3S1LA

Crystal structure of apo-form furx
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
339
structure length
339
Chain Sequence
AMMKAAVVRAFGAPLTIDEVPVPQPGPGQVQVKIEASGVCHTDLHAADGDWPVKPTLPFIPGHEGVGYVSAVGSGVSRVKEGDRVGVPWLYSACGYCEHCLQGWETLCEKQQNTGYSVNGGYGEYVVADPNYVGLLPDKVGFVEIAPILCAGVTVYKGLKVTDTRPGQWVVISGIGGLGHVAVQYARAMGLRVAAVDIDDAKLNLARRLGAEVAVNARDTDPAAWLQKEIGGAHGVLVTAVSPKAFSQAIGMVRRGGTIALNGLPPGDFGTPIFDVVLKGITIRGSIVGTRSDLQESLDFAAHGDVKATVSTAKLDDVNDVFGRLREGKVEGRVVLDFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Furfural reduction mechanism of a zinc-dependent alcohol dehydrogenase from Cupriavidus necator JMP134.
pubmed doi rcsb
molecule keywords Zinc-containing alcohol dehydrogenase superfamily
molecule tags Oxidoreductase
source organism Ralstonia eutropha
total genus 110
structure length 339
sequence length 339
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3s1lA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3s1lA01
1GY8A 4Y67A 3I9OA 3PGJA 1TB4A 2CZCA 4XCVA 1V3VA 2E37A 1DIRA 2J5RA 3DZFA 1F8FA 1TXGA 3S2IA 2B0JA 1K6XA 3P2OA 3K73O 3PDJA 2BLLA 3MTGA 5BR7A 2WE8A 5F3RA 1Y8QB 1PGOA 1GPJA 4ZN6A 4HXYA 4IMRA 4KWIA 3ZU3A 1VI2A 2G17A 2BI8A 3JQ6A 1KYQA 1Y5RA 2XPCA 4LGVA 3V1TC 1GL3A 4E5NA 1IYZA 2DU8A 3GAZA 3WGHA 1ADGA 1PEDA 3MJ4A 3WJ7A 4I5EA 4WLFA 4FR5A 3VTFA 1D1TA 1IPFA 4DBZA 4KDEA 3OF2A 3BA1A 4R69A 4FS3A 3IQDB 3K96A 2W2KB 4MINA 4Y6PA 3ULKA 4RPHA 1FK8A 1SZJG 5FFFA 4JP3A 3TZKA 3R1IA 4J6FA 3DBHB 1NP3A 4CM7A 2YY7A 3AUUA 1MB4A 3ZNQA 1K5HA 3EMKA 1RJWA 1O89A 1QYVA 3I6QA 2X5KO 2VNSA 1BRMA 4YCAA 4OSOA 2DBQA 2EGGA 3UUWA 3EZYA 2VZ8A 3AU8A 4ZQEA 4XYLA 4NFYA 4MP6A 2GF2A 4YXFA 4IDCA 5ILOA 4RDHA 4IIUA 4W82A 2ZQZA 1QYDA 4DLLA 3IJRA 3OEWA 4NR0A 3F46A 2NVUA 2IXAA 4EJ0A 4ZGWA 4R41A 5A05A 3E18A 5C7LO 3F5SA 4CM9A 3WWYA 1R6DA 4Q3NA 1JWBB 3DZBA 3DOOA 4U8GA 4B7UA 1NWCA 1C1XA 2VHYA 3KEOA 2Q99A 3F4BA 4IDFA 4CLDA 1YRLA 1N9GA 4NZ9A 1LRJA 3DOCA 1VKNA 3GN1A 4YAJA 4TZTA 4E0BA 5IZCA 2EWMA 4B3JA 1UDAA 2BMAA 4BNNA 2BRUA 5DN9A 4LMRA 5THKA 5TLSA 4Y9DA 4BNFA 2WYUA 4XZ3A 4RVHA 4CLOA 2FR0A 5J23A 3I3OA 4UAGA 4BO5A 4CM6A 2XF8A 1KEVA 4EJMA 4PG4A 1JVBA 1JQBA 2VT3A 4TMFA 1P33A 4I9HA 4CV0A 3A06A 3M1LA 3HUDA 3EZLA 4XR4A 3M2TA 4Y98A 1LI4A 1FXSA 3FPLA 3MJCA 1TA4A 5G0VA 1I5RA 3JQAD 1OC2A 4D3FA 3GEDA 2FP4A 3CZRA 3GZNA 3PK0A 1KVQA 1O95A 1YL7A 2I76A 5TX7A 3VDRA 3GVCA 1U28A 3BHMA 3INTA 1V3TA 1V6AA 3JSAA 4IM7A 4RVSA 3H9JA 5CDTA 5G4KA 3ENKA 1L1FA 4AFNA 4CV1A 1NAHA 4HWKA 3L6DA 1CYDA 2FMUA 3EGOA 1TVEA 1JW9B 2FR1A 3DC2A 1UR5A 1VC2A 3CIFA 1EVIA 4ZICA 2YDXA 1YE3A 3AFNA 4MO2A 1KEPA 2Y68A 3V5NA 2Y1DA 3WYEA 3ZV3A 5JAZA 4CR7A 4BGIA 1YQDA 1BXGA 1IPEA 1E5QA 3VPXA 4MP3A 3RCBA 3H7AA 1ZSVA 3HWRA 3DZIA 1NASA 3AW9A 4DPLA 2JFGA 3RJ5A 4Z3KA 1Q0HA 1E6UA 4CMJA 1EBUA 1EMDA 1FDWA 1H9BA 2NVWA 3GDGA 2B4TO 4LN1A 5JMWA 4IJVA 3KLPX 1AXGA 3BMNB 2WTBA 3QWFA 1R4NA 4XGNA 3MOGA 2YV3A 3ZU5A 1UAGA 2VCYA 2OL4A 2PH3A 4XQCA 2FRDA 5KVCA 3O38A 3RC7A 4E5KA 1A72A 4A26A 4RPJA 1HLPA 1QLHA 5BNTA 1OBFO 2HKIA 1PGNA 2R6JA 3PQEA 3D3WA 4GX5A 4BGUA 5EPOA 1U9JA 3HB4X 4IDDA 1SBYA 3I9JA 3JQ7B 4NI5A 3PJEA 5FWNA 3DBVO 1ZJZA 3SLKA 4I5FA 3LF1A 2VUTA 2IXBA 3JQ9A 1BVUA 3JQBA 3OICA 4NQZA 2HUNA 3WG9A 3OJEA 1IHYA 3G0OA 2WMDA 4ND2A 1MP0A 1KVUA 3SJUA 5B4TA 1KY5A 5MDHA 4TKMA 4QEDA 1TI7A 1YB5A 1V9LA 2WD7B 5DBIA 4UREA 3PHHA 2PWZA 5JO9A 3GR6A 3GG9A 3NRCA 2J6IA 1DO8A 2HDHA 2YUTA 2VUSA 1E1NA 4JROA 2DKNA 4WUVA 3ZWWA 2VWHA 4PG7A 1ENPA 4J7CA 4WE3A 3T7CA 2OOSA 4AJNA 3DMYA 4CQMD 5CEEA 3A4VA 4Z9XA 1MV8A 2HK8A 5U9CA 1EDZA 1P31A 4RDIA 2B37A 4YTEA 1BXZA 3GMDA 4QX6A 1GZ4A 2H9IA 1VJ0A 1CERA 4QFCA 1LDBA 3AI2A 1P1HA 1R15A 1FMCA 3H5RA 1DC5A 3A9WA 2GCGA 3PQDA 1ZCJA 5HBRA 3DZKA 2I9PA 1U3VA 3FCOA 1QKIA 4YJGA 4HV4A 3HG7A 3EUWA 4M49A 4O1MA 4BNMA 1PS8A 3QVTA 4NBVA 5F5LA 4OMUA 1WDKA 4OYRA 2VZ0A 3FNEA 5JDIC 3VH3A 2O3RA 1CRWG 4J43A 3VH2A 3DHYA 1K6JA 1Z74A 4CMBA 3RKRA 1DLIA 5IJZA 3EC7A 1GUZA 4GLLA 2HO5A 1RM3A 3GN2A 3JQAA 3MJEA 4OM8A 3LT4A 2I3GA 3DBLA 4IS3A 3LDHA 3G79A 3ICPA 1LNQA 4J7UA 5CAEA 3UICA 3PIIA 4YAEA 5HWSA 5DCWA 1ULSA 4GQAA 3ICCA 1MA0A 2Y0DA 3VC7A 1B15A 1V3UA 2QX7A 5EESA 2Q1TA 1D1SA 3VVBA 2JD1A 1WVGA 3WTBA 1P1JA 2D5AA 1Y5MA 4HNHA 2B36A 2GD1O 1LUAA 5ITVA 4D44A 2BFAA 3I6IA 4B8ZA 5GZ1A 1VJ1A 2BH9A 3PWKA 4DL9A 1Z7EA 3DTTA 3GZ4A 4JJGA 4MKRA 4YT2A 1BWSA 1HLDA 2EKQA 3OM9A 4N54A 3AI3A 5IF3A 2W2LD 3R3JA 2NUAA 4GGPA 5TGDA 1NM5A 4E21A 3U09A 2VRCD 4TVBA 1KEWA 1YGYA 5TC4A 2VWQA 4MVJD 4D7AA 4PRKA 4CLEA 3TN7A 1PJCA 3RC9A 4FBGA 4YJDA 4F46A 2BFOA 4JK3A 4J4BA 4D45A 1E1MA 4A7PA 3OIGA 1HYHA 1BMDA 4KTVE 3WGGA 3AY7A 1N92A 3AI1A 4IDEA 4YJFB 1QMGA 3NDRA 2GN4A 4KTTE 2GYYA 1OMOA 2ZCVA 1NQTA 3UFXA 2B5WA 4I9UA 1ISIA 1ENYA 2E48A 2FSVA 3K2EA 4GL4A 1DAOA 3H6KA 5DF1A 3ETEA 3G49A 4MVJE 1PZHA 2X22A 4YYZA 2EF1A 3BTSA 1ZBQA 3ZWVA 1WLYA 3GPDG 2AQHA 4ND5A 1WAMA 4RZHA 2ZQYA 2DM6A 5KVVA 1ZEJA 2PD6A 4WLNA 4B4WA 5DBFA 4ESOA 1VPDA 1E3WA 5A4DA 2RIRA 2GO1A 2G76A 1N5DA 1SB9A 4WNIA 4HFRA 4OL9A 1ZKMA 2AE1A 3WTCA 2NNLD 2V6FA 3TFOA 1LSSA 4OHUA 3WYCA 4R01A 2YJZA 4DPKA 4WLOA 3RUCA 4WK6A 4O6VA 4KZPA 4XA8A 4GVXA 2VYND 1TLTA 3NDJA 5AXDA 2GUGA 3VDQA 1ISMA 1K2WA 2HSDA 2NU7A 3WNVA 3WB9A 2O23A 3PLRA 2QG4A 1U2DA 2C7GA 5C7OO 4OKNA 6ADHA 1E7SA 4BMSA 1N9GB 4BKQA 3F9IA 1P0CA 4Y6SA 1QLJA 4W7HA 3DOJA 1NHWA 4J90A 1T24A 3QVSA 1AE1A 4KP7A 4O59O 4JN6B 5JAQA 4D42A 4E31A 1NPTO 3U5TA 4B8WA 3GGPA 4MVJM 3GUCA 5C7IO 4CLOB 1Q2XA 3K8ZA 1GUFA 4HFJA 3GNQA 3WSWA 4MKXA 5KVQA 1CEQA 5JBIA 3R3SA 1Y8RA 1OZAA 2RH8A 4BKPA 3WNQA 2VHWA 3OA0A 4JGBA 4WEQA 1BXKA 2P9EA 3TL2A 3AM5A 3KSUA 4ZRNA 5T64A 1E1LA 4OOEA 3B70A 2Q4BA 4O0LA 2XAAA 3NX4A 1DIHA 5ENVA 1TT7A 2ZTMA 3IKVA 1Q7BA 3GZNB 1U3WA 4NU6A 3T4XA 1RM4A 3IJPA 5BNIA 4B4OA 4Q3DA 1VL0A 4YPOA 3ZU4A 1X7DA 2PGDA 3BTOA 4CR6A 4W7IA 5G4KB 1X0XA 4Y8VA 5G2OA 3U4CA 1XELA 1LJ8A 3EHEA 1DFHA 4CV2A 1DRUA 1F8GA 1PGQA 4KUGA 5EQDA 5BT9A 5BSGA 4XIYA 5CDSA 3ZH2A 4YRBA 5IZCC 1O0SA 1OFGA 5A3JA 5KIAA 1PGJA 1WWKA 2X0JA 4UUPA 1YBMA 2GASA 1XG5A 4GGOA 5BSHA 4R5MA 1A4UA 1BXGB 2HMUA 2IZ0A 4RF4A 3Q11A 1LC0A 1HE2A 2W2LA 4CM4B 2D2IA 4YQZA 4HFNA 2C29D 3FBGA 2ZB8A 3RROA 2JJYA 3Q3CA 5T6BA 4UUMA 1NFQA 2X9VA 4GX2A 4PLWA 1VJTA 4MVJA 1DIGA 5JSFA 3DAGA 2PKQO 3MJVA 4JLWA 3W1VA 3VAZA 1ZUD1 1X13A 2NTJA 4XQGA 7MDHA 4MDHA 1IUKA 1I2CA 3I9MA 1U2GA 4XB1A 3WMWA 3ZWYA 3IMFA 1QYXA 1I0ZA 2PKRA 3RIHA 3ST7A 3FR8A 3RUHA 1YOVA 3FR7A 2JFFA 3UHAA 1H94A 2GZ3A 3H3JA 3LYLA 3G3EA 4OXNA 3ZCXA 4L73A 1U8FO 4P22A 4BV9A 4G81A 3KUXA 3T4EA 4BNHA 1Y9EA 4J7XA 3DAPA 2DPHA 2VRBA 2PD4A 3ETGA 4PN3A 5IDXA 2EEZA 3AM4A 4U6QA 2HAEA 3NDIA 4CL8A 4D0SA 5JDIA 2OBYA 3I9KA 4JQCA 2H1SA 3C8MA 2Q45A 3PYXA 1XYGA 1F12A 3WQRA 1EK5A 3HDYA 3JYLA 4DLAA 4NDNE 4AJLA 2Q49A 3IC5A 3AWDA 2Z95A 4ZVVA 2AW5A 4XKJA 3V1UA 2D59A 4H7PA 4FCCA 3V8BA 1VE9A 1L7DA 3L4SO 1NR7A 2CSUA 1PL7A 1E92A 1O9BA 5EJ2A 3IL2A 4BB6A 4Z0TA 9LDTA 3MTJA 4JBIA 5KJEA 4WGGA 3WYBA 1KEUA 1L7EA 1PJ4A 3GVPA 4IXTA 4M55A 4AJJA 3JYNA 1PS0A 2H6EA 2VYNA 4RPLA 4CLXA 4W99A 3WOHA 2QHXA 1NTOA 4XYBA 1SEPA 2Y0EA 2IEBA 4D3DA 2ET6A 1P1KA 4MVJP 2H5LA 2C7VA 1N2SA 2PGJA 4AJHA 1SMKA 1YH3A 2CNBA 4XB2A 1LA2A 2XXBA 3D1LA 3JQ8A 3ROQA 4NJOA 3EYWA 5GZ6A 2WD8A 2UDPA 1WMBA 1NVTA 3JQ9C 1JKIA 3Q9UA 5JNLA 3K6JA 3RI3A 1GV0A 3A28A 1A9ZA 2UV8A 4EJ6A 3PJFA 1EE9A 1DLJA 4W6ZA 1LRKA 4H3VA 1T2FA 1GQ2A 5U4QA 3L4BA 4DGSA 3IIEA 4YACA 1GU7A 1V0JA 5JXWA 2X9NA 1UDBA 3B6ZA 1ISGA 4JJIA 4PZDA 1EQUA 4MKZA 2UAGA 4KOAA 2BGMA 3PHGA 4LCEA 4NJMA 4L4XA 4TRNA 3FPCA 3TDKA 3IDSA 2PZJA 1B8VA 2Y05A 2W8ZA 3H5AA 4N18A 1GUYA 3DWFA 2GPTA 4J4TA 3TJRA 4BO9A 2FPIA 2J3IA 4NBTA 4IGFA 4NPCA 5ICMA 1ZMOA 4FD3A 3TSCA 5BQFA 3AY6A 4GWKA 4Y6RA 1N7GA 2C5AA 3JD0A 4NG5A 5L53A 3VPGA 1FDTA 2X6TA 3LSYA 3NGLA 2BI7A 1B8PA 1TT5B 2YFQA 2O3JA 3QVWA 2X1HA 4PCVA 4Z9FA 1LX6A 1NBOA 4PG5A 2YV2A 2I67A 5F1KA 3LLSA 3CINA 4CMCA 4S3MA 2RAFA 4HY3A 3RBZA 2Y1FA 3WGQA 5A5EA 4YT4A 1T2CA 2PZLA 3GRPA 4L75A 4RQTA 3S2EA 4PIVA 2J3JA 4RO0A 3D4OA 2FPGA 1DOHA 4KMSA 3FN4A 1GQQA 3L77A 3JQFA 4IBOA 3M6IA 3JQDA 4ID9A 4BO3A 2VUUA 1OOEA 2PY6A 3OQ1A 4RPKA 2VN8A 4ZU3A 3DXFA 3S55A 1D4FA 4RORA 4GVLA 4INAA 3BTUA 4IQ0A 2VOEA 1WMAA 4ITUA 2R00A 5IG2A 1MUUA 3FNFA 3CSDA 1XU9A 2VHVA 1GYRA 4BL5A 2YFHA 4YR9A 3HN2A 5HS4A 4BS9A 4EEZA 1LDYA 1FDUA 2F1KA 2YQ4A 2D0IA 2EIHA 2PFGA 5BSEA 1R66A 3LLVA 5EERA 1Z7BA 5COBA 3FBTA 1GADO 1IZ0A 3W6ZA 1DJNA 5B4UA 4PZCA 5GZ3A 2G0TA 1GCUA 2O2YA 3LQFA 2IODA 3ZHZA 1XQ1A 3DTYA 1U3UA 2GN8A 3BXXA 4FN4A 4BKUA 4CUJA 3SBOA 4II2A 1KC1A 2IDZA 4PLHA 2QZZA 5I8WA 3IAHA 3KB6A 2VOJA 3P2YA 1ZH8A 1I01A 4HNGA 2NU9A 2A4KA 1G1AA 1BVRA 4XR9A 3E03A 5IXSA 2VYVD 5ILGA 2NWQA 4EZBA 4BNUA 4CM1A 3TQHA 1E3WB 1ULUA 4ND1A 1KVRA 4FIZA 1E7RA 5G0TA 2I6TA 5A02A 1MC5A 1H5QA 2WSBA 3DAFA 3F47A 1X0VA 3INRA 3PVZA 1LLDA 1NWHA 1BSVA 1JKJA 2Q50A 5B12A 5TIIA 1PTJA 2C54A 5C37A 5L4LA 2Y67A 3G17A 3OBBA 3VKUA 2LDXA 3NTQA 3GLQA 3I23A 1I10A 3KOUA 1F17A 4UVGA 2ZTUA 2XXJA 1JAXA 3LVFO 5IFLA 1R4MA 1RM5A 1XKQA 3ONFA 5AXCA 3FHLA 3RAJA 1GQYA 4YAKA 4BNVA 3KYDB 3PEFA 1A7AA 4YB8A 5TSDA 1I33A 1NFRA 4RCVA 1U1IA 4ZD6A 1QXSA 3DFZA 4IJUA 2Y1CA 3EK2A 3WFIA 4KWHA 1O6ZA 1LQTA 3AOEC 4JP2A 1QG6A 2BHLA 4P4LA 1LSJA 4CUZA 4E2ZA 1R12A 2R2GA 4UVDA 1E3EA 3FNHA 3ASVA 3D7LA 1XSEA 2JHGA 4BO0A 2CDCA 4E5MA 4YAGA 1IB6A 1EE2A 1HT0A 1I24A 4P38A 3X2EA 1M66A 2NV6A 3FD8A 5EL0A 4JCOA 3BTVA 3RJ9A 1BDBA 2H63A 4J2OA 3ADOA 3IKTA 4BGVA 4PRLA 1SPXA 1LXCA 1DSSG 1UP4A 3UCXA 1PJ3A 2I99A 2O3TA 4NFHA 5TRTA 3TFQA 3AK4A 5JFOA 4BNKA 3ZWBA 5IN4A 3GH3A 1EEHA 3FRJA 3KVOA 4TRMA 3DFUA 1YQGA 5JS6A 2RHRA 3GMSA 2E6UX 2JD0A 2NQTA 1MXFA 3ZI0A 3AUTA 5A9SA 4TRRA 3AFMA 3RUFA 4K28A 2Q4EA 4E30A 5L3ZA 4J9UE 4BNJA 1SCUA 1H93A 5G0SA 2X0NA 1H0KA 5LC1A 3NT2A 3WJAA 4Q3CA 2Q1SA 3H8VA 3PQFA 4CUKA 2QZ9A 1MG5A 2QQ5A 2ZJ0A 3COSA 2WDZA 4MVJH 3CMCO 4ZA2A 5T5QA 4IMPA 1U7TA 4BNIA 3FTNA 1ADCA 1PGPA 5DCUA 2PGLA 4MJLA 1HSZA 3QWAA 2JKVA 2O3UA 5H82A 3HSKA 3ORFA 4CMEA 3RU7A 3GF4A 2ZIZA 4HUJA 2VWPA 4M89A 5T67A 2DBVO 4RVGA 3UCFA 5B4VA 4HBGA 3GAFA 4BHTA 5JC8A 2B4QA 3WX0A 1KVSA 1HDYA 4LW8A 4E3ZA 4TZKA 2P4QA 4ND4A 5AXBA 1XLTA 1D8AA 1MGOA 4QSMA 1GYPA 3EDMA 1VRWA 3DZJA 3HDQA 2HJRA 4BNZA 1ZSNA 2W98A 1W6UA 1T1RA 3ZGYA 2EKPA 3GDOA 1KETA 3S2FA 4FC6A 3W8DA 4N7RA 4L4SA 9LDBA 2CF6A 4XGKA 3TZCA 3WLEA 2QRKA 2OUIA 4URFA 4EEXA 1JDJA 3QY9A 4QTZA 4WLVA 1FJHA 2O3QA 1DRWA 1KOLA 3L6EA 5COAA 7ADHA 4UULA 4D79A 1I3KA 3QJ5A 5A03A 1SC6A 2PZKA 3ROPA 2VYVA 3FF4A 1DC4A 1WDLA 1ZK4A 4FC7A 3D5TA 3S8MA 2NLOA 4E5YA 4LSWA 2C20A 4CQLB 3WQSB 3BMQA 4DQVA 4YWJA 3PHLA 4AJ4A 5DT9A 3UN1A 1RWBA 2HU2A 3FNGA 1PZFA 1I3LA 2DTXA 1GPDG 1I32A 1XR3A 3E9MA 4XWYA 4BUCA 3EVNA 1PL6A 1PL8A 3PDUA 4G5HA 5I9NA 1JN0A 3HNPA 1I2ZA 2FN7A 5ER9A 2CMDA 1HE4A 1XA0A 4K26A 3NKLA 4BO2A 5BSFA 1BG6A 1I3MA 3VZRA 4DVJA 5L95A 3PWZA 3NJ8A 3O8QB 4XQEA 3C1TA 2O7QA 4I5GA 4XDZA 3OJFA 5EQFA 3WIDA 5GY7A 1Y1PA 4B3IA 4L4RA 5KJCA 1GAEO 1K3TA 4FFLA 4E12A 1H2HA 3DBRA 4C4OA 2AMFA 4K6CA 4TKLA 4OO3A 2O4UX 3C85A 4FFMA 5I9MA 4D0RA 3ZW9A 4QO8A 1LC3A 1T1SA 3EW7A 3RWBA 4BIIA 4L74A 2ZTLA 3KXDA 3RC1A 1LDMA 1DFIA 2BGKA 1Z45A 1DXYA 3W6UA 1LSOA 3BYZA 4DYVA 4YDRA 3I1JA 1Q0LA 1NQAO 2J3KA 1HF3A 1I8TA 3QRWA 4W4TA 4BNLA 3JD2A 1C1DB 1U4SA 3AUSA 3RFXA 4RV9A 4YQYA 4CLRA 1B16A 3RBXA 1DHRA 2BF7A 3JYOA 3C3XA 5IDWA 4Q3AA 1PWXA 3WGIA 3NUGA 4WECA 2CD9A 2PNFA 2HMWA 2AQ8A 4RLHA 4EUFA 1J5PA 4FGSA 5I7FA 1AUPA 2GZ2A 4M87A 5LDHA 3IOYA 5THQA 1UXJA 2YZ7A 3D4PA 2BGLA 3MJSA 4R4JA 2YHIB 4GX1A 1A4IA 3GEMA 5CFZA 2VNAA 4E32A 1PJLA 3GVIA 4PLYA 1K0UA 2FPPA 2OBNA 3VZQA 4DIFA 2I66A 4LRTB 5LDGA 3SLGA 1VSVA 4QXMA 3SJ7A 4R1UA 2VHXA 4WEOA 3L4BC 4CMHA 3L07A 3U9LA 3KYBA 1QR6A 3WGTA 4A0SA 5F1OA 3DO5A 3OQBA 2RHCA 3GT0A 2NM0A 2PA3A 2C82A 2Y99A 4WJZA 1KIFA 3UOGA 1U8XX 3GDFA 1YO6A 1QORA 3DMTA 4BO4A 2E82A 1IE3A 4JX8A 5KKCA 5B1YA 1KVTA 1B0AA 4BO6A 3TWOA 1C0PA 1N1GA 4I1IA 4XD2A 4D46A 3KLMX 5DOZA 4QECA 1UUFA 2HRBA 2NACA 4JXKA 1ID1A 3PFFA 5CEFA 4DIOA 3D4NA 1C14A 1E7MA 1I2BA 3AOEA 1ENOA 4ND3A 4B79A 4OIMA 3NT5A 1HYEA 4O63O 5COQA 1S7CA 3HADA 1UAYA 5IZ4A 2W90A 4AICA 2EKLA 2QW8A 5CDYA 1ZJYA 4PVCA 3QW2A 2W2KA 4R1TA 2O3SA 3ENNA 4XEHA 3TZHA 3ONEA 3D0OA 3JQFC 2BFPA 2AEJA 3P7MA 3C1AA 2EHDA 3DBHA 3RSHA 2X23A 4JNKA 1NYTA 5IAAA 4LCJA 3GHYA 2B5VA 1AHIA 4NBWA 1EQ2A 4XYEA 2JCVA 5FI3A 5AQ1A 4CQMA 1HDRA 1B26A 2EJVA 2R00C 3CH6A 4NU5A 3CZMA 2NVUB 2OP1A 4EUHA 1HE3A 1U7HA 3PRJA 4GI2A 1I36A 1NFFA 4Q3EA 2DTDA 5I7VA 2PV7A 2G5CA 4U5QA 4XJSA 5DULA 3ZWAA 3PYLA 5JMPA 3JCZA 3GNSA 4KQXA 1C1XB 1E5LA 3GGGA 2X5OA 1IL0A 1P1FA 2EXXA 4E5PA 2D5CA 4A27A 1XIVA 4KUHA 4W9NA 3D3EA 5JAIA 1ONOA 3QIVA 4CR8A 2P9CA 2V65A 1WPQA 2JCXA 3WLFA 1JVSA 4IY1A 3NAQA 3LU1A 4FDAA 4E13A 5EIOA 3IP3A 1A7KA 2X8LA 5L7TA 1SAYA 3B1KA 3PPIA 3X2FA 3F5QA 3H9GA 4RF3A 4A10A 1WZEA 4BOYA 3F1KA 1WZIA 1PQWA 1YL5A 1EVJA 2OO5A 3CKYA 4ZRMA 4EBFA 4UVEA 1J49A 1ONPA 1G6KA 3BIOA 4DTIA 4P8RA 1GCOA 2A35A 3OJLA 3KYCA 2GLXA 4GX0A 2NTVA 2HK9A 1FDSA 5T8KA 4Q3BA 3P5SA 3UXYA 1IZ9A 3VOSA 1P9LA 2ZATA 3PIDA 2AEMA 2CFCA 3ZDFA 5A9SB 4FFOA 2YQ5A 1LLUA 4TROA 4DPMA 4CM3A 4H15A 1UJMA 1PWZA 3I83A 2Q2VA 4P4NA 2FHSA 2WYWA 5DCYA 2ZKLA 1ADBA 1UZMA 4MIOA 3W4JA 3ITKA 3KETA 3DB2A 2AA3A 3OJ0A 4J0EA 3HB5X 5JDCC 4BO1A 1VSUA 4OQZA 2QYTA 1SB8A 5A9TA 5JPIA 1HXHA 3UCEA 2Y66A 2AG5A 5KJFA 3OIDA 4YT8A 3P19A 2HRZA 4YVFA 3SXPA 2P68A 2VRCA 4R51A 3ANLA 4BMNA 1O94A 3HFSA 4E2XA 1XCBA 4MOWA 2P2SA 2QRLA 4BVAA 1R4NB 1XEAA 3OJOA 1VL8A 4XYMA 1A27A 4E33A 4BNWA 3PJDA 2P9GA 3W4IA 2C2YA 3O4RA 3JQGA 4RZIA 1U5CA 2DUUA 4RJTA 4BKOA 1E0DA 3D3WB 4F3YA 4FPXA 4BGEA 5CG1A 1VKOA 3GEGA 4N5LA 5BNFA 3U3XA 1WXDA 1EUZA 2JL1A 4I8XA 4DIBA 1M75A 1XHLA 4HP8A 2Q2WA 4J4HA 5CPBA 4R3NA 2W4QA 4EW6A 2C0CA 2B4RO 1PR3A 2EP5A 4J1NA 2A9FA 4J0FA 4II3A 1DC6A 2CDBA 4J1TA 4M1QA 4WLUA 4CMKA 4YAIA 4FQ8A 4JJFA 3SC4A 3BMCA 4J49A 1UXIA 3DZGA 4TSKA 4XRGA 4U0KA 2QYSA 2GRAA 1ISFA 3KV3O 4JIGA 4IJWA 2D4AA 4LMPA 1HDGO 2HJSA 4F6CA 1Y7TA 1UP6A 1E6EA 3RC2A 5K6AA 3N58A 1DFGA 1T2EA 1NHGA 3NGXA 1PJBA 4FJ0A 1GTMA 4CMEC 3OHSX 3HHPA 4RLSA 1LLCA 3JTMA 4K1LA 4RF5A 2I5PO 4HX5A 2HCTA 4I5DA 2FY8A 2Z1NA 4J2HA 1AHHA 4OQYA 5L7YA 2B69A 2IEDA 3JV7A 1J0XO 3U4HA 1QYCA 1HKUA 2WD7A 3KRTA 1PZEA 1B2LA 5DZSA 5A1TA 4A73A 2FZEA 1H6AA 2D1YA 1RYEA 1YS4A 3WGZA 3OA2A 2CVOA 3N7UA 4KDFA 4GBJA 2UVDA 4J1QA 3Q0EA 1P77A 2DVMA 1E6WA 2D3TA 3CUKA 3KHUA 2GN9A 3C24A 3E5MA 5CPFA 5KKAA 1R0LA 3KTDA 4YJGB 3HQ4O 2NSDA 3RASA 1KC3A 3NV9A 1ISJA 1T2DA 3PYMA 2NTNA 4I08A 4PLVA 1ORRA 4CM9D 1VLLA 2Q1WA 3ABIA 5JYDA 4FJ1A 4E6PA 2AEFA 4A5OA 2J3HA 4CLHA 5FEUA 2CVZA 4IQ8A 2PTGA 2HMTA 4UUOA 3PP8A 4G2NA 2ZB7A 3MCVA 1JTVA 1CIVA 2X0RA 1QRRA 3JQAB 3I52A 5L45A 2GNAA 4ALJA 2NU8A 3DBLB 4E2YA 3STHA 5F5NA 5JCXA 1ISHA 2E4AA 3HN7A 1T4BA 1YDWA 1CWUA 1T2AA 2V6BA 4UEKA 3TF5A 4TRJA 2V6GA 1DEHA 1LLQA 4LVCA 2VZ9A 4TWRA 2CF5A 3H2ZA 1A5ZA 3E82A 3E6AA 5A06A 4PG8A 1YDEA 4XX0A 3WSVA 4L76A 5G0UA 3KO8A 1BW9A 1R0SA 3OMLA 3CEAA 4IJKA 1RYDA 4CL3A 1UXGA 3QWHA 3WDSA 1WNTA 4PLFA 4UVIA 3Q2IA 2AHRA 2WM3A 4NFSA 4GMFA 6LDHA 4YJHA 5K9ZA 1XDWA 4GWGA 1YWGO 1LDGA 4IZIA 2Q46A 2YHUA 5H83A 1DAPA 3ASUA 3CTMA 3Q2KA 4OOFA 3ON5A 4FFPA 1U4OA 4GLOA 2X7HA 3LC7O 4RVDA 1SOVA 1PQUA 3JD3A 8LDHA 4ROSA 5JE8A 2DQ4A 1A9YA 3DHNA 2PZMA 2AXQA 3RU9A 2Y1EA 1BDMA 3V1YA 5L9AA 1HZZA 3DHEA 4U6SA 2O4CA 4IDBA 3IS3A 2DBZA 4U7WA 3VPHA 1ZK0A 2DC1A 4AJPA 1ZW1A 2BFMA 1UP7A 1Z75A 1JU9A 1HDZA 2DT5A 1S6YA 4R16A 3L9WA 5AXAA 2RCYA 5KOIA 2GGSA 3GQVA 3OECA 4PLPA 4DWVA 4QFDA 5HA5A 5ADHA 2B83A 4YRAA 3HDHA 4OXKA 1ZIDA 1QV6A 4CMAA 2DBRA 4PLZA 4YJFA 1UZLA 1V8BA 2ZCUA 1KY4A 4WCFC 4ALLA 4GAEA 3A1NA 1IOLA 3OIFA 2NADA 3MWDB 3S2GA 2ZTVA 1R16A 1Y6JA 3HE3A 4NH4A 3LK7A 1UDCA 3B1JA 3I5MA 5ITWA 1C0IA 4FOSA 1GYQA 5TT1A 3ZNOA 2GR9A 4CQMB 3EAGA 4M86A 1C3VA 5CDGA 1IHXA 4QT0A 4J91A 2UUPA 1ZNQO 2DAPA 1PU2A 4PLCA 4R1NA 4LVUA 2Y0CA 5A3VA 1NPYA 3DMTC 3VPFA 1NQ5A 1E3SA 5TT0A 3QVXA 3RUEA 2GDZA 4GKBA 3L9XA 2Q3EA 2UUOA 1D3AA 1O8CA 1SEVA 3KZVA 3F1LA 1AN9A 5JDCA 4YRDA 1P3DA 2D8AA 2J8ZA 4E4YA 4ILKA 3BMOA 1Y9AA 3EY4A 4LRSB 3RFTA 3I9NA 1NPDA 1ZK2A 1ZXLA 4Q9NA 4WOJA 3WGOA 1YBAA 2WE7A 3NT4A 3BHIA 1VM6A 1R37A 4XQ9A 4YBZA 2G82A 1FF9A 2WEKA 1ARZA 3RFVA 1Y8RB 2VTDA 4ALMA 2YDYA 1M76A 3L6OO 4BNTA 4IQGA 1DRVA 1M2WA 1X15A 4XIJA 1IY8A 1E7WA 3AJRA 1Z82A 4Z6KA 2O2SA 1NAIA 2NVBA 3TZ6A 4ZJUA 3OH8A 3C7AA 2EJWA 5HS6A 3MZ0A 5TS3A 3JYPA 1HDXA 5I8ZA 2C2XA 3I9LA 3ZHXA 1K89A 3KYCB 3DZHA 3OFSA 3I4FA 3H9QA 5DNAA 3GUYA 4FFNA 1XU7A 3JYQA 5G4LA 5L40A 1UZNA 3GG2A 1Z73A 3K30A 1PR9A 3E48A 3WFJA 3CMMA 5L4SA 5ES3A 4YEDA 3R0IA 1PSDA 3DL2A 4ALNA 1KS9A 1JWAB 1SOWA 4R3WA 4CMIA 5KJ6A 1QYWA 3RVDA 3RUDA 4W9NC 1A71A 3K5PA 3UKOA 4L8VA 1MC4A 5KCZA 1ZK1A 3QWBA 2OXIA 1CQIA 1OAAA 2PH5A 1ZFNA 3ZWXA 5JLAA 1GD1O 5ENDA 2ZYDA 5KTKA 1NVMB 1X7GA 4WCDA 3GFBA 1N1EA 3TZQA 4BQPA 3E9QA 5DP2A 5TJ9A 2VHZA 4RVFA 4DC0A 3VH4A 1GFSA 1Q7CA 4DXHA 4GSLA 3ZWOA 4ALIA 4AJIA 5U1PA 1B14A 2P4HX 3VH1A 5TQVA 4LK3A 1PS9A 4CM4A 2C5EA 4PG6A 4MIEA 1Q7GA 3JQGB 3ZNPA 3F3SA 1RKXA 1SO8A 3H9UA 4R1SA 1U3TA 4H16A 1M6HA 4B7XA 1YOVB 4RQUA 5T8KC 5IDYA 1XQ6A 2DFDA 3V2HA 4UEJA 1PZGA 4EYEA 5AYVA 1AGNA 4RL6A 2EW8A 2JHFA 4ONEA 1YJ8A 4PGFA 2O7SA 2X86A 4BNYA 2Q2QA 2DTEA 1GZ3A 4WPGA 2I65A 2HLPA 3GNTA 3PHIA 2B35A 3BMCB 1P74A 3K9QO 1RM0A 3H4VA 2BELA 3ROMA 3PFWO 5IN5A 1OC4A 3AOGA 1MLDA 4UUNA 3SVTA 4BNXA 4R68A 5CHEA 8ADHA 1H6DA 1W73A 5EN4A 1EK6A 1ZXBA 5L7WA 1BGVA 1MFZA 3HDJA 3ZNNA 1SNYA 1T25A 2J5QA 3CXRA 3GK3A 3PLNA 4CJXA 5ER6A 1BHSA 1D7OA 5GMOA 4EUEA 3RUIA 1CF2O 4ZHSA 1Q0QA 1E7YA 1YJQA 4D43A 4YT5A 1P1RA 4BO8A 1YL6A 3JQ8B 2JAPA 3R6DA 3NTRA 4M8SA 1H6CA 4OH1A 5KNLA 3KBOA 4FSHA 1GR0A 3QE3A 1NX6A 1HL3A 1HWYA 3AUAA 3DDNA 4IDAA 4UEOA 1AXEA 1ZVMA 1HE5A 2OHXA 1T26A 3GY0A 3ZHBA 1X1EA 1DJQA 2PLAA 3WBFA 1GV1A 3VKVA 4O5OA 4BNGA 5JAMA 2BKAA 3GGOA 1NNUA 3DEYX 4J3FA 3ZZNA 3OP4A 1H2BA 1ML3A 3B20A 3CE6A 2VWGA 5A5FA 5K0ZA 3HZZA 5AVOA 2WWRA 5K6AC 3ITDA 3K92A 1EFLA 3TPCA 4NJMB 3TOXA 4QUKA 2YYYA 3WIEA 3BHJA 3FWNA 3N74A 4AJ2A 1B8UA 4IZHA 3QV1A 3O03A 4J16A 3EVTA 4DMMA 3WICA 1J4AA 3FI9A 3U0BA 4AJEA 3RUAA 3ZWMA 3ANMA 2CUKA 2OGUA 2YV1A 1MG0A 3PTZA 3A14A 5ICSA 4BKRA 2A92A 2HK7A 4P4GA 4AJ1A 5CEJA 1X1TA 1P1IA 5DP1A 1LSUA 2JAHA 5JO0A 1CDOA 4J1SA 5LCXA 1EFKA 3MJTA 3JQEA 4XDYA 2UYYA 2PR2A 1HSOA 2IZ1A 5KVSA 2LDBA 1BW9B 3RKUA 1CJCA 4GSKA 5F21A 1MFPA 4R54A 3ZV6A 3WGYA 1LU9A 3L0DA 3C7DB 4WCFA 1EUCA 4L9RA 2FWMX 4DUPA 1ZSYA 4OAQA 4YJHB 4DRYA 5KWEA 1XWFA 3CPSA 4NBRA 2C07A 1TT5A 1M67A 4DYDA 3GRKA 1N8KA 4D41A 1DIAA 3D64A 4OGWA 2TMGA 4CM8A 3PHJA 2JD2A 1YQXA 1HZJA 1DBVO 5HTOA 2FZWA 2YW9A 1N7HA 2GSDA 3DR3A 4R9SA 1DIBA 3ZU2A 3NEPX 2DPGA 3E9NA 1F0YA 4AVYA 1B3RA 4CPDA 5IDQA 1Y8QA 5DDIP 4CV3A 1EDOA 1P44A 4XJTA 1ZEMA 2V7PA 1MXHA 5CDUA 3S1LA 5L51A 1B7GO 1DPGA 3NJ4A 5JCJD 4K6FA 2A94A 2Z1MA 4MPDA 3PZRA 1KBZA 2OMEA 3U62A 1YONA 5JYEA 4DQXA 2EW2A 4LSMA 1HETA 1FDVA 5TF4A 4RGBA 4UVHA 3WBBA 4FFRA 3PI7A 2OZPA 1LTHR 1NXQA 2ILTA 2FR8A 2CY0A 4QO7A 3IUPA 5T57A 3VHRA 2PD3A 4TVOA 1NVGA 2DUWA 5B37A 4G65A 4IDGA 2Q1UA 3LC2O 3TNLA 2HQ1A 3AU9A 2IE0A 4F45A 1HTBA 4ZQFA 1HDOA 2E49A 2X0IA 3KM0A 2OP0A 3C7CB 4JBHA 5H81A 2Y1GA 5JY1A 3OEYA 2EP7A 1WP4A 1YBVA 3H5NA 1U5AA 3H9EO 1YVEI 3C1OA 5JY6A 4B4VA 5I9LA 3TOZA 3LT2A 2AQKA 4MP8A 1ZK3A 1R4MB 1EVZA 4NIMA 4BMVA 4S1VA 1ADFA 4U0JA 4GH5A 3M1AA 4AG3A 4IPTA 3ANNA 1GDHA 3VVCA 2G1UA 1YKFA 4DMLA 1PIWA 1W8DA 1PJQA 1P0FA 3GOHA 4DC1A 3BMOB 4R9RA 5HM8A 3GC6A 4CODB 3GVHA 4NBUA 2IZZA 2PKQP 3FTPA 1H6BA 2GERA 2QRJA 1K6IA 4IS2A 4XRRA 1LDEA 2CDAA 1W0CA 3D5QA 4DREA 4NK4A 3NYWA 3BZUA 3KYDA 4AL4A 2ZB4A 2ZJ1A 5MGBA 3UAGA 1E3LA 1ZO8A 2NU6A 3GHHA 4DA9A 4WOKA 3V2UA 3AM3A 2VTEA 3ZV4A 1OI7A 4D3SA 3RQSA 4Q39A 3Q6IA 3MOIA 4ALKA 4IXWA 2O48X 4X54A 1EUDA 4FOOA 4FW8A 1ONNA 1GEEA 3QP9A 2O50A 5A04A 3KSDO 3ZV5A 5I7EA 1T4DA 3ADPA 1WW8A 2P5UA 3E8XA 3HJAA 3LF2A 3LT0A 3FSRA 4RPGA 3O9ZA 3ONDA 4IGEA 1UXKA 1KERA 3O26A 4ZQGA 2OORA 4GPD1 1NQOA 3AY3A 4MVJG 2IRWA 3PGXA 3U4IA 3UVEA 4C7KA 5EMHA 3U4DA 2DLDA 3QWIA 1E3IA 3ZW8A 2X9GA 3DONA 1QV7A 4HKTA 3BAZA 4KQWA 2IYOA 1R0KA 2AQIA 1HEUA 1I30A 4CMIB 1PQPA 4GMGA 4FB5A 1X7HA 3I4CA 1Q1NA 3ROKA 1ENZA 1RPNA 4PVDA 1PJSA 1EBFA 2GZ1A 5DOVA 2OFPA 3M2PA 4OXYA 3T7EA 5FI5A 3SEFA 4CM5A 2WJPA 1Y81A 1JLLA 2VT2A 5FYDA 3G1TA 5F1PA 4I9NA 4IUYA 4WKGA 3GFGA 2EERA 4EITA 2JFHA 5EINA 5C3MA 3OSUA 3FWZA 1HDCA 1Z6ZA 4IINA 3SC6A 4EDFA 2HMVA 2RH4A 1EVYA 2IYPA 3GA0A 1YB4A 2EGHA 3WS7A 2FOIA 2POQX 2X5JO 3LZ6A 4DLBA 4N5NA 1F06A 1PX0A 3JQCA 4MIYA 1JKFA 5A9RA 4F6LA 3BMNA 1DDOA 2X4GA 4OKIA 5JCJA 3U49A 3WR5A 4AJKA 4B4UA 1W4ZA 3KEQA 3Q9NA 1E1KA 4OSPA 4GKVA 2X58A 3LT1A 2ZK7A 3K31A 1GZ6A 1HRDA 4NK5A 1PJTA 1ZMTA 1C0LA 2GN6A 1QP8A 4FJ2A 3QVOA 4Z9YA 1LDNA 4WASA 2PK3A 3JQ7A 4BQRA 2RBEA 3INGA 5CP8A 3BMQB 5AOVA 4B7CA 4HFMA 3W8FA 3ETDA 1QSGA 1ZZEA 2NQ8A 2HMSA 5DBGA 2FSSA 4PLGA 4L0QA 4E2WA 3OQ6A 4TQGA 4WNCA 3IUSA 3QHAA 2TMDA 3SX2A 1G0OA 1F14A 3ZWCA 4KUEA 3GPIA 3NTOA 3UH1A 2V6MA 5HRUA 1E7QA 1JAYA 3Q1LA 3V2GA 3H2SA 1I3NA 3KSZO 4HADA 3WWZA 2CVQA 3H65A 3W8EA 4CQLA 2SCUA 3PJGA 2ZB3A 4J9VA 2WYVA 2Y93A 5TJHA 4DBVO 2Z5LA 1LQUA 5JC1A 2EV9A 1HYGA 1V35A 3PZBA 4A2CA 2J5KA 3VPSA 3DQPA 2C59A 4WLEA 3H3FA 3W4KA 1J6UA 4BB5A 5I7SA 2EG9A 1LBEA 1C0KA 2F00A 3ZWPA 2ZYGA 3LC1O 4FGWA 3DBRB 3OETA 4MVJF 2Y1OA 2QIOA 2DFVA 3HFGA 4Z3DA 4BV8A 4EGFA 3QA9A 1YXMA 3O8QA 4Z0PA 4ZQBA 1NR1A 5TNXA 1H9AA 4NNJA 3PWSA 4OJNA 3UGKA 5C5IA 3E1KA 3VTZA 3ZN2A 3E5RA 3G1UA 3ZWNA 3MWEB 1E77A 1X14A 3F6YA 1TEHA 4N5MA 5FF9A 4R5HA 4BO7A 1CETA 5G0WA 4IIVA 3QSGA 4C7JA 1EZ4A 3JQBC 1BTOA 4CLRB 1P45A 3WQQA 4A03A 4YA6A 4QQRA 3GVXA 2P5YA 3UW3A 3ZHYA 1JA9A 4XYGA 2JCYA 3VZPA 1LRLA 5JW6A 3WMXA 5KJ1A 3IP1A 4ZQHA 1PJ2A 5IXYA 5K1SA 3RD5A 3JD4A 4PFJA 3B1FA 3TRIA 2BD0A 1C1DA 1DC3A 1DHTA 3F4LA 4M54A 4DQUA 4JBGA 3QQPA 3VZSA 4PZEA 1UXHA 1IULA 1LEHA 3PXXA 4LISA 3WXBA 3QLJA 1YB1A 1XGKA 3K2BA 4NHEA 2XOXA 2P91A 3RBVA 1DB3A 2I3AA 1B3BA 3JD1A 3UF0A 1GEGA 1WDMA 4WCFB 4NMHA 5CG2A 4PLTA 4CMGA 4AJOA 3MEQA 4RF2A 2VQ3A 1M6WA 1UH5A 1G0NA 4Z0HO 4XGIA 2ZYAA 2YHIA 4RVUA 2AE2A 4EI2A 4K9DA 4B3HA 1O5IA 1VL6A 1E3JA 3TL3A 4CM8B 1MX3A 4MVJI 1CQJA 5L4NA 2AG8A
chains in the Genus database with same CATH superfamily
3I9OA 4RAOA 4Z7NB 2XUPA 1PR1A 3JWHA 2HZBA 3DZFA 1J7KA 2W6JA 1SA0B 2WHXA 4J16C 2O5RA 3P2OA 4LZJA 1XA3A 1M73E 1X1RA 5F3RA 4CU5A 1UDWA 3FOZA 1EUQA 5LQMA 4HGRA 1P9OA 2W6ID 2BOVA 1GPJA 2C5HA 3MRXA 4ZAYA 4Q6BA 1ECJA 2O1XA 5CCEA 5LOVA 2RJOA 4H6WA 2IFTA 2NYUA 1C1YA 3OY7A 2ZRJA 4WOBA 5ALUA 5LLTA 4JI2B 1G7SA 4K3UA 4LV6A 4E4TA 1Z0ZA 4B0OA 4CEIA 4E5NA 3GAZA 4ZAFA 5DIZA 5EXTA 4D99A 2UYGA 2Q6KA 5KQPA 4BYGA 3OWHA 3HVIA 4RTRA 3OF2A 1DCTA 4R69A 3UH0A 3T7KA 2ZZMA 3IQDB 1E2BA 2X1MA 2RGAA 4JI0B 1GKLA 2AR0A 1N8NA 3ULKA 2WJGA 2JAXA 3EPKA 2G63A 2VK2A 3TZKA 4JITA 3DBHB 4QAJA 2WVJA 1XZHA 3BRWA 4JUCA 4M53A 4L02A 3TNYA 4KXMA 3W9SA 5IAOA 1OFIA 2ATXA 2QQFA 3D8BA 4JKIA 2GD2A 1K5HA 4O2AB 1RE1A 1VMEA 3PGMA 1GZ5A 1PE0A 1PYGA 2QTFA 4ES6A 1T0BA 1JJFA 2BGGA 1QP4A 1SVSA 2X5KO 2EARA 1BRMA 2VNSA 3DMNA 3U61B 2IUUA 2VP2A 4OI4A 4B73A 4GMXA 1RP7A 4XVQA 2PDAA 4DQ0A 3E81A 1T3GA 3AF5A 2VZ8A 5EE1A 1NXWA 1NVDA 1KEEB 1NM5C 2QTHA 3AU8A 4ZQEA 4ZWNA 5H80A 1RP1A 3ZCTA 1MW8X 2BH2A 4W82A 3K9CA 2YRXA 2DR0A 5EIWA 3F46A 2C7PA 2V97A 3WK7A 3X2SA 4EJ0A 4DSNA 2DLCX 3EOZA 5CFOA 2YC4C 4JY7A 4BMYA 4FYHA 4REOA 2CFIA 5CT9A 3VU1A 5C7LO 3F5SA 1H8ED 2B8WA 1JV2B 3WWYA 1R6DA 2PL3A 1JWBB 2XZTA 3DOOA 4CIYA 4UEQA 5LXTB 2VHYA 3RIEA 2Q99A 1MAVA 3T52A 3F4BA 4JFAA 1L4EA 1QJCA 4CLDA 2CXNA 5IZCA 4NZ9A 4TZTA 1JQ5A 1ZCZA 2EWMA 2FWJA 2OZVA 3BGDA 3PFGA 1UDAA 4MR7B 1OAOA 5M5BA 4BNNA 1QH8A 1TMOA 2ANBA 3LBAA 4CIXA 2BRUA 5THKA 2VEDA 3GCGA 2A6PA 3OM0A 2DP4E 2D6FA 3PENA 3M5WA 2FSVC 2G04A 3TLCA 3BL5A 3DVAB 4UAGA 4U5XA 3NM4A 1COZA 4BO5A 1S2IA 3RVOA 3MD0A 4GOOD 3H2KA 4EJMA 4EW3A 4RKWA 2R1UA 1Z6QA 2FW6A 5J63A 2QRVA 1A8HA 3MINA 1UBUS 4LBVA 3UBMA 4B2LA 4TQUS 5TGZA 2UZAA 3EZLA 2COKA 1AS3A 3E9DA 2R4TA 4FD2A 5DM1A 5EIBD 4D25A 1FOEB 3LFHA 1FXSA 5K3DA 1TA4A 4CU2A 3T94A 3TI7A 4RTMA 2C7OA 1OZHA 4Q34A 5AHXA 2Y92A 4AX8A 3MWKA 4D3FA 5IT0A 3CZRA 2RI6A 2HO4A 2JHAA 4X45A 2CSXA 2M32A 4OHBA 1JJBA 3ET5A 1YL7A 3TM5A 3VDRA 4YLEA 3SYLA 4D1YA 3DLBA 1L9KA 2C57A 3MVEA 2HWKA 1NF3A 3QPCA 4EELA 3G2JA 2HPZA 3EGWA 5CDTA 2PVSA 4KQ1A 1NN5A 1Z2NX 1L1FA 2HGZA 3GMIA 4Y6GB 3UTDA 1CE8B 1PW7A 4HWKA 3TLMA 2PKEA 1CDDA 3WRXC 2FMUA 2Q5HA 3EGOA 4M9CA 1TVEA 5A5VA 2IHZA 3QPUA 4QOEA 1SVMA 4LHXA 4YDHB 4YASA 3M6UA 1TNDA 1H69A 5FB3A 4OLJA 4ZICA 1ZHOA 3ER8A 1CZOA 3V5NA 4JVSB 2O6LA 5F73A 5JS1A 3WQBA 3ZV3A 5KBYA 3LQ4A 4CR7A 1W46A 4MQ5A 5ESRA 1YQDA 1BXGA 1F4VA 4YJ3B 4J0DA 4XUGB 3TSZA 2RGXA 3I05A 4V3BA 1SQFA 4INOA 4LJ4A 1SUFA 2FRVA 4TS1A 3SC3A 3NFRA 2QLFA 2DPXA 1QE5A 3H2BA 4RNCA 4EDHA 5A6VA 1GRVA 2QUBA 1FFEA 2JFGA 2V8BA 3RJ5A 4Z3KA 2R60A 1XPRA 1Q0HA 3AINA 4PPQA 3NWOA 4IWYA 1FDWA 3AWIA 4PAGA 4RHEA 4NFLA 1GT91 2REXB 4D9CA 3DP7A 1O0CA 2WTBA 2O7VA 4TTVA 4XGNA 2WFMA 1S9HA 3ZCSA 3AERB 3PNKA 4HGNA 1BXRB 5A0VA 2DQYA 4TN5A 4XQCA 3IHLA 3CM0A 4OLHA 5GIPE 3OWOA 1DQYA 4HC4A 5E4JA 4OJMX 1WUIS 1FLDA 1OBFO 3PQEA 4IVNA 2Q8PA 4HH4A 3D3WA 3MOSA 4GX5A 4YJ2A 1U9JA 3HB4X 3NCHA 4I4TF 2GAFA 3DMRA 4IDDA 3T3IA 5TDHA 1SBYA 3JQ7B 5F51A 3QNUA 3V8MA 4NI5A 5NULA 4NY1A 3BRQA 5FWNA 2PX8A 1XALA 3BF7A 3SLKA 4GNKA 4JA0A 3EVCA 1XC7A 2IXBA 3SBDA 4CYMA 1BVUA 3OICA 4ZXPA 4G41A 3G0OA 3B9RA 2PYDA 1MP0A 4WJKB 4WIAA 3V4VB 2GMWA 4XCXA 1Z56C 3AC0A 5AESA 2M6KA 3K9FC 4ABYA 1P1BA 1KY5A 1JKXA 1M34E 3EG9A 3LQ1A 1BQEA 2YL2A 1TI7A 1YB5A 4QEDA 1V9LA 2WD7B 3FTCA 2R2AA 3GRUA 3PHHA 4OBEA 3OLCX 1JIQA 3GR6A 2O07A 3B52X 5HCIA 3NETA 3GNLA 4X20B 5CLHA 1FJGB 1OFTA 2YUTA 3M6MD 2JI8A 4WUVA 3L7OA 4WE3A 4BTLA 4B46A 1MRSA 3TTTA 4RYLA 2J30A 1NJ6A 4POAA 3UMCA 3A4VA 4Z9XA 2FF5A 3VX3A 1O1YA 1TKBA 2HK8A 2PXXA 4DMKA 4F72A 5U9CA 1H8EA 1EDZA 1MT3A 4RGQA 4TTIA 2I6FA 4MWSA 4UM7A 2ODPA 4YTEA 4QX6A 3ZI4A 1Z9BA 4PAQA 4ED9A 2HLHA 1JQDA 1VJ0A 2PGIA 2WKQA 3HJCA 1LDBA 1W96A 2G72A 2W43A 1LZKA 2REQB 3AI2A 1CFZA 4IIEA 4ZOBA 1GSIA 3H5RA 1Z39A 1DI0A 4M0EA 3E9ZA 2V74B 4YJ2F 5TY0A 2PLFA 5D1NA 2WINI 4L51A 4BFZA 4EYQA 1I5OA 1FUEA 3DUWA 1U3VA 1ZYUA 2B1JA 1QKIA 3E8MA 4DT1B 4HV4A 6AT1A 1EE1A 1V39A 4LAFA 1XNJA 4O1MA 3SKXA 1M5TA 5B3JC 3JRNA 3WGNA 1ODFA 3QVTA 1UJ2A 5FTJA 3RHTA 4E6EA 3V7NA 3Q3EA 1MCZA 1WDKA 3ASYA 1SRRA 3B8EA 4EKGA 1B23P 3DS8A 2EQBA 1KQOA 1H42A 4JQOA 3A32A 3DHYA 3TYXA 4QAQA 1DLIA 2P6PA 5LQSA 5CLFA 2VQEB 3EC7A 5J5AA 1KU6A 1U0SY 2VCEA 3ZHCA 4EPTA 4FDLA 1RC0A 4GLLA 4N8DA 2GXSA 1Y4ZA 3CLUD 3A37A 3KBBA 3G5AA 1FFGA 3QX8A 3DBLA 1NATA 1M2FA 2XYRA 3LDHA 3ZR4B 4INZA 4BCBA 3Q8WA 2F17A 2L69A 4NP6A 5HWSA 1L7AA 2D5IA 3SPXA 1A2BA 1ILWA 1BGXT 3VC7A 3AIOA 1JP7A 2CUNA 3PUXA 1V3UA 2QJTA 2AOUA 4QYWA 4TMFA 4BUZA 1D1SA 1EX7A 2FPXA 2GAOA 2JD1A 2ACWA 3EZNA 4EOGA 4A9AA 2QBYA 3FDXA 2I0FA 3OLVA 2GD1O 2V8OA 3AL2A 3P0RA 4C4TA 5IS2A 3NC4A 3L7LA 4D44A 3HABA 3I6IA 4KRFA 1B0PA 1SOUA 3T7RA 2GTPA 2XWJI 2FGKA 3VR4D 5KYUB 2BH9A 4LYAA 2X4DA 3RYHA 4YT2A 1SRQA 3NHSA 4M9UA 5DHQA 1RT9A 3UPTA 1BKYA 2R1VA 4C88A 1XBTA 1OTYA 3A2MA 4MLPA 4FTWA 4I1PA 3IQXA 5JHGB 1BWSA 1HLDA 4QFBA 2ESRA 2AMVA 3GEEA 1VSQA 3O21A 3OOSA 3R3JA 5FP0A 4BEBA 4RTLA 4MJ7A 1SBNE 1Z28A 2CHVA 2QN2A 2V7QD 2VRCD 1YGYA 4LBYA 4URZR 5ICGA 3O94A 3BWBA 1E1RD 1EXWA 1F0KA 1WG8A 2I4LA 2WIAA 1PJCA 1S02A 2IYWA 4K3VA 4FBGA 4LHWA 4YJDA 4Q9JA 5F3DA 3WRWA 5C52B 2OENG 3DJYA 4L4YA 5DTIA 4ENRA 1FXWF 4JK3A 3BRCA 4J4BA 1U8UA 3DKRA 5A62A 1CLUA 4ZCSA 3OIGA 3Q6NA 3NDBB 1BMDA 1FFXB 3BDIA 4EGCB 1FS4A 4LWPA 2P78A 3RS3A 3D8TA 3K8QA 2I29A 3UV3A 4FEGA 1INLA 4LRQA 4X3CA 2GN4A 5ETJA 2E4WA 5E2IA 2VAPA 4KTTE 1ESNA 3ANXA 4ZTBA 2C9MA 1PHPA 1YD7A 3FVRA 2ZM5A 2JFOA 3BHNA 3L02A 4ZTZB 1GNLA 1VKRA 1Z5GA 5C80A 1BOFA 4IRUB 4ILEA 1ABBA 2B5WA 3HY6A 3BCRA 5A3RA 3UWSA 1ENYA 1W25A 1IBSA 2OT3B 2QD4A 4GL4A 1DAOA 5AKZA 5BY2A 4OQXA 4L5IA 1NJ2A 4KIGA 5CK4A 1M1YE 4YYZA 2JIMA 2EF1A 3QVVA 4R8VA 2C2ZA 4LX8A 4ND5A 4H7IA 4QU9A 2MDTA 4EHNA 5KVVA 1VGRA 4LE0A 4C4ZA 4B4WA 1LTQA 1Z5WA 3HPRA 2X5XA 4QVKA 2ZVJA 5GOZA 4KFUA 4CEJA 5J4KA 2BKVA 4CVNA 2YNMA 2XB2A 1EXDA 1FYWA 1FFAA 3LAWA 2NNLD 5HRCA 3RRNA 1XQXA 2YWCA 5M3BA 5LQRA 1LSSA 1MBZA 1XNHA 3WYCA 3A6HA 4AUNA 1RRGA 4ETNA 5YASA 5KOJA 3O92A 5G53C 7YASA 5BMVA 4FMCF 1RKBA 4WLOA 3RUCA 4QXAA 2H52A 1OCEA 3BGWA 4ZOLB 5EGNA 4C20A 3E7DA 3ETJA 4KZPA 4NMXB 4NCJA 5EZYA 5DNWA 1X1AA 4GBMA 4KWCA 4BMXA 6ABPA 5BWMA 1TLTA 3NDJA 2RONA 4EJ2A 1ISMA 2NU7A 4AK9A 1R8JA 2NOAA 2PO5A 5AT1A 5C7OO 1CB7A 1L4KA 2UVPB 4UAJA 4H1UA 4BMSA 1N9GB 1KJQA 3R7SA 1P0CA 1Q0RA 3K72B 2PUTA 4JVOA 4BB0A 3DXXA 1E9FA 1NHWA 1SZCA 5KYGA 2WG1A 4RE6A 1CUHA 4HEJA 4LXXA 5E95A 4B8WA 3ORHA 3PDIA 1H2YA 3I28A 3NKFA 2VJLA 4G1BA 1X3SA 3AGQA 3SGLA 2BEUA 4CLOB 1GUFA 4HFJA 3GNQA 3WSWA 2CXSA 3GEBA 2A1TS 1OH6A 1CEQA 1DJPA 3R3SA 4NXMB 3FHCB 1A7JA 1N2EA 1WA5A 2X40A 3D7RA 2EFJA 5JANA 3QE4A 1F8UA 2B92A 1H4SA 1CNEA 4US0R 3AM5A 3IEXA 4NYMQ 3LQYA 3EIXA 3M82A 1MJGM 4U2GA 3D6TB 3B70A 4DIEA 2HQOA 5EJ7A 1QZZA 4ZYZA 1J97A 3V9AA 2IY9A 4RXUA 4B7XA 2NG1A 2H92A 1UPFA 4S24A 2IOFA 1Q7BA 1BN7A 1IY2A 4ND8B 1U3WA 2BP7A 4DKJA 1T2NA 5CBPA 1RM4A 1Y42X 3IJPA 5FIUA 4B9EA 5JNSA 1ABFA 4HUQB 5ADVA 3P32A 4Q93A 2CJXA 3IR5A 5FA6A 2RFLA 4R2HA 4BRZA 1QIDA 3BTOA 4GDMA 4EL5A 2RAVA 3T41A 4Y8VA 2O5EA 3QKSA 1VJRA 3AJ8A 3HI4A 1ODKA 4MXDA 1F8GA 2FW7A 1J21A 5EQDA 5EMKA 1OIXA 4Q3LA 5I5EA 1YI1A 2J4CA 5K3FA 1WBBA 4Z4EA 3K8OE 3B36A 4ZAWA 2EOAA 5A3JA 3OZFA 2WFLB 1PGJA 3VHXB 5DXJA 1WWKA 2J31A 4UUPA 3KQYA 2X41A 5KC8A 3R5KA 4GGOA 1XG5A 4LJ9A 5BSHA 3WMFA 1A4UA 2A5FA 4D97A 2WHRA 3CW9A 4ZK2A 2G1JA 1L7BA 5AUNB 4RF4A 3Q11A 4CM4B 2ZT7A 2DLNA 4KO2S 4YQZA 3DLTA 3RC3A 3ROFA 4C6SA 4EG8A 3LOUA 4Y2YA 1KKLA 2P3QA 2V7QA 3RROA 2PO7A 2VPZA 5AW3A 5T6BA 3ML1A 2A0UA 5IABA 1DBSA 2C95A 1XRRA 4GX2A 1VJTA 4AY3A 2YMPA 5ALVA 1DIGA 2PKQO 4UDYX 4JLWA 3RPEA 1AVTA 3SYKA 4ZCLA 1XEXB 5EP3A 7REQB 4MDHA 1IUKA 1P9RA 3WMWA 2ZYHA 1J2RA 1Y7IA 3SM9A 3IMFA 1QYXA 1VA4A 1Y9ZA 5IK2D 1JFTA 3E70C 5FPPA 3NU1A 3UJ3X 2OCGA 3I92A 1F2VA 3EHDA 5A0FA 3QOFA 2ZTSA 2JFFA 3FR7A 1ZGBA 2FKAA 1L5LA 4BEWA 1EINA 1H94A 2FAXA 2GZ3A 2J1LA 5EKTA 1U8FO 1X74A 3BFXA 3JTEA 4DDWA 1DADA 4X66B 4MZDA 4BNHA 5JZOA 2HU5A 4LNUB 2YJ4A 4NEQA 4UE3S 2PUFA 4RD2A 5CFPA 3HVRA 1LBIA 1T9GR 2DPHA 2F3UA 5LP6C 1UWCA 3RF7A 5AVWA 3QZUA 4PN3A 2BMVA 4EQ6A 3GOQA 4U6QA 1PP4A 4K2HA 3Q98A 4JQCA 5ALXA 3X1MA 3U40A 2K7ZA 5CJ2A 1I80A 2Q45A 1AZLA 3ACCA 4IDNA 1EK5A 3HDYA 1I14A 2I3BA 3JYLA 1EAMA 1TC1A 4KXQA 4K9NA 1CJUC 4P93A 4DV3B 1W5BA 5CH5A 1MQAA 3PKJA 3VTAA 1E62A 4Q9KA 3KQLA 1VE1A 2K5UA 5JEEA 3V8BA 1L7DA 3L4SO 2COEA 4O33A 2W42A 2FP3A 2QTGA 1RQ2A 5D6NA 1KI6B 5G3ZA 3QXSA 3DLCA 1O9BA 4X0EA 4KH0A 4BB6A 3JVVA 4Z0TA 4ZHQF 2A8YA 2NPOA 2OA0A 3OE5A 1V5WA 4WGGA 1PJ4A 3NWBA 2YY5A 4PW0A 3OZGA 3D31A 3JYNA 3WLQA 4AQYB 1XLTC 2BHSA 2CZQA 2IZ6A 4LGYA 4Y7CA 2P35A 1I7DA 1SEPA 5SYAA 1G6OA 4D3DA 1J0EA 2W83A 2I1QA 1YCDA 5ED4A 3FBWA 2SECE 2C7VA 4PC6A 4QJBA 3U7FB 5LMUB 1JFSA 2EU8A 2CNBA 4XB2A 4F12A 2XDQB 1LA2A 1XLUA 5BSMA 2O8CB 1EK2A 3MMPA 1CJSA 3T0FA 3EYWA 1E6CA 2F4NA 3B38A 1AGXA 5HZMA 2UVQA 1WMBA 1R3UA 3SU8A 1B6GA 1U94A 3JQ9C 4AB1A 2DT8A 4ZYYA 3RI3A 4JHXA 3T9EA 2O0KA 1SVNA 2P2GA 4A5SA 2P9TA 4NMWA 5KPJA 2F1IA 3RHFA 3KS9A 4LY6A 1TPYA 4Y9UA 4ZI2A 3D2BA 1EE9A 2GSWA 4N49A 3AF2A 3RVMA 2GPYA 2OCKA 1GU7A 3VV2A 1V0JA 2FMHA 2LR0A 4LC1A 3ZCVA 1RQPA 1I7NA 2G0AA 2Z1DA 3K3PA 3B6ZA 2Y9MB 3JQQA 4GR9A 5GM1A 1SD2A 2H7CA 3PPVA 4PZDA 4Q4DA 3V32A 3PNQA 3L0PA 2NO4A 3V34A 2QTZA 1VZ2A 4DCTA 5K8IA 3EH1A 3IUMA 3TDKA 3QMWA 5F2EA 2PZJA 1B8VA 1XMXA 2Y05A 3DOFA 4Q12A 5D7BA 4FM9A 3L7MA 2Q3MA 4L78A 4XWWA 4TM7A 1EH5A 3TJRA 3OZXA 2J9FA 3WL8A 1KZYC 2FPIA 3AR4A 4G25A 2PUHA 4QGFA 4YFYA 5BW6B 3TAHA 1ZMOA 1AKUA 4GD3Q 5H7XA 3AY6A 3LT5A 4H6VA 2KE5A 1TJPB 3I2JA 3JD0A 4Q1FA 5IM5A 4EKYA 1FDTA 1WX1A 2XCRB 1B8PA 1PK8A 3THSA 3A6EA 3LY7A 2JLSA 1DZIA 1P7YA 1BCSA 2D1RA 4BPRA 2D1FA 5KB3A 3JZFA 1YQUA 2NTYC 2I67A 1Q0UA 1V25A 4Q4JB 4XWGA 1AHPA 1DX9A 1OWNA 2CHEA 2YOGA 3CB4A 1BKDR 4S3MA 3WGQA 2PJUA 2Z8YM 4PR0A 1BGWA 3C6BA 3Q87B 3TVDA 5C4IA 2ONZA 2H3EA 3UJ8A 4BCCA 5C8ZA 1TZMA 1POXA 3KCQA 2J0QA 2Q2OA 2GJSA 1QRTA 2H7XA 4KMSA 3KEFA 5BR8B 1G21B 1IB0A 5EZQA 5F9HA 3LBNA 2N1MA 3WL3A 1LX7A 2INGX 3E27A 3ZX4A 4Z51A 3RODA 3WFZA 3GFRA 1UBSB 3CLTD 3PUWA 3KPJA 4BO3A 1WKCA 4PV7A 3RAFC 2XECA 2PY6A 3QPAA 4WRRA 2VN8A 4ZU3A 3DE1X 1DS6A 3DXFA 2GZRA 4FT4A 1QR2A 4RORA 5BOVA 3S55A 4GVLA 1QQ6A 4L5JA 2VUHB 4AF7A 4ITUA 3CVXA 3QEBZ 2R00A 5IG2A 3W2HA 1LW7A 1A5AB 2D2XA 3ZKWA 1GYRA 3BE8A 3ZS8A 3U6BA 4X94A 3HN2A 1QOZA 2BZ0A 3HU3A 1GPWB 4H1HA 4M38A 2FEMA 2XCIA 4OGLA 1ZM9A 2QX8A 1TRKA 3MWJA 1LDYA 1VIYA 2F1KA 5DFAA 3TGPA 1CFJA 1YZFA 5KWSA 3HCCA 3LPCA 5AOCA 1JQEA 4LEIA 3FBTA 4NOJA 3EXIB 4FMPA 5COBA 5IUKC 5C4GB 4GYKA 5JYCA 3AHCA 4BZWA 2O2YA 3GDWA 4UE2A 2FEOA 3IAXA 2GN8A 3BXXA 1ZM3A 1AQUA 3OESA 3B1WA 4FN4A 4CUJA 2P62A 3SBOA 2AZTA 2PV0A 4E2FA 7ABPA 1YAHA 4B2YA 5I8WA 5HMLA 4MHTA 5ALNA 4ZAXA 4BQIA 4JLPA 1ZH8A 4IOKA 4EG7A 1I01A 2NU9A 4HDMA 2FSFA 4Z4CA 2BTOA 2F7SA 1BVRA 1FLVA 4HLCA 1QWSA 1QO0D 2VYVD 4JKYA 4MO9A 1MKYA 5ILGA 2JEZA 2JBAA 4K9PA 1X7ZB 3N2KA 4ND1A 1E8MA 1TK2A 1W0JD 1QHYA 3L8DA 2CJWA 5J2UA 2HA3A 1AKNA 2FPUA 5DNVA 2WSBA 4ZIRB 4QUJA 4R8KA 2Q50A 5EYPA 4DN6A 2QLLA 5B12A 5TIIA 1Y37A 4PC3A 3G17A 3KSAC 4JXZA 2CUTA 2ZLBA 3HJRA 1X8KA 1HM5A 2AW3A 3LWZA 2GEFA 4LKOA 4MPTA 4NJEA 2GT1A 4XH9B 5ENZA 5IH3A 1JUDA 4P3KA 3P9RA 2ZJBA 3FGZA 1YJ5A 3J7TA 3SR0A 4UVGA 1F17A 2GUWA 1FS5A 3WLOA 2XXJA 1MIOB 2HH9A 3NYRA 1JAXA 1UEXC 1NU8A 1GG9A 2BEWA 1R4MA 1XKQA 2WWTA 4R8RA 1RC1A 3FHLA 4TWIA 5DX1A 5FHQA 3RAJA 1J0DA 3T1QA 5I7UA 3KFLA 5J2TA 5HKKA 1AKEA 2CNWD 2WAAA 4HL6A 4QODA 4GLFA 3BXZA 4TL8A 2DOKA 4WN9A 1U1IA 3HZHA 1QXSA 4PZ9A 4IJUA 4ZD6A 3LHIA 4QNRA 4KRXA 4DLPA 3RKSA 3GJYA 4MLCA 3AOEC 1N2CA 1PDWA 3ORSA 1V7CA 1X8LA 3L7BA 2OXTA 1F9EA 3H87A 1NIPA 2VH2A 2Q9UA 1B4DA 1PFUA 3CR7A 4Q24A 3TG2A 2JDID 4UVDA 3THYB 1E3EA 4N47A 3FNHA 4E5MA 3D7LA 1FMFA 2XMBA 1EFUA 5DNEA 3WL4A 3ZXXA 3FMIA 3U7JA 4D0GA 2VAWA 2BKXA 2ODTX 5EL0A 3EXFA 2WD9A 5EWLB 1ZGZA 3N2IA 5CTJA 2UUAB 3ADOA 4JYPA 1QHSA 4PRLA 1SPXA 4UNNA 3KXPA 4YH1A 4GI7A 3EF3A 3W5UA 1XZFA 2LCIA 3R9XB 4NFHA 3TFQA 1YRHA 3AK4A 3U13A 5JFOA 3GBVA 2QMUA 3K20A 2C5BA 5IN4A 4CN8A 3VKHA 1IY0A 5JWOA 1JHQA 3AJAA 3KVOA 2GBGA 5SZIA 1SXQA 4M9SA 2BHRA 3FVWA 3HZOA 2ODEA 4MB6A 2ZVPX 1PLLA 2G5GX 1KNQA 1H2AS 1RTKA 3NHZA 1MXFA 3QJYA 1EFPA 5K99A 3AUTA 5A9SA 2BDTA 3CV3A 4GG1A 3WL6A 2WPNA 1Q15A 4M83A 4LF5B 1JQ3A 1SBHA 2Q5QA 4E30A 3WZ2A 3R3HA 3GFOA 5EE5B 3H6GA 3CUYA 5LC1A 3REQA 3VU8A 3FDJA 3PEYA 5FPTA 1T4CA 3WDMA 3OQMA 4AMUA 4EHFA 2GETA 3PQFA 3W8RA 4CUKA 4YR9A 1MG5A 2BKLA 2QQ5A 4WKNA 5LD2C 4DLSA 4EVRA 1ZIYA 1M2VA 3RSQA 1WXQA 2UZIR 1A95A 2JJ1D 3HZRA 2D5LA 3E58A 4HNSA 4I3FA 1J23A 3AHGA 2PE5A 2GQ0A 3N8GA 2XXAB 1M7BA 4EF4A 1Z34A 4CMEA 5I45A 3AEQA 1Y63A 1QHHA 4QQ8A 1WUHS 2WJ6A 2ZIZA 2VWPA 4RVGA 4LJYA 4M1EA 4KE6A 5ARBA 1XI2A 1XVTA 4G5FA 1KZ1A 1HDYA 4WINA 4JU9A 2JFWA 4E3ZA 5IX8A 5L3SB 4TZKA 1H4TA 4ND4A 3JASA 1XWIA 4JLKA 4QSMA 1NUUA 1VFNA 3EDMA 1ZJ4A 3KL2A 1MJFA 1VRWA 4AO7A 3IEPA 2RG7A 2HU8A 5KYWA 2W98A 1RD4A 2ANCA 4EPYA 2A78A 3GDOA 5K3AA 4D3YA 1T9CA 3OUUA 3S2FA 4W5RA 4FC6A 4KAAA 5JMTA 4ISCA 4N7RA 3VNQA 2QRKA 3PPWA 3HBLA 4Q5IA 4URFA 3H16A 5GJWC 5IW8A 3ENVA 3QY9A 4Z2YA 4RTQA 2O3QA 3R0ZA 1KOLA 2JFUA 4LE1A 2C1EA 3WL5A 1GGFA 1DKUA 5FTWA 4UULA 2X0KA 3QJ5A 4B3RB 4J75A 2QGNA 3D81A 2VYVA 1QO0A 3BERA 3CLRD 1U9ZA 2I1WA 3AHJA 3DFMA 2NLOA 3M5PA 1T8UA 3MS7A 2C20A 3K15A 3LUFA 4QLAA 4RFSB 4E5YA 2UZ4A 3WQSB 4S2UA 5LBUA 1E32A 1W0JA 4ZANA 4P7KA 4AJ4A 1H9CA 3UN1A 1RWBA 3ND7A 3FNGA 3GL9A 1JB9A 4JMLA 5HOEA 1I32A 3E9MA 2VJDA 2WU8A 4JL8A 1KP2A 2YYSA 1NDQA 1PL6A 1KI4A 1S8OA 2A9QA 3IP6A 4G5HA 5DW3A 1I2ZA 2FN7A 3D4BA 4JBLA 4PN7A 3AP2A 4MS1B 1Z38A 4CTMA 3R7FA 4LHSA 4TUYB 3NKLA 4DSZA 1SR8A 1JSZA 3HTXA 3M4ZA 1B6TA 2YVKA 5AW1A 2V4UA 5BSFA 1I3MA 5B2EA 5C5CA 3FNIA 4D9IA 3ZY4A 5L95A 5K8CA 4JEIA 2VTBB 2O7QA 2CNWA 3KDPA 4I5GA 4XDZA 3R7BA 3VNRA 3WWEA 4DA8A 4GKAA 1PEAA 2QN8A 4ZVPA 4B3IA 1WXGA 5KJCA 1BE0A 1VJ5A 3GIDA 3I2IA 3CX3A 1C9DB 3K32A 1PVOA 3IR7A 3SZRA 1EESA 3A1EA 3LLUA 2IYFA 4OO3A 1NY5A 1BX3A 2PM8A 4FDVA 4QO8A 1JR3D 1B74A 4J1TC 2A9KA 3F5DA 2JDIA 1T1SA 1OHHA 2FETA 3UYLA 3DQQA 3NHUA 5BMOA 1P81A 4BIIA 4FOTA 2OGWA 4K6HA 1Q0TA 1CZHA 1DFIA 3B85A 3KE9A 3W6UA 4W8GA 1QK4A 3D6VA 4UU7A 3Q8KA 1ORHA 3COJA 3BYZA 2R65A 1MD9A 3ZV7A 4A2PA 3R3UA 2RGGA 1OPRA 1QOPB 3I1JA 3MWEA 1Q0LA 1NQAO 4OYHA 4MQ4A 2HM7A 1HF3A 1I8TA 4I4LA 2AYYA 2VNJA 4BNLA 2HNAA 3MRTA 3AUSA 4LYEA 1P2SA 4YQYA 1M74A 3F6CA 3H17A 3PKZA 3IKJA 3D6JA 4XVUA 4TMZA 4C0AC 2YWEA 3WGIA 4A0HA 3NUGA 1W0KD 4KDCA 1W5AA 1K1EA 2PNFA 2QTWB 3RJZA 1O5TA 3K2QA 3A04A 2AWOA 4EUFA 4I50F 2JCGA 4FGSA 5HCUA 5I7FA 1JFFA 5LDHA 1L6IA 3L2OB 4BWGA 3IOYA 4BQFA 1U3FA 3B3QA 1VXOA 5THQA 1NE7A 2BGLA 2YWDA 3MJSA 4GEKA 1YI8A 1ISSA 4MW9A 5EUMA 1T8SA 3UTCA 2QMQA 4ZJZA 1E3TA 3GJQA 1YFKA 1PX2A 2VDVE 3QBDA 3X44A 4MDFA 4Z4IA 3O8CA 2B7CA 2KW5A 5EKSA 3R7WB 4PLYA 3O74A 1AGYA 4BLSA 2JJ1A 3G9XA 3CZ4A 3MJRA 4K5QA 2I66A 3LUBA 5A4MS 5EHQA 3P9PA 4QXMA 3TI9A 3N8NA 4LOIA 4X8OA 3W2IA 2WC1A 4QXPA 1RJ9B 2NXJA 5E1DA 1Y6GA 4G0UA 1GGJA 2XJ4A 4P4TA 3ZIUA 2PUJA 4NYIQ 1RJGA 1COWD 3ZD6A 3U9LA 1QR6A 2PT7A 5LZ9A 2GEKA 3OQBA 4FGJA 3KQNA 5LYJF 1T9ZA 2RHCA 4RC9A 3SC2A 4NE9A 3L8YA 1W87A 5K0SA 1C7JA 1QG4A 4CEIB 2D06A 3UB4A 2GWRA 2QT0A 3H97A 3TTSA 3UOGA 4RM3A 1DP4A 2F62A 3I04A 1NT2A 3EQZA 3G82C 3UUGA 5IJ9B 4AC9A 1IDOA 1XZIA 1I3CA 1C4OA 1MB9A 2AJ8A 2X0FA 3CZ9A 1I51A 4BO6A 1EJ6A 1C0PA 3TWOA 3HEMA 2IU6A 3ZOKA 2P67A 3TECE 3IE1A 4O2BF 1H4VB 3MB8A 1DWPA 4HAOA 5H0IA 2X2PA 4G5RA 4AWAA 1ENOA 4ND3A 5ELMA 1EGQA 2GK6A 4B79A 2DF8A 3NT5A 2HHCA 5EPEA 1QYIA 1DCKA 1SUBA 3AFIA 4AICA 4R1OA 2O2ZA 4OU4A 1P1CA 3K1YA 3HCPA 3AEZA 2OCXA 3KQKA 3OKFA 3HMQA 3QLEA 2W2KA 5EAIA 4UBLA 2NXEA 3HA5A 1U0RA 3I8SA 4UPDA 3ONEA 4JP5A 4AZWA 4D92A 2AEJA 1NT4A 1ZC4A 4B0PA 3P7MA 1Z6XA 1CZRA 1H2XA 2AI2A 3C1AA 3ESXA 4WBSA 3FWPA 2RHTA 4UTXA 5AVTA 2X23A 2AGVA 4QSHA 1SBQA 1CVRA 3R6TA 3WYAA 2JH8A 3DPUA 4NBWA 1EQ2A 1JKJB 4QOHA 1P7ZA 1YS7A 3D5EA 3RSLA 1BFKA 2FEAA 2WWIA 4TL7A 2ZIAA 4QTYA 2CYAA 5KYYA 1QM5A 3QQ5A 3F8SA 4GI2A 5BO5A 3RTDA 1CNFA 2IGBA 5EP2A 2GM3A 3E15A 2P2CA 4KVFA 1KYZA 1YCGA 3ZWAA 4YUYA 4QOFA 3GNSA 3CX8A 1E5LA 1ELOA 4Z4HA 2UYHA 3AVTA 5JD3A 3GGGA 3F0TA 1W2HA 3I0ZA 4Q66C 2IBTA 2P6NA 4R9UC 4A27A 4B5LA 3SVLA 4NXNB 1XIVA 4KUHA 3AM1A 4O4IA 3FMPB 4TXHA 1QH8B 3D3EA 1G9TA 2X8JA 121PA 4MI1A 3UM9A 2XE7A 3TB4A 1BYIA 3WLFA 3TJMA 5HJ2A 1T3HA 3NAQA 5SY9A 3CYFA 4MUFA 4WAUA 3LUDA 3LP6A 5B1IA 2I03A 4KU4A 4RFLA 3PPIA 3EIOA 2UZ3A 3H9GA 4A10A 1E8DA 1TD1A 5F7OA 2N47A 3HVJA 1H2WA 2CV1A 2HWYA 3GJXC 4H9GA 1PZMA 4RVCA 4G6ZA 1JAHA 2JFBA 3AF0A 4JMPA 5EZ6B 1IMOA 4BFSA 3ND8A 5LLSA 4EBFA 3PWTA 5AH0A 2UZ1B 3BXPA 1ONPA 2APJA 1PQ4A 2BKUA 3WNBA 3W5BA 3I6ZA 1H2FA 3LVBA 4RSHA 5ECWA 3S68A 4B3DA 2ZWVA 4P8RA 2B0CA 3OJLA 2AD1A 3WLTA 3IPRA 1W0KA 2W6MA 5TB5A 1X7YA 5K0FA 2HK9A 5T8KA 3O84A 1U6JA 2VHTA 4Q3BA 3HBAA 3UXYA 1S2NA 4JI3B 1P9LA 4C1BA 3S7ZA 4FFOA 4P1ZA 4TROA 2XKBA 3SYRA 1QIIA 3I83A 2WYWA 2OQ2A 3P9ZA 4Y1RA 2ZJ2A 3SXJA 5B57C 3KETA 2I4NA 2P9BA 2R5FA 3AEXA 3C4QA 1BFDA 3NOQA 4HYYA 3VTKA 3PPYA 4EFNA 1VSUA 5A9TA 3UCEA 3WO1A 4TYNA 5KX5F 4DR5B 2W0MA 3TKYA 2A67A 2I8LA 2KJQA 1W4LA 1Z0AA 5EJFA 3ZQJA 3OIDA 5KJFA 5KUTA 2HLDD 3O1JC 3GFSA 1HGXA 4LRUA 4MQFA 4AF8A 1BU5A 2P68A 2ZRBA 3IA2A 3NEAA 2ECFA 4IIGA 4R51A 4YONB 4LGMA 5H1YA 3ZJ4A 2OQIA 2YINC 4E2XA 3HBJA 1W1UA 3UW1A 1UKZA 3MBKA 2HGSA 4LWOA 1DQNA 3G2HA 1F1BA 4Z3OA 4G5YA 3F3KA 3T5CA 4KL8S 5EMNA 4UMEA 1FUYB 1VL8A 2GK7A 1XCJA 4XYMA 3SQNA 2IU0A 3V4LA 3QU7A 3W4IA 2DUUA 5A6SB 3IPLA 3SIRA 3KT0A 1J24A 2ZFUA 3MM4A 5ECGC 3D3WB 4YJ2B 2F9MA 4OFWA 4EK9A 3F73A 5D8DA 4NARA 5B6PA 3TR6A 4G85A 1SCAA 2HWXA 4WQMA 5BNFA 2JL1A 1EUZA 4DIBA 2VS1A 2HDWA 2BL4A 4J0KA 1MB2A 2YVUA 3O82A 3WRYA 5JJIA 1HPLA 2J7KA 4G0OA 3VNUA 4RACA 4A82A 2L2QA 4IDPA 4J1NA 4JDPA 2FFHA 2CDBA 1WXFA 1M3SA 3C3KA 3B1VA 4FQ8A 4JJFA 2ZSHA 4RK0A 1VLVA 1E2KA 1FNCA 2FPOA 3EG9B 4TSKA 4W5WA 4N65A 4MULA 3I9FA 2GRAA 1KO1A 4KWEA 4LMPA 5BQ5A 2H2WA 3I6YA 1HURA 2HQSA 5JROA 1UDXA 4ITVA 3N58A 1B8OA 1T2EA 1D2NA 3NGXA 2JH3A 4FJ0A 1M8FA 1GTMA 3CWCA 4UMVA 4G0WA 1YB2A 3HHPA 4KO1S 4IIDA 2Z5GA 2H1FA 4LJRA 3CRNA 1F6DA 1NQXA 1RBZA 2I5PO 5CA0F 4HX5A 4BFVA 1TCCA 4I5DA 4PYQA 1AHHA 1U2ZA 2Y71A 4F2WA 5JHHB 2NUPB 3WJ2A 1IEQA 2TECE 3L3BA 1J0XO 3U4HA 4ERNA 1K6MA 1M2GA 2JZNA 1SXGA 5EQJB 1YRAA 1T8YA 2E2WA 2QTTA 3UXMA 1QGED 3I1YA 1SM4A 1SIBE 2VK1A 4FHEA 3QJGA 2I2XB 3WVNA 1XRPA 2FZEA 1OXBB 2RGDA 3OCYA 1MJNA 2E4YA 4TWBA 3WGZA 1GQSA 1TUBA 1WSAA 2JKZA 2FG5A 2YWXA 4GP7A 2J09A 3PXCX 4KDFA 1M0WA 1P8AA 1DUIA 2UVDA 4J1QA 2WIJA 2DVMA 3L43A 1Z0DA 2B25A 3STXA 3TUJC 1E6WA 2D3TA 3F67A 3KHUA 2GN9A 3E5MA 1Z4IA 5CPFA 4HVCA 2VHJA 4LY0A 4DLTA 3HQ4O 2BMJA 4QYIA 4YLGA 2OHJA 4O4JF 5CVCA 2J0EA 2DPMA 2WAOA 4KFRA 2MINA 1C8LA 1NLMA 1VLLA 3MGGA 2WLTA 2Y1KA 1TFUA 3AG5A 5B6JA 2QIPA 1M2NA 4RWEA 1Q16A 2VATA 3QEOA 1O9GA 3KT8A 3UJ7A 4FJ1A 4CKEA 2AEFA 5IT4A 5DGXA 1N2BA 4R7TA 5LZ2A 1QG0A 2WT9A 4RESA 1PUIA 2J3HA 5CGZA 4FXOA 3WA6A 5FEUA 4M1SA 4XDHA 3N2ZB 1UIMA 2HMTA 2JFZA 1XQVA 4CW7A 3TQOA 2OILA 4J2TA 2GNAA 4B6QA 4FI3F 4FEAA 4KNWA 3THRA 3DBLB 4P84A 4E2YA 2RHDA 1SOAA 5FOSA 3STHA 4KAJA 5F5NA 2F9LA 4ESHA 1LFAA 4BNDA 3H2IA 2D4HA 1ZJ5A 2YWGA 4ZQIA 3RSGA 3LI2A 4H1VA 1SXJC 2FZGA 1J09A 1JG2A 1SCJA 2V6BA 5FXMA 2WIFA 3ZW7A 4TRJA 2R9VA 2BZGA 1A9XA 3HM9A 3IPYA 1KHHA 1JF8A 5AI0A 1FS6A 2VP0A 4OPMA 1KU0A 1RHMA 1NSTA 3PXGA 1JSRA 1XDZA 3LL7A 4CRWB 3TQRA 4PG8A 4D9FA 2QBYB 1YDEA 3MTBA 1HNXB 4L76A 2VBFA 3KO8A 1O7JA 2GKGA 2QN1A 3MF4A 4M2LA 3U6KA 3RRMA 2WB4A