 4LJSA 4CJXA 3PFHA 1H1DA 3FWPA 4EZIA 1HTWA 1QKIA 4CIXA 4ZK2A 1GFIA 4V2IA 1KFEB 2IS6A 2HU7A 4R1PA 3W6ZA 5KWJA 4Q1BA 5AR1A 1XKTA 1Z47A 2O1SA 3I34X 3JWGA 5CH8A 4M9RA 4FQ5A 4AZSA 2OFPA 4EHIA 3HO1A 4A36A 3GL9A 4CV3A 4KWHA 4RACA 1TU4A 3I92A 2SCUB 5FV7A 3N8IA 3L1JA 3PRJA 4M98A 1BOOA 2WKRA 4OLJA 2RGXA 4J3NA 3J7AC 4DA7A 5IZ4A 2W6IA 5GV8A 4XDHA 3N2GA 3ZU4A 1KMMA 4D96A 1P2VA 2VSNA 2YWFA 4ZVQA 2AI3A 3KJZA 1GGJA 4DCTA 1EDOA 4DNXA 1DKNA 1G6OA 2FE4A 2V65A 3KSAC 3GFGA 1IOLA 4C2TA 1N3IA 1IHYA 2JJMA 1E89A 2C2ZA 2OR3A 1P9NA 1Z5WA 1PJZA 2PYDA 3BHMA 3ECCA 1FP2A 5AM4A 1VLLA 5F73A 1WXGA 2GN4A 3GNQA 5I5EA 3RG8A 2DKOA 5FO0A 4ZGBA 4F4DA 1UT5A 2H2IA 5H82A 4F6RA 1CIPA 2HT1A 4DUGA 4PLZA 1R0XA 3A58B 3ZJ4A 3CZCA 2EKPA 1JQEA 3CW8X 3CLUD 1GGVA 4J1SA 4JLDA 5P8WA 4IIVA 1BA3A 4NYIQ 2A88A 2O0KA 4HEJA 3P9SA 2Q6IA 1XF9A 1ISSA 4F04A 1J1UA 4MH0R 2I8LA 1M1XB 5HIAA 5JADA 1MO4A 2VTDA 2PZBA 1G6KA 4IVRA 1R9MA 4AJOA 1EFTA 4QNMA 5TQJA 2OESA 2C0CA 2FRVA 3RKSA 2AQIA 1MB4A 1AQUA 1D5CA 1JPUA 2BR3A 5FBVB 4GLLA 5A3VA 4IEEA 1M7BA 4CLXA 5K3SA 2I2XB 1U7OA 3LRTA 4ZQIA 4B47A 4BFXA 3OSUA 3FLBA 1PUIA 3C1AA 2AFVA 3ASZA 3G8AA 5ICGA 2EJBA 1JIXA 2W2NA 1QV9A 2WUGA 3MPOA 3MFQA 4IMPA 4JENA 4RXMA 5ALYA 4EPTA 1KZ9A 1O54A 1XLVA 4ESOA 5JSZB 3E0XA 4B4VA 1Z7YA 5EPEA 2Q5FA 4LGVA 4R1MA 1P7WA 1MV5A 3OUUA 4NOJA 4IDGA 5KI6A 4ZRMA 1N0UA 1C9EA 1LI5A 3VI3B 2PVSA 3NC4A 1ZI9A 1WEKA 1EK0A 1P39A 5JS6A 5A0TA 4M7PA 3GMSA 3K71B 1KU0A 4PYKA 3Q5DA 3HR8A 3RUIA 3V42A 4H15A 2NO0A 1T2AA 3QHQA 4HVCA 3S8EA 3RVKA 2C2HA 3VTKA 1MB9A 3PXGA 3FCCA 1YL5A 4EQZA 1K7YA 3DTYA 1Y7IA 3NIWA 2AUNA 4NHEA 1U7DA 4X63A 1PN3A 4CKWB 1YNSA 1FMTA 3MXOA 4E5DA 1BG6A 1E61A 2PQ2A 4MGEA 1CERA 2J6CA 2QNBA 2GPNA 1SPXA 4FBLA 1LPOA 5F51A 3CF4G 2OYCA 1DBQA 2EJUA 4QYIB 1A88A 1CZUA 3MGKA 4ZK6A 1VPWA 2QTZA 4QQNA 5AW9A 1D4FA 1SU7A 4FEYA 4IWNA 1PF7E 2O48X 2FGKA 4G9GA 2ILVA 3U16A 1SXJC 1ZN2A 4W7SA 3GGGA 4JLMA 3DEKA 2Z30A 4R2MA 2NPIA 5BR7A 1CYDA 5DNCA 3UB4A 2PA0A 1L7BA 1FP1D 2ZUBA 2WPDA 4GPIB 4DUZB 2X9QA 2AD1A 1G17A 4HNVA 8ABPA 1TI7A 4LJRA 3O47A 2B5WA 4I1SA 1RJ9A 4Q1VA 1SGWA 4BO7A 2YHUA 4FOTA 4O4IF 4R3WA 3SMQA 1AMNA 1Z34A 2OP1A 3RBVA 1NBAA 3IBYA 3ACDA 4BAUA 4GX2A 1CIJA 1XRSB 2A5GA 5F21A 4RK5A 4V24A 2F1KA 5KKAA 5KNLA 3UUEA 3DAYA 2OBFA 4DLNA 3CLVA 3AXSA 3BGWA 1J49A 2OBLA 5EZSA 1T29A 1BCRA 1GPKA 1FU4A 1NU8A 1UDXA 3FG9A 4HDKB 4O4IA 4AG6A 2H9IA 2XB6A 4HK4A 2XKAA 2CNKA 1JEEA 1T4GA 4E03A 2G4CA 2GO7A 2OORC 2PZFA 1VBNA 4RVOA 2EKLA 5DXFA 2FR8C 4Q9AA 3PXEA 1RQGA 1Q7EA 3O92A 4GP7A 2REBA 1EU1A 1Y4DE 3COPA 4MWEA 3KD2A 1DKLA 2IOFA 2XOXA 3I45A 5LN1A 4O2LA 1H2YA 1YNOA 5EXEA 4K26A 3A4TA 2NAPA 4B3DA 3MN1A 3P2EA 4CLOA 1SUPA 2A9VA 1MP0A 1RIFA 4NJEA 1IATA 3ND9A 3UJCA 1B74A 5HG0A 3OPVA 4HDQB 4NABA 3RQIA 4YMLA 1RSZA 3IRVA 1HYEA 4A0GA 2EX4A 4L7VA 5KYWB 1ORIA 2E49A 3OWHA 1SCJA 1ZG3A 1K7XB 2FKNA 4L4SA 2QL9A 3RVPA 1DRKA 4HEA1 1OBOA 1X7ZA 4IUYA 1HL3A 4QOIA 1ZW6A 2I4OA 1Z08A 1C9NA 1L4NA 1SXJE 2DUJA 1ESDA 4ZOCA 4IH4A 2O7NA 5IJ0B 1RI1A 3C97A 4KO1S 1LGYA 4KREA 1ID1A 1M0TA 1WDKA 4HI0E 4TS9A 3C3YA 3OX4A 3N2EA 2ZVJA 3DMDA 3DVQX 2BGWA 1EGVB 1TF5A 1Y6QA 2GZSA 1CUXA 4YP5A 3KQLA 2O8FA 2G63A 5T5QA 2HXGA 4NYJQ 2VP9A 1QIFA 2CEAA 2YJZA 3HJCA 3UTCA 7YASA 1E77A 3PNSA 3LD9A 3A9UA 2GN1A 4JVMA 4QBIA 1NGSA 2WAOA 3QLJA 4I1VA 3B1ZA 4Z6KA 2XZPA 1GAXA 1KU6A 1KYTA 1XAHA 3C6ZA 1M8KA 4JSRA 2XKBA 3HKEB 2EDCA 3AR6A 4PZUA 1JIVA 4MJXA 3BD7A 4C88A 3JQ9A 2FYTA 4LWOA 3RABA 1EZ1A 5H70A 1ZKMA 4DILA 3B78A 5KNCD 2C94A 2V5VA 2EKDA 2EXXA 3EXG1 5KYUB 3ESQA 3IDOA 1WXEA 3IIIA 1YGYA 3KKQA 5JJBA 3BG5A 1H6BA 2SKCA 3O3CA 4FHGA 2QW1A 1I10A 3G7NA 4KDFA 4RW0A 3DXFA 4F5ZA 1YVDA 1DXOA 4H1VA 5I7SA 4MI9A 1N6HA 1XBTA 1W87A 2QE6A 1VSTA 4EHDA 4W7IA 1T5TA 1M2GA 1O95A 3E9MA 3K9QO 5B7QA 3ZWXA 3AOEC 5EWMB 2V6BA 4YALA 1DIAA 4BMXA 1D6SA 1I6KA 4LX0A 1UJMA 2F3SA 1MC5A 1YJCA 1C2TA 3CUEF 1C4XA 4URYR 3VSCA 4AZTA 4ZHQF 3UMYA 4EJ0A 1TVKB 4I55B 4PZPA 1Z6YA 1BVYF 1T5DX 3FJYA 2B8TA 3WHIA 2PIDA 4ZCRA 5A06A 1SA0B 1T9CA 4F7WA 5C5DA 5H5JA 3H3XA 3FFWA 2DHDA 4NS4A 4OHWA 4ZTUB 4UD2A 5JSYA 2HPZA 4WXPA 2WPNA 4DBZA 1TZKA 3D6TB 1F4VA 1G9SA 4QQRA 1G59A 4CFYA 3JAKB 1GM5A 4KHPB 4JNKA 2IYUA 4GP6A 4KQIA 4ZHQA 2FB9A 1KMHB 2GXUA 2JAUA 2YRFA 1V11A 5EFZA 3SIXA 4EG8A 2IXEA 4ND1A 1T91A 1UXOA 3CA8A 4D8UA 4Q00A 2GD0A 1UMDB 2JGIA 2JZOA 4KR9A 4GZ5A 5IASA 3T7DA 3RFTA 3V7NA 1PZNA 2EVWX 5DGDA 2ZPTX 3L7DA 4WNAA 3TFWA 4LY0A 4JL5A 1AUVA 1R18A 2HJWA 5HF8A 1YIAA 5J2TB 3BYZA 1JKMA 1HE5A 4C5AA 3C1UA 1I1HA 1YS2X 1T8WA 1ZAKA 2B5VA 1KVSA 1M2WA 2D13A 2VAWA 1E2DA 2VQ6A 2OT3B 4BUCA 1CNEA 1JLMA 1WMDA 4EPYA 1H94A 4PFSA 3PHLA 1SAYA 1E2MA 2PYZA 2I99A 3HB4X 5HM6A 3HY4A 4AKGA 4MV3A 1NI5A 1N2SA 1W0KA 1BFKA 2C8LA 5ERXA 5FR1A 1MDBA 1C30B 4WXEA 3UEOA 4PG8A 3FNGA 3BTSA 5AVXA 4EF5A 1MA0A 1Y4AE 3S1LA 3FRJA 2DBVO 5E6UA 4C0SA 4KFSA 2Q29A 3IEXA 1VGRA 3FSGA 3AIKA 2PA3A 1JPNA 2VHVA 3KS9A 3LWBA 3PGLA 4RC9A 2XUGA 4CHGA 5KU1A 2GF2A 2HU5A 2R00C 4Q3LA 1QO7A 3EXFA 2Y1GA 4URZR 2ZI3A 2AYXA 2Z57A 3EF0A 3KELA 3PDCA 4RE6A 1RE1A 3LPCA 4B2IA 5JAOA 1IOZA 4HUQB 4PYIA 2XRFA 4WFIA 4WY8A 3WBJA 3NRCA 3UMVA 3DS8A 5HUQA 2G8LA 3TQIA 5CVUA 4DMLA 1VE1A 5DP1A 5HRCA 4MEJA 4O63O 3BKWA 3ROTA 3DP7A 4QXOA 4A03A 5KEIA 1D04A 3F6RA 4HHEA 3U6BA 4RHEA 4QAQA 4GICA 3V8EA 4CMAA 2MSCB 3OLWA 1W5SA 3FTDA 1Q3TA 1ZKDA 2C9MA 2ZANA 3R7NA 4FOPA 1R9JA 3MWEB 4H77A 4J07A 3PDIA 5TIIA 4KE8A 3FHCB 1R15A 2C97A 2C5GA 4P7JA 4JKOA 3PQ6A 2EF0A 2WZCA 2JKVA 3MUFA 4UUPA 4Z4CA 4UHCA 2QPLA 2D7CA 4LAFA 2O0LA 2BKAA 3R5SA 1D2EA 1N5JA 3FZYA 5TC4A 4KX3A 1BMFD 1VBMA 2NXCA 3WRWA 1A7JA 3LC7O 4PTLA 3PNLA 1MFPA 2YIDA 3A8TA 3OPNA 4X8LA 3IHTA 3ETGA 3V1MA 2OXCA 3G6WA 4N8SA 3MGBA 3TQSA 1NOKA 3UA4A 2R47A 2X0RA 2A2ZA 2P2ZA 1IUNA