3S2FA

Crystal structure of furx nadh:furfural
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
340
structure length
340
Chain Sequence
AMMKAAVVRAFGAPLTIDEVPVPQPGPGQVQVKIEASGVCHTDLHAADGDWPVKPTLPFIPGHEGVGYVSAVGSGVSRVKEGDRVGVPWLYSACGYCEHCLQGWETLCEKQQNTGYSVNGGYGEYVVADPNYVGLLPDKVGFVEIAPILCAGVTVYKGLKVTDTRPGQWVVISGIGGLGHVAVQYARAMGLRVAAVDIDDAKLNLARRLGAEVAVNARDTDPAAWLQKEIGGAHGVLVTAVSPKAFSQAIGMVRRGGTIALNGLPPGDFGTPIFDVVLKGITIRGSIVGTRSDLQESLDFAAHGDVKATVSTAKLDDVNDVFGRLREGKVEGRVVLDFSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Zinc-containing alcohol dehydrogenase superfamily
publication title Crystal structures and furfural reduction mechanism of a bacterial zinc-dependent alcohol dehydrogenase
rcsb
source organism Ralstonia eutropha
total genus 108
structure length 340
sequence length 340
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3s2fA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3s2fA01
1A7KA 4R9RA 1B14A 2V6BA 3HADA 4ND5A 3WQSB 1U8FO 4YACA 3GEMA 2BFAA 5L3ZA 3WG9A 2AW5A 4BL5A 4CV1A 3K2EA 1PQUA 5EL0A 4UVEA 1QYDA 3GNTA 3ONFA 3AY6A 4MKZA 1UXGA 4YXFA 3OQBA 1XDWA 2QRJA 2AE1A 2DBRA 2PD4A 3GR6A 4XIJA 1DHTA 2JD2A 3FBTA 3GVHA 4HFMA 1BMDA 4BNLA 4BO9A 4ALMA 4L76A 1H6DA 1LLQA 2H6EA 3LQFA 5BQFA 1VKOA 1UP4A 2D5CA 5L45A 3ZCXA 2NU9A 4I9HA 4ZJUA 3EDMA 5FI3A 4NK5A 1QLJA 4HXYA 2J3JA 3H3FA 4FSHA 4E3ZA 1NHWA 4O0LA 3RJ5A 3TOXA 3H2ZA 4CQMD 4NU6A 4WEOA 3QVWA 4BUCA 3DZBA 1KY4A 5IZCA 3MTGA 2B69A 1FF9A 4IGFA 2FMUA 4NJOA 2EKQA 3OJ0A 4J9UE 3UCEA 3NAQA 4DGSA 2HMSA 1RM3A 1G0OA 3ITKA 4J2HA 4A27A 2WD7B 4MVJP 3KXDA 5TC4A 3ASVA 1GQYA 4GX5A 4UEJA 4NDNE 3JQBC 3OEWA 2ZATA 5DF1A 5A04A 1EUCA 4DYDA 1W73A 1FDUA 1JQBA 4Z9XA 4TKMA 2H1SA 3KYCA 4X54A 3C1TA 1C1XB 4I5DA 4BNNA 3WJ7A 4OIMA 2WE8A 1HL3A 4PN3A 3PLNA 1E3EA 4J9VA 3OJOA 3VZRA 3I9MA 1EBUA 1BRMA 1H2HA 1TT7A 2B5WA 2Q1WA 2ZYDA 3CMMA 3FR8A 3PHLA 4NJMB 4AFNA 4CV0A 4K9DA 3HQ4O 3LT2A 3VTZA 1LDYA 1EUZA 4UVDA 4YB8A 4A26A 1NXQA 2C07A 1IHXA 2D2IA 3UAGA 5IN4A 3E18A 2J8ZA 1SCUA 2I3AA 5JY1A 4W9NA 3RUEA 1QYCA 4M1QA 3VDRA 1X14A 3JQGB 3DTYA 2X0RA 1I3LA 1D1SA 1PWXA 4FFOA 1DDOA 1M76A 5KWEA 3MOGA 3GDFA 1K5HA 2QW8A 2VHXA 3GRKA 3WYBA 3H2SA 3AUSA 1UJMA 3EYWA 1KC3A 2VUUA 2D1YA 1GQ2A 2P4QA 4TKLA 2PA3A 3WX0A 1MB4A 5C3MA 2OOSA 3A14A 1GL3A 3NX4A 5T8KA 5JDIA 1EK5A 3K9QO 3OIGA 4HFNA 2FZWA 2OP0A 1LSSA 3EZYA 4YEDA 3EVTA 4MVJM 1P1JA 2OP1A 4KZPA 1NP3A 5H81A 1NQOA 3ZU3A 4OGWA 4UREA 4DL9A 1P1IA 3KLPX 2Y1GA 4D42A 4MOWA 2BMAA 2R6JA 2VHWA 1C1DA 1RKXA 4AG3A 5JBIA 3OF2A 2IXAA 1PL8A 5IFLA 1HDOA 4DREA 2G0TA 3F4BA 3R3JA 3GHYA 4R01A 1DIGA 1IY8A 3WGOA 3PWKA 1DIBA 4BNZA 3K73O 1Y6JA 3C8MA 4NHEA 5GZ6A 3IKTA 1R6DA 2RHCA 4OOFA 4XYMA 4ZVVA 4J3FA 4WGGA 3W4JA 4E5MA 1KOLA 1LRLA 4BNKA 4YT2A 5JCJA 1EFLA 1CETA 1XKQA 4NZ9A 4Y6RA 1B7GO 3HE3A 5HS4A 1Z82A 2PZJA 1E77A 3IIEA 4BMSA 4ZICA 1O5IA 3BMOA 4OXKA 5LDHA 4WKGA 2VZ0A 1PU2A 3ADPA 1H93A 3DBLB 4BGEA 1LQTA 4YT5A 1JN0A 4UUNA 1SO8A 4MVJI 1K2WA 1IE3A 2Q2QA 3I52A 4NNJA 4WUVA 3WS7A 3K6JA 4U0KA 1N1EA 4EI2A 3AK4A 3G79A 5BSEA 3DZGA 4J0FA 2IYPA 3DFZA 4DIOA 3Q9UA 1EE2A 4ND1A 1Q7GA 5TLSA 5MGBA 1JVSA 3WTBA 3QWIA 2J5QA 5IDYA 1OFGA 5A9SA 1DAOA 1ML3A 4JP2A 3NT4A 1IPFA 3U4HA 4GX2A 3GOHA 3D3EA 3H9UA 2PTGA 2UYYA 5LC1A 3DAFA 4J90A 2AXQA 2C5EA 5KJFA 4NBTA 1N7HA 3ZNQA 4IINA 2ZTVA 4GX1A 3BHJA 3TZKA 4B8WA 2Q2VA 3H5RA 1DC5A 3BTVA 4RV9A 4E2XA 4FCCA 3D0OA 4J4TA 2VYND 1E92A 3I1JA 1X1TA 3N74A 2GLXA 5BNIA 5G0TA 3SC4A 1JW9B 3DHEA 2X23A 3DXFA 4MVJF 1DB3A 1NASA 4WCFC 5A3VA 4N18A 3D3WA 4ZRMA 3SEFA 1GUYA 1Q2XA 3PJGA 4U5QA 1NR1A 3PJFA 1OAAA 3VAZA 2QRLA 3M6IA 4W7HA 2B37A 4BGIA 1JA9A 4BO2A 4I8XA 3NGLA 1E7RA 3G0OA 4CM8B 4CM7A 5T64A 4B7CA 1PS9A 3QP9A 2A9FA 3U62A 2Y67A 4FJ1A 3GUYA 3M1LA 2EJVA 4MIOA 5G0UA 2ZB4A 3JQ8A 3D4PA 2B5VA 4JBHA 2HK9A 1B8PA 5AXDA 5A9TA 1EZ4A 3OJEA 3UN1A 4ALLA 5KCZA 5B12A 1VSUA 2JHGA 1M6WA 3FHLA 4DVJA 1I8TA 1Y81A 4KDEA 1QRRA 5G0SA 2UV8A 3L6DA 3RC2A 4PZDA 1XSEA 4B7UA 3F4LA 4TRRA 2YHUA 2X9NA 2QG4A 2VHZA 3CINA 2ZYAA 1HDCA 3HJAA 3KYDA 4GGPA 3WBBA 4BKRA 4PCVA 4IDDA 1PJCA 4RORA 1DFGA 1IZ9A 5JXWA 4M89A 3SLKA 4YJFB 3F1KA 1SEPA 1VE9A 3PQEA 4ALJA 1ENZA 4E5KA 2RIRA 3AI2A 4CLEA 3GVCA 3L0DA 1CWUA 1TA4A 1R0KA 1YXMA 2VHYA 3A9WA 4R51A 3RFTA 4BNGA 2AHRA 2DVMA 5CEEA 4J1QA 4CL8A 1PJ2A 4IZHA 4OHUA 2PK3A 4BNJA 3KVOA 3U49A 3ONEA 2GZ3A 5IZ4A 3B1KA 5JDCA 2BHLA 1I32A 3HN7A 2H5LA 4WK6A 3O8QA 4XYGA 4CLOB 4PLGA 1WDLA 1N5DA 5JCJD 4J16A 4IJKA 1AUPA 4IDCA 1HTBA 1QYWA 1Z7EA 1X1EA 1P3DA 1LSJA 3WYEA 2OL4A 1BXZA 5C7IO 4RPKA 4KQWA 1K6IA 2GF2A 1T1RA 2AE2A 4FGSA 5AVOA 3HSKA 3VKVA 4JQCA 5BNTA 4INAA 3TQHA 2PZMA 1T1SA 2JHFA 5I7FA 4QO7A 3RUAA 4ONEA 1HEUA 3WFJA 4CLRB 2DPGA 3GG2A 1Z74A 3S2IA 4E31A 4ZQFA 3VPGA 1JAYA 3SLGA 2X58A 3ZH2A 2PFGA 1U4SA 9LDBA 3PI7A 4WCFB 2DTEA 3AM3A 3GFGA 3Q6IA 3IP1A 3M2PA 5G4LA 2J3IA 4QX6A 2V6FA 2P5YA 2LDBA 4K6FA 4PG4A 2DBQA 4B3HA 3WSWA 4J49A 3ZNNA 3EW7A 4ZU3A 3Q1LA 3QWFA 5DULA 3RBXA 5T57A 4MVJD 1CJCA 3GZNA 2WYWA 3GNQA 3S55A 3VH3A 4GH5A 4ILKA 3KHUA 4I5FA 4JJIA 4EITA 1TXGA 3PEFA 2FR1A 3MOIA 2O2YA 1M2WA 1HZJA 3JCZA 3F9IA 3MEQA 3ROMA 5TS3A 4I1IA 3W8FA 5FI5A 1GY8A 4JK3A 1U3VA 1P0FA 3UGKA 4BKUA 3G49A 4ZN6A 4EDFA 2FZEA 3CXRA 3PWZA 4AJHA 4BQRA 3BAZA 2IDZA 3FNHA 3HDYA 1ZBQA 1KEVA 5KTKA 2EGHA 3QV1A 1P33A 4BQPA 3JQAB 1I0ZA 4IXWA 1DLJA 3DMTC 4YAJA 1YOVB 1NR7A 4HFJA 5AXAA 4Z6KA 3WWYA 5IDXA 2HMUA 4I9UA 1DIRA 3V2UA 3KETA 2CDAA 4Y67A 2W2LA 1YONA 3G17A 4RDIA 3AJRA 1Y8RA 4J7UA 3E8XA 1KVQA 3JQFA 5ICSA 4MVJH 3W8EA 4E0BA 1SAYA 4FFMA 3DBRB 3DONA 3ZHXA 4EYEA 2VOJA 5IDWA 5JPIA 3ANNA 3QA9A 4R1SA 2HO5A 2RH4A 3TDKA 2CSUA 5G4KA 2B0JA 3PYLA 5I7EA 2FR8A 2DFDA 4HNHA 4WCDA 5FWNA 1T2CA 3PYMA 4M54A 2Z95A 2IRWA 4YCAA 5EJ2A 4RF3A 4L73A 1E3WB 4NG5A 3PVZA 4JLWA 1GYRA 5HM8A 1RJWA 3PJEA 1A4UA 1Y9EA 4CR6A 3GNSA 3P7MA 3K31A 2A4KA 2AQHA 4Z9YA 1KIFA 1CQIA 3MJVA 2A92A 2XOXA 4D3FA 1U3UA 3RBVA 1DEHA 3RC1A 5IZCC 2RCYA 2HQ1A 3HZZA 4L4RA 1IPEA 1HDXA 4RDHA 3VH4A 4EZBA 3WLEA 4N54A 4CV3A 1O9BA 2VOEA 1I3NA 4CM9D 2ZKLA 3K8ZA 4RVGA 3JD1A 4HFRA 3GLQA 4LW8A 1UZNA 2PR2A 1PGPA 1E1LA 4ALKA 4RGBA 3I3OA 4YQYA 2POQX 1H9BA 1OMOA 3DAPA 4EW6A 1TT5A 2PV7A 3UF0A 3V8BA 3COSA 3DBHB 4XX0A 5B4TA 4J4HA 2PH5A 5L9AA 1UUFA 5CHEA 4ZRNA 4Q3BA 1F12A 3AFNA 2I5PO 1E7MA 1H5QA 4R3NA 3UCXA 1MGOA 3BXXA 1R4NB 3AU9A 3L6OO 3LC2O 2D5AA 1PZGA 3JTMA 3LK7A 4OKNA 4Q9NA 3V1YA 4BNHA 3HG7A 1HRDA 1N9GB 4JROA 5K0ZA 1FXSA 4IDGA 1DPGA 4D45A 4GMFA 3JQEA 1VJ0A 1WZEA 3MWDB 3OETA 5L4SA 1BXGA 2OFPA 1R0SA 1Y5MA 2CUKA 4HX5A 1ONNA 4E4YA 2VZ8A 2C0CA 2Y1DA 1W0CA 3DZKA 2DBVO 2EJWA 3PRJA 3NT2A 1HLDA 3HFSA 2BLLA 4XQEA 3GVPA 1AHIA 5DP1A 2YQ5A 1ZMTA 4MKXA 3DHYA 1ZCJA 3KTDA 4W9NC 4EJMA 4WOJA 3G3EA 1HDZA 4MVJG 3HWRA 2YDYA 5EQFA 1FK8A 5JMWA 2YFQA 3PQDA 4EEXA 4EUFA 1KVSA 4NFHA 1NQTA 1AGNA 1GADO 3TZQA 5TGDA 2DBZA 1BHSA 1CYDA 1VI2A 2IE0A 1E5QA 4RVUA 4PFJA 1XQ1A 1A7AA 3AWDA 2YFHA 4IDAA 1YBVA 3NJ4A 5T8KC 5JDIC 2HK8A 4KWHA 1NQAO 2Y1EA 4XYBA 1FMCA 5DZSA 5KIAA 2IZZA 3PHJA 3Q3CA 4A03A 1RYEA 2CDCA 4AJ2A 3INRA 1IUKA 1Z73A 2C20A 5T6BA 4OKIA 3MJEA 2BFMA 4JX8A 1E7SA 4L4SA 3VPXA 1LUAA 3GDGA 2HJRA 4KTVE 4L0QA 4GKVA 2CDBA 3D5TA 2V7PA 3D5QA 4XQGA 4DLBA 2VYVD 4NBRA 3TL2A 1Y9AA 4WOKA 1J49A 3FF4A 4D3DA 4CM5A 3JQCA 3LYLA 1KEUA 3VPHA 4DXHA 3GAFA 2CF5A 2PLAA 3L07A 2WM3A 3GAZA 4RLHA 1PJQA 2WD8A 3HDHA 1ZFNA 2V6GA 3GVXA 4Z0HO 3L9WA 5JC8A 2Y05A 1OC4A 4KUEA 3BZUA 1KEPA 1YBAA 4QXMA 4WEQA 3ZW9A 5IF3A 4DIBA 2GN9A 4IIUA 3NTQA 1CQJA 1LC3A 1LLUA 3BTUA 1GFSA 2JFFA 2QZZA 3V2GA 5BSGA 4B3IA 1WWKA 2HJSA 1BVUA 5TSDA 1T24A 3DAGA 1I2ZA 1JTVA 1CRWG 1PIWA 2DKNA 3QVOA 4MIEA 4OXYA 5IDQA 3VTFA 4QSMA 4BKPA 4IXTA 4FOOA 1F06A 1ADFA 5ILGA 3RWBA 3KYCB 4RPLA 5BNFA 3IL2A 3KUXA 2NUAA 4HUJA 1T4BA 2BGLA 5KKAA 1JLLA 1EVJA 1NTOA 1NYTA 3EK2A 4LGVA 3ITDA 2HLPA 5CFZA 1DBVO 3KRTA 1HYHA 4CMBA 2NU7A 3R1IA 4Z9FA 1OOEA 1S7CA 1UR5A 4DPKA 2AQIA 2B83A 4DLAA 1JKFA 2DUWA 4AJIA 2ZCUA 1YDWA 3WGTA 3WTCA 1E3JA 3E9MA 1W8DA 4CLHA 5JY6A 4XRRA 3Q2KA 1TEHA 7ADHA 1XYGA 1GAEO 4R1TA 5A5FA 3PGJA 3JQAD 3VC7A 3W6ZA 4F46A 4P22A 2AQKA 2AEFA 1ZJZA 4E6PA 2NNLD 1XIVA 3LVFO 1LRKA 2GUGA 4AJPA 4WLUA 1PJLA 2NTJA 1DC6A 3H7AA 4YBZA 1IL0A 4EUEA 2DTXA 1HSOA 3ASUA 3TF5A 3BMCA 3C7AA 4WASA 4Q3NA 7MDHA 1PEDA 5IAAA 2I9PA 1A72A 1ZO8A 3TOZA 3IS3A 4RF4A 3MZ0A 5TNXA 1XGKA 3IP3A 3OJLA 2EWMA 4XGKA 5HS6A 1ZXBA 1L7EA 1V35A 9LDTA 1YJQA 4OOEA 1NPDA 1LEHA 3O4RA 1C1DB 1NPTO 1VL8A 2FN7A 3UH1A 4CMEA 2EXXA 4NI5A 3C7DB 5TT1A 2GD1O 5CEJA 3SBOA 3H5AA 4C4OA 3ZWOA 4CM1A 4KOAA 3CZRA 2CVOA 4WLEA 5TX7A 4FD3A 3VVCA 3FTNA 1MG5A 4DUPA 4HV4A 3TZ6A 3RD5A 2B35A 2JFGA 3AOEA 1F8FA 4ITUA 3ZWYA 1KYQA 1YB5A 2I66A 2O3SA 3KO8A 3BMOB 5A02A 1OBFO 5AXBA 4WLFA 2VT2A 3DZIA 1VM6A 2J3HA 5DBGA 4N5NA 3AM4A 3ADOA 2JAHA 3PHGA 1Z7BA 2G17A 3FD8A 3FPLA 4UUMA 2OORA 1P1HA 4W99A 5EQDA 5TJ9A 2FR0A 3O03A 3SJ7A 3TJRA 3IAHA 3ZWCA 4Z3KA 1UDCA 4B79A 5IXYA 3X2EA 4I5EA 4BV9A 4IGEA 2X22A 4A7PA 2P68A 2RH8A 4MJLA 3F1LA 5JDCC 3ROQA 5CDSA 1QV7A 3MJSA 3OECA 4NQZA 2Y0DA 2HRBA 3K2BA 2GZ2A 4BMNA 5A9SB 2HAEA 4R5MA 1DRUA 3WGZA 5C7OO 1NWCA 3L4BA 2QYTA 1EVZA 3QHAA 2YV3A 2CZCA 2VN8A 4CMJA 4L4XA 1QLHA 4M8SA 1Q0QA 1YKFA 1WMBA 1X7DA 2NVUA 2OBYA 2O2SA 1WNTA 2WYUA 2G76A 3CH6A 1E0DA 4K6CA 4WLNA 2R2GA 4D3SA 4D46A 4FR5A 3WMWA 1G1AA 4TWRA 3AFMA 5KKCA 2VTEA 5B37A 4ZHSA 5ES3A 4XZ3A 2NVWA 2C82A 3I9KA 1AN9A 1E1NA 2O48X 4JIGA 2WTBA 5TJHA 4S1VA 3GMSA 4Q3CA 3RUFA 3D3WB 3I9JA 1GD1O 2Q2WA 3PDJA 1B15A 3RU9A 3ICCA 1B2LA 2WYVA 5GZ1A 1C0IA 1Y5RA 3ANMA 4CMGA 3PQFA 1X13A 2EKPA 1JWAB 2J6IA 1J0XO 1LC0A 2WWRA 2Q46A 3FWZA 4ZA2A 5ADHA 1PR3A 4ZQEA 4NH4A 1ZUD1 2VRCD 3DHNA 5ER6A 3GT0A 3ZV4A 4KUGA 5CDTA 4NFSA 4PG8A 2WDZA 4WE3A 2Q3EA 3RKUA 3CSDA 4BOYA 4D41A 3TFOA 3CZMA 1BG6A 1J6UA 3LC1O 3DC2A 5ENDA 4DYVA 1E3LA 4YJGA 3RUDA 4HNGA 2C54A 2P9EA 3JQ8B 4G5HA 1WLYA 1DJNA 2XAAA 4GX0A 4HP8A 3W4IA 4YAKA 4ID9A 4XB2A 1FDWA 3Q9NA 4BNUA 3JYNA 4B4OA 2BH9A 4IIVA 2P5UA 2I67A 2J3KA 3I6IA 3QVXA 4Z0PA 3TZCA 3KV3O 3DQPA 1ZMOA 4DTIA 1F17A 3KYDB 2VUSA 4Q39A 4BO6A 2WJPA 5CPBA 4DA9A 1Y8QA 3HFGA 4CM6A 4IPTA 1FDSA 4YAGA 4GPD1 4YWJA 2X86A 3RAJA 1KERA 5DBIA 2X9GA 4CUZA 2ZYGA 3E03A 1Z45A 5F21A 2IXBA 5TT0A 2VNSA 3LDHA 5CDGA 1MXHA 3TN7A 2DLDA 2JFHA 3ETEA 1ZKMA 4MKRA 1DLIA 3JQFC 1BGVA 3QIVA 1U1IA 4IDFA 4MO2A 2I65A 1A5ZA 3R6DA 2AEJA 3QY9A 4YJHA 1K89A 1ZJYA 4CM4A 1VRWA 4TVBA 3MTJA 3IUSA 4U7WA 2J5RA 4FGWA 4EJ0A 4PLTA 3BMNA 2IEBA 2D4AA 4BNXA 2HU2A 3F6YA 3K96A 3O8QB 1K3TA 1PJBA 1GYQA 2NSDA 1W4ZA 3PGXA 5EIOA 3KZVA 2ZB7A 1V6AA 1ISJA 2PD3A 5ER9A 1G0NA 2X1HA 2EF1A 4PLFA 3RFVA 1CEQA 3EZLA 4J43A 1BTOA 3W6UA 2B4TO 1E6EA 5JCXA 3GDOA 1HE3A 1DC3A 4NMHA 2AMFA 2C7VA 2HK7A 2Z1NA 3FWNA 1LQUA 1SOWA 1LLDA 3GVIA 4CR7A 3I9LA 1B3RA 2C2XA 5JAQA 1NAHA 1MUUA 5AXCA 5COAA 4BNIA 4E33A 2O3QA 3RUHA 2NM0A 2Y68A 4B4VA 4B4WA 1ADGA 1AXGA 5C5IA 4UVIA 1IZ0A 1QXSA 3ZHBA 1MC4A 3WB9A 4LCJA 3F46A 2VCYA 2GN8A 2UVDA 1YO6A 3NDRA 4NBUA 1YDEA 2O7SA 3WSVA 4L9RA 2OBNA 3GK3A 3BTSA 3MWEB 2Q1SA 5FYDA 2DUUA 5F1PA 1R16A 4D0RA 3GZNB 4OSPA 3VPSA 4OYRA 3H4VA 3KEQA 3RU7A 5FEUA 5KVSA 5A05A 4GL4A 3ZV6A 1B8UA 1U8XX 3S2GA 3LT1A 3M2TA 4XA8A 3Q2IA 1ENPA 4OAQA 4BO8A 2ZIZA 4BNTA 4CMHA 2SCUA 2GZ1A 1YQDA 1L7DA 3WBFA 1VC2A 3P5SA 3RI3A 4UUPA 2Q50A 3FN4A 2OMEA 4RLSA 4BO0A 2G82A 2VWPA 4LRSB 3U5TA 2YW9A 3AY3A 2UUPA 2HMWA 4HY3A 4NBWA 4R3WA 4XJTA 4ALNA 4G65A 1TLTA 5GZ3A 4AJNA 1GZ4A 2E49A 5CPFA 1EMDA 2X0IA 4JJGA 4QEDA 4GGOA 5BR7A 3JD2A 1EEHA 3IQDB 3HUDA 4PRLA 3ZWPA 3OA2A 5HTOA 2ZB3A 3P19A 1E1MA 2GASA 3L6EA 5EN4A 4TSKA 1PX0A 3PHIA 2BELA 5CG2A 3FR7A 3ZWXA 3C85A 1I10A 2P91A 3R0IA 4O5OA 1Y8RB 3DTTA 3TNLA 3U0BA 1VL6A 3E5RA 4J1SA 4CQLA 3U4DA 2YYYA 1KY5A 1HE5A 3IMFA 2D8AA 1N2SA 4YRBA 2JAPA 3UCFA 3L4SO 2JD1A 1UXJA 2QQ5A 5DBFA 2JCYA 3CMCO 3GMDA 5G4KB 5I8WA 1ISHA 3PFWO 1H6BA 1ZNQO 2DTDA 4CMAA 2O4CA 4Y98A 4MP3A 3PLRA 4CPDA 3GHHA 4AL4A 3FNEA 4GVLA 1N92A 4I5GA 2CFCA 2VNAA 3WNVA 3IDSA 5KNLA 1PJSA 2FPGA 2R00A 4B3JA 1A27A 2AEMA 3FNGA 5I7VA 5KVVA 1ISFA 3UICA 4N5LA 1RM0A 2W98A 1NAIA 3RROA 4O1MA 2H63A 2CMDA 4HKTA 1M67A 1YB4A 1W6UA 2DPHA 4FQ8A 3U9LA 1EQ2A 4M49A 1SZJG 4K26A 2NQTA 4XR4A 3U4IA 3PK0A 3PWSA 5CEFA 3GPIA 4UVHA 2RBEA 1I36A 1H9AA 4BO4A 1GYPA 3BIOA 2OXIA 4D79A 3CTMA 4AJKA 4XRGA 2C29D 1LU9A 4YPOA 2Q99A 4E2YA 2CVZA 1GDHA 3BTOA 2AQ8A 4ZQHA 3TWOA 1VKNA 1TT5B 2UDPA 1HYGA 1P1FA 2XF8A 2F1KA 2VWHA 1J5PA 3EC7A 3S8MA 4A0SA 1PSDA 4FS3A 3ICPA 1BW9A 2QX7A 3A1NA 3GN1A 5FFFA 3VKUA 4OQYA 1XWFA 1P45A 2TMDA 4RQUA 3RC9A 4TRMA 1X7GA 3DL2A 2LDXA 4IY1A 5A5EA 4IBOA 3U09A 3CIFA 1F14A 3PIDA 1HT0A 1YL5A 2BI7A 1BXGB 4R41A 2E4AA 3ULKA 1MFZA 4KQXA 1R4MA 4IM7A 3JQ9A 4UAGA 2YY7A 2FPIA 4XB1A 3KEOA 4GSLA 2ZTMA 3O38A 1LBEA 3BMQA 1NHGA 2BF7A 4PLZA 4Q3EA 1E7QA 3WGIA 2AG8A 1VPDA 4BGVA 3DMYA 4IJWA 3E9NA 5TIIA 4IDBA 4BO5A 2HDHA 1PJTA 3WGQA 3NGXA 3OEYA 4U6QA 1S6YA 4W4TA 4CUKA 2EW2A 2PH3A 4GWKA 1U7TA 1FJHA 1SMKA 4L75A 5AQ1A 1N8KA 3TL3A 1ZEJA 1PTJA 1E3IA 1UH5A 5L7WA 1A71A 3KSZO 1Q7CA 3KSDO 4U6SA 3B70A 3M1AA 4P4GA 3ABIA 1UDAA 4XIYA 2DT5A 2W2KA 5DN9A 4FBGA 1JKIA 5HWSA 4D7AA 2YV1A 2D0IA 3EAGA 4R69A 2WEKA 2HRZA 3NRCA 4PLWA 3S2EA 4CJXA 1GEEA 3ST7A 2VZ9A 2C2YA 2VHVA 5B4UA 2GO1A 3E82A 4A5OA 4S3MA 5L95A 4ND3A 3QW2A 2JD0A 3ON5A 4CMEC 5JAIA 1ISGA 1ZK4A 1WW8A 5CAEA 3RUCA 4DWVA 4E5YA 3EHEA 4IMPA 2WSBA 4D0SA 4EUHA 1G6KA 1LDGA 1HETA 4H16A 4I9NA 4RJTA 1NNUA 4NPCA 3CKYA 3AOEC 3FTPA 2DFVA 4RPJA 1ZK3A 3VH1A 3AM5A 3JD4A 4CL3A 4TMFA 1VLLA 4BNFA 4ESOA 3AW9A 1DRVA 1F8GA 4W6ZA 5K6AA 4QO8A 1GU7A 1PJ4A 3ETGA 1ONPA 2B4RO 3RJ9A 1HZZA 3H9QA 4PLCA 1NM5A 4RO0A 2GSDA 4WLOA 1T4DA 3E48A 3RBZA 1A4IA 3Q0EA 3ZV3A 4PVCA 2V65A 2PWZA 3DOJA 4IS3A 2V6MA 5U9CA 1JKJA 1DOHA 1M6HA 4CR8A 2EV9A 1F0YA 2GNAA 4YT4A 1IYZA 1IB6A 1ARZA 3FCOA 5L53A 2PKQO 2X0JA 4GLOA 4NBVA 4QT0A 3ZWNA 3I9NA 2X5OA 2X6TA 3L4BC 4KDFA 4XCVA 3VH2A 1PZEA 1E5LA 1U5AA 5DP2A 3ZHYA 4RPHA 2C59A 4XQCA 2YJZA 3WWZA 4D43A 3ZN2A 1LTHR 4XKJA 3SXPA 3PZBA 4CQMA 2NACA 4MDHA 2JCXA 3NEPX 3ZU4A 1HDRA 3NYWA 4KWIA 4BO1A 1KVUA 1BSVA 2IODA 1U3WA 4GWGA 5AYVA 3WXBA 4E12A 1LNQA 3GUCA 5JNLA 3ZWAA 2EP5A 2Y1OA 4TVOA 3PYXA 3TPCA 3C7CB 4F3YA 2OGUA 1I2CA 4OO3A 3T4XA 1HE4A 4NR0A 4O63O 4B8ZA 1P44A 1P77A 4A2CA 1O8CA 3C24A 3NTOA 1K6JA 1PL7A 4Y6PA 5F5NA 2YUTA 3WMXA 4GKBA 1WDMA 2P9GA 5DCUA 1WXDA 3OMLA 5CG1A 1RPNA 1ONOA 2UUOA 3LT4A 3GN2A 2EKLA 2NLOA 1O94A 2VQ3A 2W2LD 2F00A 3BHMA 3BMCB 2FPPA 3UUWA 3E6AA 4AVYA 3LF1A 1XELA 2NVBA 4RVSA 2B4QA 4CUJA 1RM5A 3PFFA 1V8BA 5MDHA 3D4NA 4FJ2A 1WP4A 1YRLA 3GFBA 5F5LA 3H9EO 3BYZA 4PLVA 1P1RA 3W8DA 3PDUA 1ULSA 3LC7O 4J7XA 1YVEI 1MLDA 1D1TA 1XG5A 1O6ZA 3PZRA 1VSVA 3W1VA 4BIIA 3RFXA 1U4OA 3NDIA 4FFRA 4BGUA 4J0EA 1B16A 4F6LA 5DOZA 3EGOA 4IJUA 1EBFA 4HWKA 4DPMA 1KC1A 1GPJA 5A03A 4Z3DA 2Y99A 1T2AA 4RVHA 4PRKA 4R1UA 5EESA 3MJCA 4CM3A 1GCUA 1NWHA 5F1KA 4M87A 1MA0A 2E48A 3OJFA 2BFPA 8LDHA 5ENVA 4R54A 3I23A 1P74A 1BDMA 3LZ6A 3IC5A 4NFYA 3AUUA 3GY0A 1FDVA 1HSZA 3OH8A 3QSGA 3DWFA 4JNKA 4N5MA 2D59A 2FSVA 3EMKA 4ROSA 3JYLA 3TZHA 3K5PA 4TZTA 3WICA 4PVDA 4IQ8A 5IN5A 3LSYA 2Z1MA 2Z5LA 1EK6A 1WAMA 3OIDA 5LDGA 1BDBA 2YHIA 3QJ5A 4BS9A 5A06A 1V9LA 2FWMX 1MFPA 2NVUB 4R16A 3QRWA 1YGYA 5I9LA 5KJ1A 2Q4BA 4XGIA 1D8AA 2W4QA 2GGSA 2NU6A 3LU1A 1P9LA 4L8VA 5KJ6A 2QZ9A 4BNWA 4OM8A 1ENYA 4AICA 1PS0A 3UW3A 5A3JA 1T2DA 2PZKA 2IZ1A 3CPSA 3EUWA 3HN2A 3N58A 3MJTA 2X0NA 2O3JA 3LLVA 4CODB 4E5PA 5JAMA 2X9VA 1BWSA 4K1LA 4AJ4A 4CMIA 3GH3A 3PP8A 5L7TA 5ITWA 1GR0A 1ZK2A 2GN4A 2RAFA 1ZH8A 1J4AA 3JV7A 4R68A 2HUNA 3JQ7A 4JCOA 2ZTLA 5EINA 1QG6A 2X5JO 3JQ6A 2I6TA 2X5KO 3I4CA 1LDBA 1I30A 3B20A 4RVFA 4DQXA 4LMPA 2Y66A 1V3TA 1OC2A 1ZK0A 4Y8VA 4WJZA 4YJGB 1LSUA 1LXCA 5COBA 3UFXA 3D7LA 1CIVA 2WE7A 4L74A 4BNYA 1HE2A 4XYLA 3JD3A 2VYNA 4JBIA 4FJ0A 5L51A 1KEWA 1MG0A 4JXKA 4LSWA 3ZNPA 3ENNA 4XWYA 2E37A 3UVEA 4NK4A 3MCVA 1NFFA 3KBOA 1EVIA 3A28A 4AJJA 3Q11A 4DQUA 1EFKA 3KYBA 5F1OA 1UAYA 1P31A 1HKUA 1U7HA 5FF9A 2CD9A 4FC6A 4GAEA 1Y8QB 2FHSA 1QYVA 3FPCA 4C7KA 1E7WA 3F5QA 1CERA 1RM4A 2YZ7A 3OA0A 3OQ1A 3RSHA 4YT8A 1SOVA 4P4LA 2O3UA 3F3SA 4DIFA 3S2FA 1EDZA 3DEYX 4UUOA 5L7YA 1LDMA 3SX2A 1EE9A 4BB5A 1UDBA 4FN4A 4IZIA 1XHLA 4XYEA 3FSRA 2WMDA 2VTDA 1NPYA 2VUTA 5B1YA 4O6VA 3JYPA 2DM6A 5ICMA 2GRAA 1B26A 4YJHB 2JKVA 4RCVA 3U4CA 3ZDFA 1MX3A 4CM4B 4OJNA 1U2GA 4DRYA 4UVGA 4KUHA 1C0PA 3QWBA 4BB6A 1C14A 1ORRA 4JJFA 4LISA 2QYSA 3BMNB 4BO7A 4IQ0A 4LVUA 3H6KA 3QVSA 3G1UA 4LMRA 4XR9A 3O26A 4EBFA 3WGGA 1KS9A 2EIHA 5DCYA 2FOIA 4BHTA 1BVRA 2O23A 3S1LA 3DZHA 3VZSA 2FRDA 4YRAA 4OXNA 2OZPA 3DDNA 4H3VA 3GG9A 3VZPA 4BKQA 2HKIA 3INGA 5JC1A 1SPXA 3QE3A 2R00C 4BO3A 4E32A 1XU7A 4JBGA 4ND4A 3WGYA 1GUFA 3EVNA 1YJ8A 2CY0A 4G81A 2J5KA 5TRTA 4TQGA 1JU9A 4PG5A 3TSCA 5IXSA 4LSMA 2A35A 2FSSA 2O50A 3N7UA 3QQPA 5JAZA 5TF4A 3OIFA 2HSDA 3U3XA 3ZWWA 4JP3A 3VPFA 4Y6SA 2QRKA 1H6AA 3FNFA 4DQVA 6LDHA 2WD7A 3VOSA 3WLFA 3ETDA 1HYEA 1IOLA 5KJEA 4J91A 1JAXA 1LI4A 4JGBA 4GQAA 2EG9A 1PZFA 2PNFA 2O3RA 1NVMB 3P2YA 4PLHA 1T2EA 3V2HA 1ADBA 1Y7TA 1HLPA 3E9QA 1ZSVA 1C1XA 1PGNA 1PGQA 1T2FA 3AUTA 1MXFA 1Q0HA 1QV6A 5THKA 5LCXA 1UP6A 4XJSA 3CEAA 3HDJA 1AXEA 3H8VA 1C3VA 1EUDA 2DAPA 4PZEA 1XCBA 1V3VA 1YL6A 1JDJA 1XA0A 3X2FA 1DRWA 3VHRA 2ILTA 3JQ9C 5T5QA 4NJMA 5B4VA 3HNPA 5G2OA 4N7RA 5U1PA 4DC0A 1PWZA 1SB8A 1E3SA 2X7HA 2EW8A 2YDXA 1NVGA 3DOCA 3OSUA 4LRTB 4AJ1A 4WECA 2VWQA 3UKOA 3SJUA 3JQGA 2D3TA 2PZLA 5G0WA 1HDGO 3JQDA 3A4VA 5AOVA 5TQVA 4B4UA 1C0KA 4MVJA 1PR9A 1L1FA 4EEZA 1DXYA 1I01A 1I3KA 4E2ZA 4Z0TA 1DSSG 4CQLB 4EGFA 4JN6B 4XDYA 2Q45A 1LDEA 1PGOA 2UAGA 1UXHA 4YQZA 4YAEA 5BT9A 5I9MA 2NTVA 1RYDA 4R1NA 4GLLA 4LCEA 1LA2A 1GZ3A 4O59O 2Q4EA 3QWAA 2I99A 4KMSA 1XLTA 3RVDA 4B7XA 4BV8A 2QHXA 3NKLA 4YAIA 1FDTA 4FW8A 4FFLA 1EVYA 3WQQA 5HBRA 3I4FA 4MVJE 3WQRA 3DFUA 3B1FA 5L4NA 3E5MA 3HDQA 1EDOA 1ADCA 4TZKA 1R12A 1GV1A 1YE3A 1Q1NA 2GERA 3H65A 2ZJ1A 4EJ6A 3H9GA 5JSFA 3L9XA 1N1GA 4P4NA 4FPXA 6ADHA 5JYEA 1CF2O 2Q1TA 3G1TA 2XXBA 5GY7A 3RQSA 1NX6A 1GTMA 5CDUA 3I6QA 5GMOA 1SEVA 3H5NA 1X0VA 1T26A 1E6WA 4BNVA 3AU8A 2PGJA 3OHSX 2E82A 4ZD6A 4GMGA 3INTA 3OP4A 3DBLA 4PLYA 5K6AC 5JLAA 3C3XA 3GEDA 3KB6A 1I33A 4GI2A 2ZB8A 5JO9A 4QECA 1YWGO 2EERA 3HB5X 1LRJA 2PKRA 1QR6A 2NV6A 1D4FA 3JQBA 2EP7A 2RHRA 4LN1A 1PQPA 4YDRA 3ZWBA 4MP8A 2CNBA 3QVTA 2B36A 1BW9B 4II2A 3I5MA 1PS8A 1X15A 4ND2A 3ZU2A 1M66A 2JJYA 4TROA 3WR5A 4IS2A 1DIHA 1JWBB 1UXKA 3QWHA 1OI7A 1R0LA 2ET6A 3AOGA 1R4MB 1VJ1A 2HMTA 3CUKA 3OFSA 5EERA 3ZV5A 4A73A 3LF2A 3ZHZA 5K1SA 3DBVO 3IUPA 5KOIA 3GF4A 3T7EA 4FC7A 1DFHA 4CM9A 3BMQB 1EQUA 4ALIA 4W82A 1GEGA 5JO0A 1GQQA 4J6FA 3RCBA 5H82A 1XEAA 1XR3A 3T4EA 2BGMA 1VJTA 4NIMA 4ZGWA 4R4JA 4E30A 1SBYA 4GSKA 3ZGYA 1YQGA 5G0VA 2QIOA 4FOSA 1NFQA 3A06A 3WOHA 3R3SA 1PZHA 1CDOA 1ZSYA 4XDZA 1P0CA 5DDIP 3STHA 2BFOA 3B1JA 3AUAA 2NWQA 4U8GA 5JS6A 1A9YA 1NBOA 1JVBA 5CP8A 3GGOA 4XQ9A 2BKAA 4CM8A 4FB5A 3H9JA 4HBGA 3UXYA 3LT0A 2W2KB 3UHAA 1ZXLA 4YYZA 3IKVA 2O4UX 1U28A 5A1TA 3K30A 1H94A 4J7CA 1HF3A 1U3TA 4QTZA 4NU5A 1YL7A 4CLXA 1ISMA 2FP4A 1LSOA 3NV9A 1XQ6A 4R5HA 3QLJA 1ID1A 4H7PA 3VDQA 3F47A 1QYXA 4YR9A 1UZLA 1ZZEA 4AJEA 1E6UA 3NDJA 5COQA 3NTRA 3NJ8A 1MC5A 3KOUA 2PGDA 2YQ4A 2P9CA 3PJDA 2PD6A 4ZQBA 5KVQA 1BXKA 4RZHA 1Q0LA 4YJFA 4F6CA 2NADA 2NTNA 2P4HX 3DR3A 1ZVMA 4YVFA 1B0AA 2EHDA 1I3MA 4D44A 4K28A 2ZQZA 3UOGA 1NQ5A 1PGJA 2P2SA 4A10A 1UP7A 4II3A 3ZW8A 3DZJA 2DQ4A 4M55A 3ZWVA 2W90A 3ONDA 4BNMA 1IHYA 2I76A 1U2DA 4OH1A 4BVAA 2IEDA 1B8VA 1O0SA 1TB4A 2GCGA 3GQVA 3WGHA 2Y1FA 1YBMA 2C7GA 4YTEA 1V3UA 3D1LA 2Q1UA 3WIDA 1I24A 4CLDA 1IULA 1XU9A 2JCVA 3I9OA 3I83A 4CLOA 3WIEA 1ZIDA 2VYVA 4J4BA 4PLPA 1P1KA 3GC6A 3HB4X 3RUIA 3F5SA 1UAGA 3AI3A 1SNYA 3C1OA 2PKQP 2TMGA 3GZ4A 5JW6A 2VRBA 4IJVA 4DPLA 4E21A 1D3AA 2FY8A 3FRJA 4CQMB 2XPCA 3PXXA 4FIZA 4URFA 1Y1PA 5BSHA 2PGLA 4YJDA 4G2NA 1QP8A 4R9SA 4CLRA 3C1AA 3JYOA 4IQGA 1R15A 1ULUA 2Q49A 4UEOA 1H6CA 3GA0A 4YRDA 1KVTA 3PPIA 3T7CA 1PQWA 5L40A 3ORFA 3BHIA 3ZU5A 4RZIA 4YA6A 4DBZA 1TI7A 4H15A 1O95A 4WCFA 3H3JA 1KETA 5HRUA 1X0XA 3WFIA 2DC1A 4OSOA 1GCOA 3OQ6A 4WNIA 5I8ZA 1V0JA 4BMVA 4DC1A 3OICA 3WDSA 2GPTA 2BD0A 1I5RA 1ENOA 2C5AA 2O3TA 5I9NA 3EY4A 1AHHA 1U5CA 2XXJA 4OQZA 4F45A 5BSFA 3JSAA 4DLLA 3ANLA 4MPDA 4RPGA 3IJPA 1Z75A 1GZ6A 3NUGA 2JL1A 3FBGA 4CMCA 4E5NA 1MP0A 3PTZA 4WLVA 3RIHA 4W7IA 4C7JA 3SVTA 3FI9A 3ROPA 1DC4A 2VWGA 1SC6A 3GGPA 4RF5A 3GEGA 4J2OA 4DBVO 1WVGA 1H2BA 1ZW1A 4UEKA 1GPDG 5A4DA 2BI8A 1H0KA 2NU8A 5THQA 2X8LA 4XD2A 3ZNOA 1KBZA 5ITVA 1ZSNA 4OL9A 2OO5A 5JE8A 5JFOA 3E1KA 3OM9A 4PGFA 3ZWMA 4E2WA 3JQAA 1RWBA 1T25A 2X4GA 2BRUA 1QKIA 3O9ZA 2GN6A 2ZJ0A 1YOVA 4Q3AA 1N7GA 1MV8A 4J1TA 5F3RA 4MIYA 2G5CA 4MP6A 1DO8A 5EMHA 1ZK1A 4IDEA 5I7SA 1WMAA 3ENKA 4QQRA 1E7YA 4QFCA 3DB2A 4KP7A 1HWYA 1E1KA 3AI1A 4M86A 3AY7A 3GPDG 1U9JA 3P2OA 4HADA 3OBBA 4GBJA 5T67A 3GRPA 4PG6A 3RKRA 3DOOA 4AJOA 3V5NA 3DBRA 5CDYA 2HCTA 4PIVA 1UXIA 3KSUA 1ZEMA 2ZTUA 4UULA 1R66A 4IMRA 2CF6A 1WDKA 2O7QA 2OHXA 3CE6A 4Q3DA 4LVCA 4PZCA 4XGNA 4CMKA 3L77A 5K9ZA 1DJQA 1YB1A 4FDAA 1YS4A 1WZIA 4WNCA 3ZI0A 4XEHA 1M75A 3JD0A 1K6XA 2G1UA 1E3WA 2H9IA 5JYDA 1TVEA 1LDNA 3K92A 2BGKA 2AA3A 3V1TC 1YH3A 2DU8A 1YQXA 5A9RA 3VZQA 2Y93A 2YHIB 1QMGA 2GDZA 8ADHA 5U4QA 1LLCA 3D4OA 4Y9DA 5H83A 1KVRA 1GUZA 1Q7BA 4U0JA 3WYCA 1PJ3A 1UZMA 3IOYA 2IYOA 4AJLA 3RC7A 2OUIA 2NQ8A 5C37A 4MINA 1ISIA 4I08A 1WPQA 3W4KA 2E6UX 3RASA 1NFRA 1K0UA 4LK3A 3KLMX 2IZ0A 1DFIA 2PY6A 5DCWA 3PHHA 4P38A 4CV2A 2EEZA 3JYQA 3PIIA 4QFDA 3GGGA 3DBHA 2A94A 4CMIB 3WJAA 4TRNA 1GV0A 2HMVA 5HA5A 1R37A 2ZK7A 1R4NA 2I3GA 2Y0EA 4RQTA 4PG7A 4P8RA 5J23A 1N9GA 1D7OA 3HHPA 3JQ7B 1DHRA 3TFQA 1VL0A 1DAPA 4FFNA 5ILOA 4QUKA 1HDYA 3D64A 3VVBA 2ZCVA 3BA1A 5C7LO 5DOVA 5IJZA 1I2BA 3IJRA 3NT5A 3LLSA 2CVQA 4E13A 1LX6A 1O89A 1OZAA 4IUYA 3V1UA 3ROKA 5EPOA 4KTTE 3DZFA 3WNQA 1QORA 1AE1A 1DIAA 1A9ZA 5DT9A 3B6ZA 5DNAA 2EGGA 5JMPA 1SB9A 4FFPA 4RVDA 3ZZNA 5L4LA 2VT3A 4RF2A 2YV2A 3DO5A 1B3BA 2ZQYA 2AG5A 1X7HA 3DMTA 4TRJA 2GYYA 1C0LA 4RL6A 2GR9A 3SC6A 4BKOA 1NVTA 1QSGA 4ZQGA 3KM0A 1HXHA 1PL6A 1LJ8A 2Y0CA 4OMUA 3MJ4A 4DMLA 5IG2A 2W8ZA 5KJCA 4GVXA 4WPGA 3TRIA 2Y1CA 2VRCA 4DMMA 5KVCA 1Z6ZA 4J1NA
chains in the Genus database with same CATH superfamily
2PSEA 3N2YA 1PR5A 2WG0A 1VMAA 1CUWA 3PEYA 1ANKA 1TF5A 1Q50A 3CUEF 4H0FA 3OZEA 4X6UA 5DYNA 5BMVB 3T9DA 5KQGA 1HMPA 3F8TA 3LVRE 4BCCA 5EEHA 1SXJE 2H7XA 5FRDA 1QYDA 3AV0B 1BN6A 3GNTA 4FGJA 1FS4A 1TM5E 2X4IA 1R0XA 3AILA 3OQBA 3PGA1 4AMZA 3L6RA 2QRJA 3WLAA 3PI6A 4FFDA 4J0IA 5EXEA 1KXZA 5E8JA 2GPSA 3GVHA 4PZ0A 3TQOA 3OX2A 2NQ2C 4GPIB 5SY6A 3P4UA 4BO9A 4EQ6B 1CP3A 1UPFA 3HLKA 5IJ0A 3GV0A 2B1IA 1M5RA 3I6YA 2XQFA 4MWSA 1S2OA 2WPNA 1LLQA 2H6EA 2HA4A 1ZHHA 3F71A 3WNCA 2M6RA 3ZDXB 5BWMA 1T6BY 1UP4A 3HJTA 3PU6A 5L45A 4BMCA 1MO3A 4CF6A 1RHMA 1G4HA 1JT2A 5FI3A 4NK5A 4N0PA 4FSHA 3W2EA 2DHQA 4E3ZA 2LIPA 1J9ZA 1KMHA 1PVDA 1W47A 2Z9DA 1U7PA 3RJ5A 1IDN1 3UUFA 1ID8A 4CQMD 4MVWA 2H52A 4TYMA 4BUCA 1KY4A 2CK3A 2B69A 4DEYA 3KTAB 1UEJA 5AJXA 2EKQA 1G19A 3LDAA 3NAQA 5EQJB 4C03A 4NU8X 1KQFA 1G0OA 4XQ0A 4A27A 3TGLA 2BHSA 3QKRB 4DSUA 3THYA 4FW9A 4YGXB 4DSAA 5KNCA 2ONZA 2GM9A 3KXDA 3PL1A 4NL4H 3ASVA 5FLKA 4UEJA 1I7NA 2AL7A 5HCIA 4KXXA 3K20A 5FPQA 4ABYA 3QKWA 1Q1BA 4L5BA 5DF1A 1UJ6A 2Z9BA 4W8HA 5JZBA 1L4MA 1NR5A 2FKNA 3ZHOA 3RIXA 4KPYA 3A58B 5KTYA 4QJBA 3BKXA 1W73A 5LB2A 2QL7A 5ALEA 4HQNA 1VJCA 4OU4A 4Z9XA 2ZR0A 3ZQJA 3Q3IA 2OZVA 2WTNA 4WJLA 2JIDA 5KNBH 3DNFA 1M2EA 3GJ6A 1GP2A 2K6GA 1KI6A 5I9SA 3T9AA 2V9CA 1T2NA 4OIMA 1TUEA 1NQVA 2R25B 1UBUS 2C0QA 3L8DA 4IXMA 4N8DA 4X41A 4PN3A 1QZTA 3PGMA 4PFQA 3EN0A 2IBMA 1D2EA 1XZDA 3VZRA 3F5MA 5BRAA 2VDWB 3I9MA 2Q1WA 1BRMA 1WTCA 1XEXA 2G6BA 2I4IA 3E5HA 5LU9A 3KZCA 2A0UA 1N6NA 1Q0ZA 4MR7B 3M1YA 4I2VA 5CH8A 2V5AA 4CV0A 3PUWA 3WV4A 3HQ4O 1QIJA 3VTZA 4BMYA 1YIAA 3CJQA 2A9OA 3ZBPA 4B6QA 2VDUE 4MKIA 4A26A 3P27A 2ERCA 2D2IA 3UAGA 4EKIA 5GJCA 5JTUA 2NXEA 4CKEA 1EXNA 2JIQA 3OT1A 1XQ9A 4FINA 4KWTA 5EZQA 4ZT5A 2Y1XA 3R7FA 5JY1A 2A1TR 3KJZA 3IERA 1X14A 2Q9UA 3JQGB 3U7GA 3UMRA 3L7KA 2X0RA 3TCXB 1I3LA 3C8DA 1C9EA 5KOJA 3LUBA 4RH1A 2IP4A 5D5PA 2NUTA 1A8UA 2W0SA 4UASA 2BN4A 4NXMB 3GXBA 3COYA 1XEWX 3H2SA 1G6OA 1QIMA 2YOGA 4KO3S 4TKLA 3CLUD 3FYUB 2RI6A 3LUJA 5BVHA 4AKHA 3A14A 2C4WA 2DFTA 3GLHE 4CIWA 1DAMA 3TB4A 2NIPA 3LHIA 3BFPA 1DX6A 3AHJA 3K9QO 2ID8A 1W0JD 3OWOA 5FUMA 4R6XA 1NP3A 4V38A 5A3SA 4Y7CA 1E5DA 3I8XA 4ZI7F 4HAUA 2QB5A 3FNBA 1SXJD 1X74A 2JB9A 4MOWA 1QK5A 1YACA 1S8NA 1VPEA 3ECCA 5TS2A 4RESA 1C1DA 1JHRA 1P2TA 1RKXA 2A84A 3AONB 3C5VA 4LDRA 4AG3A 5JBIA 3NVDA 1EAYA 2ORVA 2MSLA 4RS3A 4DREA 2ZYHA 3R3JA 4R01A 1I2MA 1KDYA 4S2EA 1GSIA 3WWDA 3B48A 4LSZA 4R81A 1PZXA 1L4HA 4G67A 1DIBA 4A3SA 4BNZA 3GLFA 2WYHA 2F67A 3KELA 3LBHA 1R6DA 2RHCA 4ZVVA 3L0ZA 4BEBA 3T94A 1DMRA 1GU0A 2DYKA 4E5MA 1KOLA 3J7TA 4W1QA 4OM7A 3DF7A 5JCJA 1M2VA 1XKQA 4NZ9A 3NHKA 4FMDB 1B7GO 2QL9A 2XDQA 3S5JA 1Z82A 4RGQA 1F0PA 4BMSA 5EHQA 1QAMA 2BUBA 3I4LA 3LNCA 1A1SA 4TMTA 5C4IA 1F2UA 4JXZA 4RFSA 4RWEA 1CR0A 4ASUD 5LQKA 1LQTA 2QIPA 2QM8A 4LJYA 1I7QB 4MVJI 3SS9X 2AR0A 4WERA 5DGCA 2Q2QA 3I52A 3Q2OA 4WUVA 3UWOA 1Z13A 3JVEA 3K6JA 1U2DC 2D0DA 3G5AA 4U0KA 1ZYUA 3NVAA 4C3VA 3C3KA 4ZHQB 2KLBA 2XECA 4DIOA 2LGJA 1EE2A 4R40A 2ODPA 4N3NA 1DBQA 4LK2A 2E4ZA 2I4NA 2JFQA 1JVSA 2OFOA 2P2YA 4P81A 5JSYA 5JEDA 2P40A 1L4FA 1M3SA 1WUYA 3OX1A 4Z4EA 1FU7A 5TVKA 4F4CA 1SHKA 4PBRA 3SOZA 2J3LA 1PNVA 1ML3A 2AJTA 2HSZA 2J32A 3QOYA 1E89A 1TZMA 1NUUA 4DCSA 3D3EA 1XU4A 2AC4A 4BU0A 5GIOE 5LL6P 3OTHA 4S24A 1L0BA 2I2AA 5LC1A 1D2RA 1KYWA 3TKLA 2WAMA 2JKYA 3C1UA 1DQZA 3CH7A 4G0PA 4LIPD 2RB5A 2FSFA 1DDIA 3NIWA 4D3ZA 5FBZA 2BHRA 5DTRA 1DE0A 1EK1A 3BHJA 4HDRA 4J3NA 4B32A 2C9YA 3RU3A 4H1WA 4P3YA 4EO4A 1NU8A 4X20B 4F96A 1ZOLA 2ZRJA 4FOTA 4GPAA 3VR0A 4B9EA 2KI5A 4HVLA 5BNIA 1MVOA 4Q3LA 4F11A 2Z09A 5EJAA 1JEJA 2G9ZA 3H6HA 4ZVMA 1DB3A 2XA1A 4WA7A 4WCFC 3T9CA 1MHTA 2WTXA 1FP6A 4N18A 3DOEA 4QPCA 3PJGA 5B2EA 1UMDB 3C6KA 2JIPA 4TUYA 4LGYA 5CYPA 2BEJA 4XJXA 3VAZA 8ATCA 5JALA 1DTEA 4IKPA 1WSWA 1PNTA 3IE2A 2V55B 3KUUA 2BLNA 2GJKA 3KYJB 4HJRA 4I8XA 3UMSA 2ZT5A 5HKKD 4KL8S 1L1QA 4QBHA 5BQXA 2XUZA 4W1PA 4RTQA 1QK4A 3LG2A 1DQSA 1PS9A 4H7HA 3QP9A 2A9FA 3SBEA 4X1KB 1HEYA 2H7YA 5IPFA 3PSAA 4DTCA 4GP7A 1T9GR 3GUYA 4IG9A 1U0HC 3G8BA 3NIGB 4ENRA 1DTWA 5AVQA 2JC3A 2ZB4A 4NE9A 5F76A 2I7CA 1OPXA 3O21A 3DV0A 3HJFA 1WEHA 3REQB 4JBHA 2J33A 2QE7D 2WU8A 4KWEA 5JCZA 1IDOA 1UKVY 4FDLA 1EZ4A 1U3CA 2PS9A 3OJEA 3TVTA 3ZWKA 5KCZA 1ZRNA 3LGAA 1OKKA 2JHGA 5DTEA 1JPJA 2WM9B 1I8TA 1C9YA 1RBZA 1F8UA 1Y81A 3QJGA 5G0SA 4Q05A 2UV8A 1LPOA 3L6DA 1YVRA 2YHUA 3HV0A 4MLDA 4D8XA 2QG4A 2VHZA 3UJ3X 2ZYAA 1HDCA 3HJAA 4UQLA 3B2NA 3RSGA 3H7IA 3WBBA 1SBHA 3KHSA 5HK9A 3GFOA 3W5JA 1F0NA 1FEZA 4IDDA 4YP1A 5JXWA 1IZ9A 1Q2UA 1R1DA 3IODA 2A7QA 4M89A 1AMOA 5EUMA 3PGVA 4HWOA 2JGDA 1VFNA 3PQEA 5AVYA 5ES4B 1JDNA 5LNK6 1KZHA 1ENZA 3NXKA 3MGGA 4BP8A 3AI2A 3DTNA 3GVCA 4FEGA 1CWUA 2VHYA 4S1PA 4BNGA 5GADl 2F3QA 3VNQA 2AHRA 1DAHA 2NT3A 3EBPA 5CEEA 4KIUA 4M8IA 4H3KB 1ZIYA 1QGYA 2FETA 1N2JA 3F67A 3P4XA 3QIAA 5AK0A 1B2RA 1N2IA 1RXEA 1Z5GA 1P3JA 3KVOA 4G97A 4C05A 3ED1A 3FDFA 4M88A 3ONEA 2UYHA 2LW7A 3F7OA 1ESZA 3KVVA 3L0IB 4PRZA 1MPTA 4PCUA 4P2GA 4Q48A 4R2XA 4UUQA 3V55A 4OBBA 1ODFA 3NIDB 4JYAB 3VVMA 4CIVA 1A9SA 1WDLA 1E96A 2R47A 4MRVA 1Y8CA 1AUPA 1DQPA 3T3NA 5AKLA 5CM9C 1QYWA 3AHEA 4EELA 1X1EA 1GDDA 3O4JA 3WYEA 1TC2A 1USIA 4DWWA 3CT6A 3HL0A 4IO1A 4RPKA 3TBHA 3PE3A 4G4JA 2AE2A 1WW3A 4QIHA 5FUXA 3K1TA 3JATA 5B3KA 1TCCA 2JHFA 2PEZA 4NPHA 5AESA 4MR9B 4LDAA 4ZYZA 5I7FA 1WS6A 5JXIA 3UV6A 4QO7A 5A71A 4ONEA 4TOIA 3SBXA 4R31A 3QX8A 4LXQA 4FDUA 3VR6D 4GLFA 3UAOA 2J41A 3SQDA 2JLQA 2PSHA 3D02A 1HDIA 2XRMA 5D3MA 4BZQA 1UBFA 1BJTA 4JC0A 1Q19A 3SLGA 1RP7A 1U0EA 4DHWA 2H4YA 1T0BA 1XZEA 9LDBA 3PI7A 4WCFB 5BUZA 2IVFA 4M9RA 2YR0A 1DNPA 2XHEA 3M2PA 3NONA 5ECYA 4K6FA 1Z4KA 4HSGA 3QU4A 3K1ZA 4LV5B 3A6EA 4YMLA 3GZTB 4K9QA 3WSWA 3FOZA 5TGTA 1GN8A 2VH2A 2A9KA 1HTTA 4J49A 2P69A 4KFRA 1EXMA 3EW7A 3EVCA 2WKPA 3Q1LA 4YGYA 3ZNNA 4D26A 2QUKA 4CE6A 3RBXA 5T57A 3GZNA 1YC2A 5EGNA 4Z4FA 2O54A 4IGIA 4DRXB 1DCFA 1ZN7A 2QM0A 4ILKA 3EULA 3KHUA 1JI3A 4JJIA 4WY2A 1GA1A 3EXHA 5C0OE 1U0SY 1TEZA 4C2AA 1ZN2A 4MDEA 1U11A 4H9GA 1IN5A 1MIHA 3FAZA 4R8SA 3JCZA 3IQXA 2YXPX 2YZMA 3QPDA 4IIEA 2HY7A 1PK9A 5FI5A 3WV5A 2QDKA 1JSXA 4JK3A 2WIDA 1GQOA 3LD9A 1K5DA 4I50B 2EG5A 4BKUA 4PTZA 3DCYA 4GDMA 1G21E 2V7BA 4UEQA 2D3WA 1Y8ZA 1VOTA 4AJHA 3T5TA 3NB0A 1I2DA 4LNUA 2WAAA 1P60A 3IVMA 4BQRA 3BAZA 2IDZA 3BWCA 1PV2A 1ZBQA 3D7RA 3P4YA 1V8ZA 3RSFA 4KBYA 3GP5A 2EGHA 1P33A 3CURA 2Q5EA 4BQPA 3K6SA 2QRVA 1I0ZA 4P84A 2BGGA 3UWDA 3W1EA 1VBKA 2PX5A 4U00A 2XX3A 3GW8A 1RLTA 5EMLA 5FWYB 1G20A 4IIHA 4PR3A 2G8LA 2OAP1 3ESBA 3WWYA 1CB0A 2HMUA 3EHDA 4UPEA 2PUTA 3JS5A 2W7TA 3V2UA 2BKUA 3LDUA 2W11A 3GFSA 4MS3A 3HK2A 2PSFA 3BH0A 3OCXA 3E8XA 4EY7A 4LFBB 4RA6A 4MVJH 2COEA 1SUCA 1UIRA 2Q6OA 4LJ4A 4GBGA 4E0BA 2JFNA 1RXUA 1ZDMA 3T1YB 3AESB 4FFMA 5LUAA 3DONA 2VJNA 4FYPA 1E58A 2BEUA 3WLKX 1KK1A 1WKVA 3HY3A 5JZ9A 3CRVA 4YQFA 1U9IC 2BW0A 2QVYX 2RGDA 3HP4A 3OF5A 4NZNA 5JPIA 2C3UA 3QA9A 4R1SA 3TDKA 2RH4A 2BFDA 3FPBA 1WF6A 1PHRA 3SN6A 1DARA 3IO5A 2JLVA 5IVHA 4OU5A 1OA0A 1FCJA 3QFSA 5IH7A 5DBEX 1EQAA 4I4TA 1TEXA 1UFOA 1H5UA 4Y9RA 3GA7A 4YCAA 2IIVA 4XIFA 5ALUA 4HH4A 3KCQA 4RF3A 4NQRA 3WO0A 3UWMA 4EL5A 4NG5A 1ZPDA 1IM8A 3E0QA 3GRAA 4JLWA 2P9BA 5HM8A 4B40A 1RJWA 3DE3X 4CR6A 3GNSA 4CTJA 4N3GA 4P2BA 3O8NA 1IQPA 5EHZA 3SJZA 1O4WA 3ND5A 1QH1B 1CQIA 2ZBDA 3VYSB 1MZVA 2OHGA 2ODTX 2XJ9A 2XOXA 1Y6FA 3MVEA 4QHTA 1NU6A 3IO3A 3KT3A 4PPQA 4Z7QB 2SNIE 2QGNA 1XKLA 3U37A 3HZZA 1HDXA 3C5WP 1W87A 1O9BA 1KR5A 1P9OA 4RFVA 1FTNA 1DEAA 3IQHX 1OLSA 5ALXA 3K8ZA 3NM5A 1P6XA 4RVGA 4YRIA 1SVUA 4HFRA 3W77A 1TIPA 2KSQA 3GJ4A 1LKZA 3OU6A 4LW8A 4LX8A 4OHFA 4LF5B 5EE1A 3OLQA 5JOQA 1OMOA 3AYZB 1L1RA 5EJGA 5FV4A 4K5QA 2FSPA 1TT5A 2GB4A 1J23A 4ZVLA 4XX0A 4DCGA 4J4HA 1JG2A 1CJUC 3OO0A 1UUFA 3F3MA 1IXSB 3AJ8A 3IGFA 5K3FA 1JL3A 1EB9A 1M2FA 3BXXA 3GJZA 2QY9A 3AUFA 3LC2O 3HVKA 1PZGA 2DHCA 3LK7A 3NWPA 4OKNA 1FYXA 1SC9A 4QQNA 4YV1A 2RGBA 7ABPA 3KT0A 1FXSA 2C77A 4C1BA 3O3NB 2G9RA 1XRMA 2JEZA 4D45A 1PZMA 4FZVA 1I5OA 1WZEA 2QVCA 4S12A 1JTFA 5CA1A 2R68A 3OE5A 3QBVA 1XMXA 1R0SA 1Y5MA 4QYSA 5L4SA 1Z0ZA 3I39X 3T99A 3PGKA 3H1GA 1REQB 2AF3C 4MYSA 5KINB 2C0CA 3G0CA 1AKVA 3R5HA 5I7HA 1YQUA 3RYCB 3F8WA 4K9SA 1ICIA 3ZTYA 4I1PA 3HFSA 5JVDA 4EMUA 2NV2B 2PSSA 3HEMA 1AHIA 4JJAA 4EK9A 1YB6A 3JALA 1T9CA 4BFVA 2LR0A 3DHYA 4DM3A 3R5XA 2NSLA 4W9NC 1P39A 4YASA 2ZBFA 4EJMA 2F17A 1CZNA 1OTXA 3G3EA 3Q5EA 4WOJA 5B57C 4QAQA 1CQPA 4B5KA 4MW0A 2BY4A 1MTOA 1JH8A 1KVSA 2C3MA 1RTTA 4M46A 4UARA 1BQ4A 1YMQA 3TW4A 2WHQA 1GADO 3CVXA 3TZQA 3JZAA 3PVCA 2GLUA 1O8BA 3EIWA 4JLNA 4ZO7A 3FVTA 2Q41A 1P9NA 2IE0A 1IY2A 3W9YA 1E5QA 2J30A 2UZ3A 4BVHA 5BWBA 2OO7A 1H5NA 3O2SB 1XQ1A 1A7AA 2QNBA 2QMZA 2X14A 1I51A 4O8ZA 3TTVA 5DYYA 3KQYA 3U3OA 4BECA 1CEYA 5D2CA 1TZBA 2G07A 1XRSB 3OBIA 4G0YA 5JDIC 2XNDA 2G9NA 3AR5A 2HW8A 1VHQA 2NOAA 3CPEA 5BN3B 4Z7NB 5JXJA 4RIIA 2B21A 2CYBA 4BV3A 5CB0A 3Q3CA 1VLVA 2M6KA 3VBCA 2NN3C 1LK5A 5KQLA 1YRHA 4PQFA 4C5AA 3NHMA 1EFVA 2A5FA 4JFAA 1GSOA 2C4MA 4AN4A 3KS9A 1XUOA 1J7JA 2HJRA 4L0QA 4GKVA 4XLLA 2CDBA 2H5JA 4DCPA 3D5TA 5A6SA 2V7PA 2VYFA 3D5QA 5BYJA 4XQGA 2V7VA 1GFIA 3RFCA 1VP9A 5EJ5A 1BCSB 4WOKA 2C4VA 1J20A 4O4IA 2I29A 3GWZA 1WUIS 2R60A 3RAPR 3P2KA 1NSFA 3TXYA 3VPHA 4H1TA 2HTEA 2R86A 3GAFA 2PLAA 5KYNA 4JP5A 1L4LA 2WFZA 2WD8A 4L16A 1RJDA 4GOKA 3GVXA 2W2NA 1X9IA 4L72A 1T0JB 2YOHA 4UFOA 5EE5B 4Z0HO 2FH5B 2VDKB 3BZUA 3ZUGA 2CLCX 3K70B 3ZW9A 2HF7A 3U7RA 4B5LA 3DTVB 3VUEA 4EY5A 1AUVA 2VPZA 4WKBA 2AEEA 1LLUA 3ZLUA 1KOJA 4K05A 4DVGA 2BHTA 2X3FA 2CXPA 2GH1A 4HZGA 1DPFA 1DWOA 1WWKA 2FYTA 5KAMA 2A88A 4FDTA 1BVUA 5TSDA 3JQQA 1QANA 2NW6A 3IUNA 1KBQA 5CB4A 3ZXSA 1AV7A 3BG5A 1UC9A 2DKNA 2FN4A 3QVOA 3CU5A 3RJZA 4AZSA 3Q8XB 1EUCB 2WYIA 4Q1AA 5BOVA 1N4AA 3VTFA 4R3UC 3X1KA 4PYOA 1KMQA 2QUJA 3T5BA 4UUBA 4FFSA 1RD4A 2O7VA 3DEKA 2KS6A 5JIBA 2D2FA 2Y6VA 4JEUA 2HI0A 1EESA 3UKDA 3IL2A 3HBAA 3OOSA 3O93A 3TO5A 1SU7A 1QHFA 4M2LA 1JLLA 3EK2A 1UFRA 3UZUA 3HBFA 5FOVA 1C4WA 1Z38A 2HOQA 3GB9A 3K72B 1G59A 2IDMA 2JAXA 2Q6IA 4XVCA 4C22A 3BBPA 3T8YA 4X7BA 4F86A 1XZLA 3WE7A 3TAXA 2Z3WA 4UQOA 1HGXA 3T1VA 1IWBB 1V7QA 1Y37A 4BLRA 5IKPA 2JI6A 4UPVA 3QHQA 1EWVA 2SBTA 2DUWA 2ECPA 1Q3TA 1A97A 1XPJA 3LHFA 3LP6A 4HAIA 1SCUB 1E3JA 3JRXA 4M1WA 4GM0A 3D8HA 5LYJB 2OAGA 1PE0A 7ADHA 1XYGA 1AT1A 3LOUA 4R1TA 4P3KA 5A5FA 2XMPA 1BWQA 5EMMA 5F2EA 5ADWA 2IU3A 1T5SA 2IUUA 2AQKA 2AEFA 2IYXA 3PFCA 4INJA 2NNLD 4K88A 1O58A 3LVFO 4PTYA 1S2DA 4BLOA 1LRKA 3H1AA 1T5TA 1ZRSA 4OBEA 2ZLBA 4AJPA 1PJLA 1WF3A 1IL0A 2BDTA 4HYTA 1II0A 1H66A 3ND6A 4MJXA 4UE2A 3C7AA 1PEDA 2GFQA 3LX5A 1BFKA 2B92A 3BIFA 3OIWA 2IV7A 3WLMA 3TJZA 1G1MA 4DJFC 1VB5A 1JHDA 2Y1WA 1OBCA 1P72A 3IP3A 1NP6A 1PT9A 2EWMA 4KG7A 2ECOA 3G9ZA 3AERB 1ZXBA 1L7EA 2HTFA 4O4JF 5A4JA 3DMDA 2HBZA 4IHJB 1LEHA 4RXTA 3O4RA 4K9NA 1W4BA 4HDKA 1VL8A 1Q0PA 3PDHA 3CVOA 3E7WA 3IVRA 1AZLA 5CIQA 4JD5A 3U3RA 1LPMA 4ZV9A 2GHQA 3VA7A 2O7NA 3T1OA 1SCBA 1MW9X 3KAKA 5TT1A 1SCDA 3H5AA 4EW3A 1KSJA 4CM1A 1FYFA 4ZDJA 1KI8A 5BUSA 2Q0HA 4DUPA 4HV4A 2GM3A 4IH9A 1IB0A 2J48A 1Y5LA 4P31A 2IYWA 4XPIB 3OOYA 3TZ6A 4LRXA 2OCPA 3OC6A 5ESWA 3RD5A 1F8FA 4FZ3A 4CKZA 1F9AA 3Q6MA 1KYQA 3ACBA 3IBGA 4B3CA 5B1EA 4BY9E 3E3OA 3OLXA 3IR5A 2DUJA 3TYXA 2VT2A 4ARVA 2GA8A 2QUBA 1ZS9A 1TFUA 1VM6A 3BN3A 1NE7A 3KWMA 5JANA 3HJCA 3BJRA 4H31A 1JLRA 2OVFA 4PAQA 4UBIA 4X94A 3ABZA 3SEZA 3FD8A 3FPLA 3HXMA 4W99A 5EQDA 3KVNA 1X1BA 2D0OB 1A9PA 1AGPA 3K9WA 4P9NA 1GQSA 2HQSA 4U2CA 3SJ7A 1Z0DA 3ZWCA 3A9UA 4BV9A 4A7PA 2RH8A 4YBRA 5JQGB 4MJLA 5KSYA 2ZVQX 4MUHA 5E38A 3H18A 1JHUA 2ODNA 1HL7A 3DCJA 1QV7A 1W75A 4DMKA 1IBSA 3OECA 3ZJ5A 4DLNA 2HRBA 1FFSA 2C04A 1EPUA 1JEQB 1TADA 1RSZA 3EUAA 4BMNA 2YWDA 1W581 2B34A 3R9XA 3UK0A 4KLCA 4LF4B 1R3UA 1Z29A 5C7OO 2IF0A 1NWCA 1IAVA 3L4BA 1EVZA 4RETA 3BK7A 4TKVA 2NGRA 3PC8C 3QOFA 1MJGM 1XZPA 1IM2A 1GLVA 2NZYA 1XTTA 1T8RA 1G7RA 2Y3IA 4Z99A 1WMBA 4DE5A 1GKKA 3QXJA 3EW9A 3BD9A 2ZU6A 4M0FA 4ZANA 3VR5A 4FB4A 3KSBC 2ZSKA 4AMUA 4EYKA 2VTVA 2F43B 5BMOA 3HGMA 4Z1MD 4KSCA 1NI3A 3GU3A 1RT9A 4ZT2A 1U2PA 1E0DA 3I32A 4K6CA 4WLNA 2R2GA 2C4UA 3VSCA 3U40A 4QKQA 2WVAA 1G1AA 5IVIA 1WQ4A 3VR4D 1Z4OA 3UT6A 5ES3A 4AMGA 3LZDA 2NVWA 2C82A 5IVDA 3ZE7A 5BXYA 1AN9A 2P62A 2PLNA 4QSHA 2O48X 3JU3A 5CNJA 4GRAA 1AS2A 1GNLA 3CR8A 2IYUA 3GMSA 2I6UA 3S2ZA 3WLIA 3I9JA 1GD1O 2JJ2A 2PLRA 5FR2A 3L7DA 1ODLA 1J8QA 3GLFE 1B15A 1L6RA 4BMPB 4DNXA 3ICCA 1B2LA 1BS1A 2NO1A 5GZ1A 1Y5RA 2ETVA 5DRYA 2GM5A 2Z2XA 1AZWA 2WWHA 1H0RA 1TZJA 3OQIB 4L9AA 1J0XO 1LC0A 1TTQB 2XAUA 5DYGA 3RANA 1PR3A 1VIVA 4F3NA 4HLQB 4X00A 4ZQEA 2BGNA 1E8NA 1E9BA 3DGFC 3NHRA 1JQAA 1XCJA 4LHWA 3ANSA 3B6MA 3GRFA 3IQGX 4PNHA 4X3CA 5CDTA 4ARCA 5A2QA 1WCIB 1THZA 2Q3EA 4BOYA 5FTLA 2ZP1A 4N65A 2GTPA 2Y8EA 4LKRA 4DIEA 2ODAA 3LC1O 4LRYA 4WADA 3NASA 5ENDA 5LP6C 1YR1A 1E3LA 2P9JA 4DYVA 3RUDA 4HNGA 2P9EA 5TMDA 3VYRB 1DOAA 4MITA 1TK2A 4HP8A 2BM8A 2P2CA 5BV2P 3CZ5A 2NO5A 4XB2A 2O2DA 3STUA 4V3CA 4B44A 1V39A 4Q82A 3PTLA 2BH9A 1R0WA 3TM4A 2WD9A 2JFXA 2P5UA 3LKDA 3K0SA 2I67A 5I45A 4Z0PA 4V2UA 4ZI5A 2C5GA 4DNOA 1X7XA 1F17A 3KYDB 1E1CA 2VUSA 2WZBA 2H7VA 3UY4A 3TEFA 1UWKA 2JDIA 4BO6A 4BZZA 3RVOA 4CM6A 4DA9A 3B6JA 1FDSA 2QVBA 2X41A 3C4VA 1X8XA 4GPD1 4K9PA 3V1LA 3TLMA 4O3MA 4DUYB 2VT6A 1KERA 3FFTA 2E4WA 4UBLA 3SCZA 5DBIA 3KKLA 4HGNA 4CUZA 5HGXA 3L8CA 4TV9A 4BAUA 2IXBA 1C7QA 4EY4A 3A6JA 3HU1A 1ZUNB 2DLDA 2PMKA 3W04A 1C4XA 1TD9A 2K4MA 4M6WA 3ZCPA 2GVZC 4MWTA 4DCJA 1G8MA 4PSVA 3UJ9A 4X65B 1Y4SA 3KKQA 3EVEA 1BGVA 4MUJA 1OGYA 4F6RA 1U1IA 1RKVA 2KM1A 1A5ZA 1QQ7A 2J0UA 3R6DA 1AM4D 4E2FA 4YJHA 4ZJZA 5HMMA 1U1EA 4IQFA 4BLQA 2IEGA 4IJQA 4CM4A 5L3QA 1KI3A 1VRWA 4KPUA 4MW7A 4RKWA 5FI1B 3EVZA 1FFBA 1K0FA 3TLYA 4LXHA 3RYIB 4FGWA 2FPOA 2H1CA 3LK6A 1N1MA 3BMNA 4PLTA 4LBZA 3JW8A 4KC0A 4F2PA 4DOMA 2D4AA 4BNXA 2P9TA 5HF5A 5KYKA 2VYCA 3QE0A 4EPXA 4KR7A 3P9RA 1MC1A 2QMOA 4U7FA 2FR8C 1WMDA 5REQA 4RXMA 1GYQA 3FZQA 4PIPA 1W4ZA 1FYDA 3QLUA 3ITEA 3MF4A 5EIOA 1WVIA 1T2UA 2ZB7A 2C5FA 3E58A 4C1NA 1W76A 3DUFB 1V6AA 1CUJA 2PD3A 1HLFA 4XM1A 1GGHA 5KSZA 2X1HA 4K46A 2EF1A 1RZUA 4FNGA 4LHVA 4PLFA 4Q1VA 2O1XA 3QLEA 2IQIA 1PSWA 1VMDA 2E4XA 5LZ8A 3RFVA 1WZ2A 1B6TA 3OT4A 1H1DA 4NNPA 5IXJA 4KO4S 1CUFA 4TX1A 3W6UA 4FN5A 1ODJA 1EI9A 3PNPA 2JI7A 1ZGCA 3GDOA 3HKEA 1YIOA 1I94B 3GXOA 1M6VA 2NX2A 4PSUA 2HK7A 3D4IA 4KQJA 1LQUA 3PXDA 2WQ6A 2V6JA 1OVMA 3LFHA 1P5JA 3AHCA 3TPZA 1NAHA 4ZVKA 3A6FA 3RW9A 4BNIA 2O3QA 3K15A 3RUHA 4B4VA 5EI5A 3GLSA 4TVSA 2RAVA 2XDAA 3A6KA 2XUPA 2YJGA 1QXSA 1U3GA 2LRHA 4DILA 1SBNE 3B13B 3RVSA 1RQGA 2UVDA 3I2YX 3BRSA 4LE0A 1PVVA 3QEBZ 1RKBA 2I3BA 2UYQA 2UVQA 1BH2A 1WXXA 2JK1A 3ILVA 3CE9A 5A5DA 1CD5A 3GK3A 3MWEB 1RAAA 5FYDA 2H1FA 3H3XA 4IOJA 4EHNA 4LBYA 1R27A 2W22A 3JVIA 4OYRA 4WKCA 2Q1XA 4KDRA 3KEQA 1CY7A 4P7FA 4MI6A 2WZCA 5KVSA 3BOSA 1APBA 1B8UA 5G1PA 3FMGA 3MINB 1U8XX 4NENA 3W0LB 1EGHA 4CG2A 2RGEA 2VJQA 1YE5A 2RAUA 4XA8A 4Y2XA 2QXYA 3I01A 3KZMA 2ZIZA 4BO8A 5LP6B 2SCUA 2GZ1A 2PUGA 3VFDA 2XODA 1L7DA 2QS9A 3FN4A 2WJVA 1PW5A 1HZZC 3KEMA 3X1ZA 1Y9DA 4INZA 2G82A 2VWPA 2R7KA 4M0CA 4QULA 2VHQA 3TXXA 3OE7D 1ZD9A 1QZXA 5TGZA 1ULBA 4GYJA 2HMWA 1XFDA 3UKJA 1TAUA 2CLMB 2ZR8A 3KAJA 2REBA 1YDHA 3ICEA 1G3QA 2IT1A 2OKGA 2ZSJA 1OPRA 3MPOA 1EMDA 1QBKC 2BZ1A 1F6WA 4JLUA 3OCWA 1YZQA 2R8PA 1EEHA 1O54A 4F8YA 3HUDA 4G24A 3SR4A 4MB6A 3ZWPA 1RI2A 2ZB3A 16PKA 4MXDA 4BFWA 4PN7A 4HYQA 1K8ZB 1V4BA 4MUKA 4QU8A 3EIUA 1FUKA 2BELA 3PC8A 1KAHA 5G02A 1G66A 3HRKA 5E2IA 1E60A 3C85A 3R0IA 2IPAB 3WB1A 4CG0A 3DTTA 3TNLA 1G291 4E1BA 3E5RA 2IXGA 5G1OA 1QOPB 2RAPA 2WQZA 1S02A 3C41J 1AVTA 1HE5A 5JWOA 4A82A 1HT3A 1PDWA 3P9YA 4YRBA 2JAPA 1X1AA 2XI4A 4AURA 1PSZA 3D3NA 3EWAA 3L4SO 1U9ZA 3MYRA 1UPUA 4I0WB 4TGLA 1G7TA 1XJWA 4X0EA 5C18A 4KX3A 1J0AA 1N3LA 5G4KB 2G08A 1H8EA 2WAOA 1II8A 2VPXA 3TCNA 1H6BA 3DKKA 4CMAA 3VR3A 2O4CA 5ITZB 1G63A 1X87A 4G89A 4GZLA 1KDTA 1YZYA 2PKCA 4FMPA 4G0UA 1NV8A 1ZH6A 3GHHA 5DK4A 3M9WA 2OPBA 2WZDA 4DLKA 2H2IA 3CGGA 5D3QA 5J5AA 4I5GA 5JCOC 1FX0B 1IEXA 2ZRGA 3RS5A 3C8HA 3WNVA 1GAQA 1JDVA 5B6JA 1XVAA 1PJSA 2Q3MA 2GAJA 4PC1A 3A2MA 3DBOB 3GQBB 2FCAA 4E7OA 3UBTA 2OILA 1ISFA 3UICA 1QPZA 1DEKA 4AMBA 3AVOA 4JXJA 1VGRA 3PXCX 3MMZA 1NAIA 2GLTA 4YUYA 1X7YB 2CMDA 2OG1A 2AJCA 1EQ2A 1GUAA 1SZJG 2EFDB 4N3CA 5EP4A 5ERXA 4C7MA 1OAKA 4C76A 4DEVA 4N7MA 5F4BA 2WP0A 3S44A 5FCDA 3IP9A 5DHUA 1CNEA 1H1LA 4YRZA 4C7OA 2W5UA 1GYPA 3BIOA 3QFTA 1XLVA 4YY3B 3ZGXA 5JH7B 1ZNWA 5A6VA 2JCSA 1LU9A 1MJ5A 2ECKA 4RM3A 5K6TA 1KMNA 5CCEA 3REFA 2Q99A 1GDHA 3LTNC 4KODA 4ZQHA 4B87A 2X8JA 3PHCA 4J0DA 1JFSA 1KIMA 1P7ZA 1T9AA 1JWLA 3CLKA 3ETHA 3OIYA 3NDPA 1XAJA 3EC7A 3LBAA 1IOWA 3HR7A 3NUQA 3JY6A 1IZ7A 4DBLC 5KX5A 2WT9A 4FS3A 1G42A 1BW9A 3GN1A 5FFFA 2Q27A 2OQVA 3T7SA 1KO4A 2QUAA 4JWKA 1P45A 2A0YA 4RQUA 3AVQA 3RC9A 2NV0A 4TRMA 1OFUX 4LY3A 3FFXA 1C3JA 2WHPA 3AQ4A 4MRSA 4GXQA 4IX9A 4V0ME 4IBOA 3IA7A 5BP7A 3QOXA 2ZZKA 3K53A 4CWAA 1WTAA 2BI7A 1LZLA 1TQ8A 4C04A 3ZHCA 1MFZA 1CFZA 2VAXA 3QPUA 4UHHA 4LAFA 4NDAA 4QYMA 1Y1LA 4WVLA 2BBWA 2ZAGA 4M9XA 5IJWA 1KJYA 3EOBI 4RZ3A 3RNLA 2A86A 1GL7A 1U8YA 1DZIA 2J7PD 2VNKA 3DHWC 3EPPA 3PFKA 4RUKA 3MILA 4DMRA 1XTIA 3B9BA 3A1EA 5ESXA 2WUGA 3LV8A 2CHGA 2WV7A 3WGIA 2ZIGA 1LPAB 4ARZA 1E7QA 3RWMB 3ET5A 3ZOKA 4BGVA 5BN4A 3DMNA 3IXQA 4OVKA 2UZ1B 2D2VA 2HDHA 4GU5A 1PJTA 2GZAA 3RVKA 5DE3A 2BPOA 3COWA 3NGXA 4IILA 4LTDA 1S6YA 4M8KA 4U6QA 3RHZA 5MFZA 4AO7A 2F8SA 5DIZA 2CXTA 3FYTA 3K9BA 5J47A 2IOYA 3EXEA 4JBYA 1QVAA 1RYYA 5J9FA 1I4EB 4C4YA 1NUAA 4L75A 5AQ1A 1XQVA 1QCCA 2FOXA 5FBKA 3CLTD 3GLGB 1OZ0A 5FLXA 1ZEJA 2DHDA 4COOA 2CEAA 13PKA 3PL5A 1A71A 1QK3A 5AHXA 3HB1A 1RYNA 2O0HA 4MYTA 3G7UA 4U6SA 5JI3E 3NAGA 2XLCA 2KX7A 2XE4A 3D1JA 3GROA 5KC8A 2N46A 3SF8B 1KWGA 1QMPA 4FBGA 1JKIA 2PGAA 5HWSA 1Q0TA 4L5JA 4W5QA 2D0IA 1QV9A 4PLWA 4KYTA 4OUKX 1PHPA 3S2EA 5ALKA 3D7MA 4JVOA 4D6YA 2VHVA 3HM9A 5B4UA 5L95A 2O2JA 3N87A 4KXQA 3AP2A 2EYUA 2F8LA 3BRQA 4IH4A 4CMEC 1JMVA 1ISGA 4GZMA 2P8JA 3NNSA 3UMYA 3VMMA 4D4JA 3RUCA 1U6IA 1A0OA 4YPVA 2FFHA 1BEEA 5D7NA 3RO7A 1U2EA 4EOGA 2ZCJA 4P7GA 2JBAB 5LBTA 2Q5LA 4L7QA 4Z4GA 1A69A 3Q1KA 1NJ6A 1MH9A 1QUFA 3ZI4A 2D06A 5PNTA 4BZXA 4EGQA 3C43A 1U7OA 4O2BB 1VHDA 3GUVA 2Q7OE 3N0VA 1NNUA 4NPCA 4RD3A 1OIWA 3CKYA 3H83A 3N2IA 4QTYA 3N7TA 2CL7X 4RPJA 4NF2A 2PXHA 5CNMA 4CL3A 1RFGE 1DAEA 2AR7A 2JHPA 4TMFA 4UU1A 3VVLA 4AN1A 1DRVA 1F8GA 3N6RA 5EE3A 5D3ZA 1CULC 5BQ3A 1E0AA 2J9FA 2XQJA 1F5SA 4PYMA 3RTBA 5K0CA 1XK6A 2OORC 5HVNA 1E2JA 1HZZA 3OCCA 3TQTA 3WHLA 1NM5A 4AUEA 4UZFA 3ABRB 1S96A 1GPKA 4HEA1 3FTEA 1NN5A 2V65A 4IS3A 1RC8A 5KYYA 2WNHA 3BD6A 3ONNA 4E1VA 5K1ZA 4LC0A 4L1KA 5CH5A 3OOEA 2PXCA 3QXXA 2ZBVA 3B9QA 3OWHA 4D81A 1VQ1A 3L18A 3L8ZA 4FSXA 3S1AA 1KMCA 1ZD4A 5FORA 5L53A 3Q6NA 3ZWNA 4QT0A 1G3UA 3OZUA 3RDPA 4KDFA 4JC8A 3H2JA 4XEUA 4B45A 2HPVA 3B3GA 4XCVA 1PZEA 5DP2A 3VH2A 4RPHA 4LJSA 5INTA 3H9BA 4D43A 3OKCA 3ZN2A 1JHPA 2NZJA 1LTHR 2VTKA 3NAMA 4HZIA 4QGBA 2JGFA 4WINA 5CVEA 2CT8A 3GPLA 3OURA 4UJ5A 4ZKDA 4PRYA 4K6HA 3ZU4A 3KNZA 4A1OA 5J4LA 2FMFA 5BW6B 3R77A 3V8MA 3QKSA 1G7SA 3V7UA 2VTBA 3WXMA 3FPAA 4L51A 1LNQA 1H05A 2YFKA 2IXTA 2Z4RA 4QWWA 4M22A 2JH9A 4Q37A 3RYTC 1NZJA 1NZDA 4Y2TA 3ZVMA 3FDIA 2OGUA 3HYTA 3T4XA 4F9GA 1HE4A 3O1IC 5J2TF 3TJMA 4KI7A 1LVHA 1P44A 1P77A 3UENA 3D6MA 1O8CA 1RJ9B 5FWXB 3VGJA 4RTJA 3H4MA 5C9ZA 3FYUC 2R5WA 2QT1A 2P9GA 4DCTA 5CURA 2GF0A 1FUYB 3BKWA 1R6AA 3OMLA 5TQ0B 1W9HA 2UUOA 1AGYA 3Q4GA 2EFJA 4XCQA 1NBIA 4ZOLA 2EKLA 1AD2A 2W2LD 1JSRA 2F48A 3AFIA 3BFVA 5LZ5A 2IW3A 4MA5A 3WWCA 3LUKA 4B8WA<