3TQHA

Structure of the quinone oxidoreductase from coxiella burnetii
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
317
structure length
317
Chain Sequence
KEMKAIQFDQFGPPKVLKLVDTPTPEYRKNQMLIKVHAASLNPIDYKTRNGSGFVAKKLKNNLPSGLGYDFSGEVIELGSDVNNVNIGDKVMGIAGFPDHPCCYAEYVCASPDTIIQKLEKLSFLQAASLPTAGLTALQALNQAEVKQGDVVLIHAGAGGVGHLAIQLAKQKGTTVITTASKRNHAFLKALGAEQCINYHEEDFLLAISTPVDAVIDLVGGDVGIQSIDCLKETGCIVSVPTITAGRVIEVAKQKHRRAFGLLKQFNIEELHYLGKLVSEDKLRIEISRIFQLSEAVTAHELLETGHVRGKLVFKVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Quinone oxidoreductase
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
total genus 96
structure length 317
sequence length 317
ec nomenclature ec 1.6.5.5: NADPH:quinone reductase.
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3tqhA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3tqhA01
1A4IA 1BVRA 5TT0A 1LSUA 2X0IA 3DMYA 4G2NA 2YZ7A 3UN1A 3JQ9A 4YAKA 1LLDA 1LC3A 4IQ0A 4CQLB 3H2ZA 3QWBA 5FF9A 2NNLD 3LZ6A 4PG5A 1WVGA 3S2GA 5L7TA 3H6KA 5C3MA 3U09A 4JJIA 5U9CA 4IUYA 2DQ4A 5A5EA 1NTOA 5K6AA 3DHYA 1PJSA 3VC7A 2FPIA 1JA9A 1KERA 4ILKA 3E48A 3ONDA 3B1KA 3AI1A 1P33A 3COSA 3WJAA 1KVTA 3Q11A 1KBZA 3PQEA 1O0SA 2NV6A 4U7WA 1EQ2A 3OMLA 2X6TA 2DBZA 1QYVA 4NPCA 1PS9A 4OXNA 3KEQA 2VOEA 3G49A 3U49A 3AU9A 5MGBA 4DLLA 1NPTO 4J1TA 4YJHB 1MB4A 4PIVA 4QX6A 1Y9EA 2Z1NA 4ND3A 5AOVA 4BNTA 3OECA 3GFBA 5JAMA 1DAOA 3HQ4O 1ZH8A 5ITVA 3DAGA 4MVJM 2EEZA 2Q50A 4D3SA 5KVSA 4CV2A 3BHMA 3EZYA 2YV3A 4GAEA 3WNVA 1B8PA 1A4UA 1MA0A 1A27A 2B0JA 1LC0A 4CM4B 4GL4A 4E5NA 1EK5A 4E2XA 2IE0A 4R1NA 1BG6A 3BYZA 4JJGA 3T7EA 2WWRA 3AOEC 4YR9A 4CQMB 5JAIA 1UZLA 2VNSA 1N5DA 3O9ZA 5TSDA 1KEUA 4CPDA 4WOJA 2C5EA 2X23A 5IDYA 1V3TA 2NWQA 4QTZA 1JDJA 4PLTA 4WK6A 1Y1PA 4D41A 1QYXA 4D3DA 1Z6ZA 1PGJA 4CM6A 1TT5B 1C0LA 3EVTA 3UKOA 4B79A 3NDRA 4J43A 1CETA 1U2GA 2H5LA 1E1MA 1HDXA 2ZQZA 3IL2A 3C24A 4PLVA 3W4JA 1NQTA 1SOVA 1PS0A 1KVQA 4BO3A 1DJNA 3AUAA 2C7VA 1D1SA 2CUKA 4MIOA 3R6DA 5JFOA 5TLSA 5KVVA 3NX4A 2WYVA 3JQBA 3WQRA 3E6AA 4PLZA 3KSZO 4BMVA 4XEHA 4AJNA 3H65A 4ALNA 4D0RA 4EZBA 3JYPA 1YRLA 3FSRA 3ZWXA 5BNTA 4JN6B 3KETA 1GCOA 3UUWA 2HAEA 2DU8A 1CIVA 3WSVA 4BNKA 2HK8A 4Z9XA 2O48X 3D5TA 4R01A 1WP4A 3ZV3A 1IHXA 2PKQP 3L9WA 3PYMA 5A02A 3VH4A 4BO2A 1N92A 1PQUA 1E5QA 1TT7A 2EHDA 2VYVD 3AFMA 1XEAA 4RV9A 4AICA 2YUTA 3I83A 1K89A 4Z9FA 3SXPA 1EUZA 3KXDA 1T2AA 3JYOA 1U3WA 2DBRA 2OP0A 1GDHA 4FBGA 4JBHA 3WOHA 1D3AA 2V7PA 3DBHB 3KB6A 3ZHZA 4AJLA 4GVXA 1N8KA 5KKAA 3RSHA 4TRNA 3K96A 3QV1A 2V6BA 5DBIA 3PDJA 3GVCA 4UUOA 5JMPA 2X4GA 3S55A 2HO5A 2RHRA 4PGFA 4EYEA 2C29D 1F12A 2GN6A 2AG8A 4HFNA 3TJRA 4CLEA 4OXYA 1YGYA 2OP1A 1T4DA 2BRUA 4UVGA 3VKVA 4KMSA 2TMDA 3W4KA 1LX6A 5FI5A 1LDEA 1W4ZA 3SJ7A 4BNJA 1H6BA 1T25A 5IFLA 2NTVA 2WEKA 1K6JA 2J5QA 4E2YA 5KJ6A 1X7DA 2WMDA 1AXGA 5ENVA 4ALIA 1YO6A 4E2ZA 3OFSA 4CV0A 4YXFA 2JD2A 1PR9A 1CQJA 5CDSA 1YH3A 4K28A 4NBUA 1LLQA 4MINA 2VZ0A 2Q1UA 3BXXA 1Z7BA 2PD4A 2Q45A 3F47A 3NKLA 4RVSA 3H2SA 1UAYA 3ZN2A 4CM7A 1K5HA 3H9UA 2A35A 2W2KA 1U5AA 1R0KA 4ALMA 3ANMA 5MDHA 2AMFA 1YB5A 2NTNA 2PWZA 4GQAA 1M75A 2OUIA 1UDBA 3JSAA 1ISIA 5T5QA 2D5AA 3RFVA 2JL1A 2O2SA 4IBOA 4GVLA 4M87A 1O5IA 1P1IA 4Y67A 1FK8A 3DZBA 3GG9A 3M1LA 3DO5A 1OAAA 3PJGA 3BA1A 5T8KA 2HMTA 4KQWA 2G17A 5THKA 1NFQA 1HDGO 2Z5LA 5G0TA 2YFHA 2EWMA 1B3BA 2J3JA 2ZB4A 4XR9A 5J23A 4TWRA 3BMCB 3GF4A 5DOZA 3P7MA 1J0XO 2BD0A 5A04A 4CL8A 1C0KA 3DC2A 4A27A 5IN5A 3WGZA 1YWGO 3DFUA 4TRRA 3MCVA 2VRBA 3AJRA 1Q2XA 3QLJA 4CL3A 3N74A 3BTUA 3NT2A 3M2TA 5FEUA 4YQZA 1X0VA 1C14A 3DHEA 3AOGA 2Q2QA 5COQA 1DFIA 1XU7A 3VDRA 2EKPA 3PP8A 3ZU4A 4OSOA 1Z73A 2B83A 3LLVA 4XD2A 3VPSA 4ZJUA 5JC8A 2C0CA 5HRUA 1DC6A 3PPIA 3VDQA 2D1YA 3GG2A 3PWZA 3RI3A 4BNHA 4L8VA 1VE9A 3WGGA 4UVHA 1E7SA 3GAFA 1NFFA 3FPLA 5ENDA 4CM5A 4IZHA 4IGFA 1EZ4A 2Y1OA 3SX2A 1E6UA 3I52A 4OQZA 3RUEA 3ONEA 1D8AA 1BDBA 2EW2A 2PY6A 1R12A 3QWHA 3OF2A 4KQXA 4KZPA 4R69A 2NSDA 3OJFA 4I9UA 1XDWA 2HK7A 2CDAA 4D43A 5LC1A 3JD2A 3ST7A 3FNHA 4BNUA 3IKTA 3GFGA 1EUDA 3OQBA 3DMTA 4GWGA 5IZCC 4DA9A 4MKXA 4A03A 4DPMA 1PJBA 4CMIB 4BNFA 3EC7A 4YYZA 4EJ6A 1HSZA 4UUMA 2UDPA 1HYHA 3IAHA 2OOSA 1UP6A 5T6BA 1JN0A 2G5CA 2V65A 1V3VA 1Y6JA 4YJDA 2B5VA 2VCYA 5EQDA 4E5YA 4NU5A 3HN2A 3HE3A 4Q3DA 4Q3EA 3KSUA 2VHZA 1HDRA 3NT4A 4L73A 4BKUA 4F6CA 1E92A 4S3MA 1ISJA 4PVCA 3R1IA 2ZCVA 2B4RO 3TZ6A 4DXHA 1VRWA 1YL7A 2J8ZA 4HNHA 3FN4A 4YT2A 3F5QA 3WWZA 1QYDA 3I5MA 1VM6A 3VKUA 1DFGA 2GF2A 1LNQA 3ZI0A 1E3WA 3AI3A 4A26A 4DWVA 2RBEA 2HMUA 1LBEA 4XYEA 1AUPA 1I32A 1VL8A 4NBWA 3D3WA 4J1SA 1ML3A 4LRSB 5K9ZA 3FR7A 1UJMA 5ER6A 3B20A 4TQGA 5F1KA 4AJPA 2AE2A 2BKAA 4Q9NA 4TROA 3I4FA 2A94A 3ON5A 3RBVA 4DPKA 4XQ9A 3GR6A 5A9TA 4CLHA 3ETDA 1WMBA 3KTDA 3GAZA 1LQUA 3WR5A 5I9MA 4ND2A 3KM0A 1X14A 3E8XA 5JY1A 1VKNA 1IUKA 1LTHR 2FOIA 3I23A 5BNFA 2Y1FA 1X7HA 5TQVA 3QE3A 1VL6A 2ZTVA 3LK7A 3JV7A 4BQPA 1VLLA 3Q3CA 1GTMA 4B4UA 2NVWA 2HMSA 3MEQA 3P2YA 5L45A 3WIEA 3I9JA 3PVZA 2PD3A 3ENNA 4FSHA 4UUNA 3ZHYA 2YDYA 4N54A 3ZNNA 1CF2O 3OM9A 3GN1A 1H6DA 1HE2A 2VN8A 3PWSA 4DRYA 2ZTLA 1M6WA 3OA2A 1FDVA 1DBVO 1U3UA 3H8VA 3JYQA 3OICA 5A05A 1CDOA 4W82A 1HTBA 3RJ5A 3JQFA 4O63O 1R66A 3DBVO 1HLDA 3TZCA 5B4TA 4EITA 3IP3A 2NUAA 1HXHA 2VHWA 2OORA 4L4RA 1GQ2A 4LSWA 2Y99A 4O0LA 4XIJA 5TX7A 1PWZA 1GR0A 3ZWNA 1DO8A 2QRLA 2JAHA 1FDUA 2JFHA 3ZWYA 1HDCA 4YRBA 4IDDA 3O8QA 4DVJA 1K2WA 4CR6A 4NR0A 3BTSA 4RF3A 3PJDA 5L53A 1YOVA 4KDEA 3VHRA 4H3VA 3HFSA 3JQEA 4HADA 3VAZA 3WB9A 4IS2A 3K2BA 3QRWA 3RVDA 1GADO 4BNIA 1DPGA 3GVPA 5DP2A 4Z0HO 4KWIA 2V6FA 4XKJA 1ORRA 4D42A 4GLOA 3WLFA 1CEQA 5JNLA 2IYOA 3AU8A 4FQ8A 4DLAA 2GZ1A 1DC3A 5JAZA 1FDWA 3CE6A 4RVDA 1HT0A 5BQFA 2Q49A 3JCZA 4M55A 5L3ZA 2HLPA 3KZVA 4FC7A 3WWYA 2DBVO 4BNYA 2FPPA 4YRAA 4IIUA 1E7RA 3AM4A 3WGIA 1I2CA 2BGKA 4J91A 3WGOA 3H9GA 4P38A 3BZUA 3LC7O 4OL9A 1IPFA 3RUFA 3HB5X 3FR8A 3MWEB 9LDTA 3N58A 2I99A 1B16A 5JMWA 2IODA 3N7UA 2GPTA 4OQYA 2JFGA 4PLHA 1ONOA 2P68A 4RQTA 4WLOA 4YA6A 3L4BC 3UICA 2ZJ1A 2JHFA 4JNKA 3CIFA 3VPFA 2LDBA 2X86A 1KC1A 1SEVA 3ENKA 2FN7A 3KYCA 3P2OA 2ZYDA 3S2IA 3WNQA 2NVUA 4HP8A 4RJTA 1AE1A 1JAYA 3DBLA 4NI5A 1K6XA 2NTJA 4DTIA 3ZW9A 4AJEA 3V5NA 1LDBA 3HFGA 5IDWA 2VT2A 4IQ8A 2O2YA 1LDMA 4OM8A 1PZGA 4FGSA 5TIIA 1LSOA 2HDHA 4QXMA 1F14A 2AEJA 3TZHA 4W9NA 4DLBA 4DREA 3EK2A 4NDNE 2EW8A 1DLJA 2C2XA 1GFSA 2B4QA 3CPSA 1E3SA 3QQPA 1QMGA 2C07A 2ET6A 2YYYA 3LT4A 4YACA 3X2FA 3VVBA 3GK3A 4OIMA 4C7JA 1QLHA 3W8DA 1VJTA 5CAEA 3WLEA 1WMAA 2P91A 1NM5A 2Z1MA 3DFZA 4UAGA 4IXTA 5BT9A 4Q3CA 4EBFA 1QYCA 4MIYA 3JQAB 4ROSA 1DEHA 4QO7A 2J3KA 4GX2A 5U4QA 4GBJA 4WNIA 2UVDA 1QR6A 2HQ1A 1OI7A 3EY4A 4DL9A 1U8XX 3F4BA 1MXHA 4F6LA 1JTVA 3JD0A 2Q46A 1H0KA 1NX6A 1NFRA 2VHYA 1RPNA 3I9LA 4DGSA 1P1FA 3GPDG 1KYQA 2BGMA 5T64A 3PLNA 4CMEC 3PYLA 3GUCA 4IDBA 5AXCA 3UXYA 5IXYA 5EERA 4XQEA 3VH2A 5L7YA 2O3TA 4WCFB 8ADHA 2W2KB 1CQIA 1DC4A 2EF1A 2RHCA 3KUXA 3O26A 1HE4A 1N7HA 3L77A 4WLVA 3UAGA 3C7DB 2B36A 4UVEA 3GGPA 4PVDA 2DAPA 3PEFA 3ITDA 1EE2A 3V2HA 2PH5A 1XQ1A 2PH3A 4EJ0A 1UUFA 2VRCA 3BIOA 1HZZA 4GPD1 4YTEA 1NVTA 3S2FA 5F21A 4O5OA 3LC1O 1I3MA 3GPIA 4RVFA 4NQZA 4ALJA 2VT3A 4D3FA 2FZEA 2Y0CA 4RZHA 1G0NA 1Q7CA 2D5CA 4A10A 1ISGA 3AM5A 1G1AA 4YPOA 1HL3A 5ILOA 1N1EA 1YB4A 2DC1A 5ICSA 2A92A 1BMDA 2IZ1A 4MVJP 1HDZA 4N5MA 3QWIA 4L9RA 1DIHA 4FFNA 4MOWA 4IJWA 3VOSA 1ONNA 4UEOA 3K9QO 1T1SA 5TJHA 1E3LA 3T4EA 1A9YA 5JCJA 3IS3A 3H3JA 1YDWA 3IOYA 4R54A 2VWPA 4AJHA 2C59A 4GGOA 5KVQA 2R00C 2CD9A 4GX5A 3BMQB 1KETA 4RDIA 4W4TA 1HRDA 3OIFA 3RUIA 2ZB8A 1LLCA 3W1VA 4AFNA 2J6IA 4CMBA 1XR3A 3L6OO 1NR1A 2DTDA 1A7AA 1D4FA 1E6EA 1U7TA 4WJZA 1PQWA 2AA3A 3DHNA 3K2EA 1LDNA 3U4IA 4A5OA 1DIBA 4G81A 1NPYA 1V6AA 4CLDA 5IZ4A 4WASA 4EUHA 2JD0A 3ZHXA 2JD1A 4NU6A 3R0IA 2GUGA 3GHHA 4GWKA 4ALLA 2O3SA 3WSWA 1A9ZA 3JD1A 3TOXA 1EDZA 2FP4A 3IQDB 4YQYA 3TZKA 5L40A 4MJLA 4IMPA 3JQ8A 6LDHA 1C1DA 3RFTA 1IOLA 1XGKA 3QVWA 4X54A 1PL8A 2PR2A 1GCUA 3S1LA 2Q2WA 3G17A 4XIYA 2BLLA 5BSFA 2X5OA 3TNLA 3MTGA 4EUFA 1GEGA 4PN3A 2E4AA 5G0UA 2QW8A 5HBRA 1EMDA 3C1TA 5L4NA 3HN7A 3F5SA 3ZDFA 3OIDA 1I36A 4L4XA 2GNAA 1E3WB 1I24A 1R4MA 5JCXA 4ZA2A 3ONFA 4MIEA 3KV3O 3D3WB 2OO5A 4R41A 3AWDA 1DLIA 3QVOA 3RBXA 4KUHA 2A4KA 2ILTA 3OH8A 4K6CA 4OMUA 4CM3A 2X9NA 3K5PA 1C0PA 1R15A 3MZ0A 1QLJA 1O94A 1HYGA 1J4AA 3SVTA 1PGQA 1KVSA 1ENZA 1UDAA 1UP4A 3NDJA 4E21A 1KVUA 2YQ5A 3WYCA 1H2HA 2OXIA 1PGOA 4ONEA 4JCOA 2QQ5A 3UCFA 3E03A 3F6YA 4BKQA 1ZVMA 4MP3A 1ZZEA 4FJ0A 1U4OA 2GD1O 2Q2VA 1OFGA 3RROA 1NVMB 1ZMOA 3M2PA 3PGJA 4N5NA 1PJQA 3A14A 5EINA 4EI2A 9LDBA 3RC2A 2Y0DA 3RCBA 2H6EA 3TZQA 5GMOA 4J4BA 4XJTA 4CM8B 3ROPA 3ZWMA 1ENPA 3QJ5A 2Q1SA 1LRLA 4MO2A 4OKNA 4J0FA 3U3XA 4DBZA 2FPGA 4ZN6A 5H83A 3GA0A 2GZ3A 3ZCXA 4CV1A 1I3KA 1KEPA 1BVUA 3DZIA 3AOEA 4DPLA 4GI2A 4MVJI 3PXXA 4N7RA 3FRJA 5F1PA 3OP4A 1U5CA 4Y8VA 4LMPA 4TVOA 5DDIP 3CTMA 3NJ8A 5G0SA 2I67A 4CLXA 4MVJE 3WYEA 4BNVA 2ZQYA 4NIMA 2AW5A 3GEMA 5DF1A 3GOHA 1ISMA 2EG9A 2R6JA 3O8QB 4E32A 4RCVA 1M6HA 4FIZA 5I8WA 4IY1A 4Z3KA 2PZJA 2EP5A 4C4OA 1ZUD1 4AJ1A 4JBIA 5EL0A 2E6UX 1YOVB 4YJGB 1NQ5A 2X0RA 1ADCA 4BB6A 4BVAA 1ZJYA 2B37A 3UFXA 1XWFA 3V1YA 1VI2A 4BNZA 4M1QA 2FMUA 4XR4A 5A9RA 4E6PA 2IEBA 2QHXA 3KLMX 2Q4BA 2HKIA 2BFAA 1LJ8A 4NK4A 5L4SA 4UEKA 1PU2A 1ZSNA 4FJ1A 3P5SA 3GT0A 4WEQA 1P0FA 1DIGA 1YB1A 3H5RA 2QYSA 5CDGA 2WJPA 4JP3A 2HJRA 5C7LO 2JCYA 3IUPA 3TF5A 4JLWA 3WMWA 2BI7A 3TRIA 1RJWA 1YVEI 3GH3A 1UXJA 1K3TA 3GRKA 4XYLA 1ZK2A 2Y05A 1DRWA 1EVJA 5ER9A 3GQVA 1GV1A 1QP8A 3WTCA 1UP7A 2J5RA 3D64A 3I6QA 1FDSA 1P74A 3DTYA 3GZNA 3RAJA 5JAQA 5GZ3A 2PGDA 5FI3A 2J5KA 3KVOA 1TB4A 4DQVA 2PLAA 5I7FA 2WSBA 1L7EA 2OFPA 4WCDA 1E3JA 4U0KA 2GERA 3RASA 1E77A 2I76A 1IZ0A 3CZRA 1HDYA 1NR7A 1ZK3A 2VNAA 1R0SA 3HZZA 4IJUA 1E0DA 1ZK0A 3KYCB 1OOEA 2V6MA 2PA3A 1PJ3A 3L07A 4HFMA 3PFWO 2NVUB 5JY6A 3PHIA 2DLDA 4TZKA 4FN4A 3DBLB 4E12A 4BO7A 4CMHA 1N2SA 5F5NA 2DFVA 3V2UA 2X0NA 1P45A 5KCZA 1GUZA 1ZEMA 3HB4X 1HDOA 1I3LA 2QZZA 2CY0A 1DB3A 3DEYX 1Z82A 4ITUA 4CMJA 2DKNA 1OC4A 3KEOA 1WZEA 2VYVA 2FY8A 1GV0A 5BSHA 3E5MA 3JQCA 4MVJD 4WLEA 4E5KA 1VPDA 3QWFA 4NBTA 3A1NA 3F3SA 2PV7A 1MP0A 4WCFC 1U3TA 2FWMX 1R4NA 1WPQA 3GMDA 3L9XA 1P3DA 4OO3A 4BIIA 5A9SA 1RWBA 3TFOA 1BXKA 1MFPA 3GUYA 1ZIDA 2DTEA 4Y9DA 4CUZA 1GY8A 4BO6A 3MTJA 3PI7A 2AQKA 3PGXA 1DRVA 4IDEA 2HU2A 3IUSA 1Q0LA 1H6CA 4J2HA 2RH4A 1RM3A 4XGIA 3K8ZA 5IJZA 1B3RA 1HETA 1QKIA 1UZMA 3NAQA 4JK3A 4K6FA 5IN4A 1M67A 1Z7EA 1JQBA 3FF4A 4GX0A 3ZWCA 4R9SA 4RVUA 4PZEA 1U9JA 5K1SA 1P1RA 6ADHA 4MPDA 2XXJA 1T4BA 3RD5A 1BXZA 4BMNA 4CLRA 3PQFA 4M86A 1B8VA 1PTJA 4LVCA 4DQUA 3ZNPA 1CYDA 4BGEA 1IYZA 3DZFA 4B4VA 3IJPA 4WLNA 1XHLA 3GVXA 1P44A 1C1XA 5HS4A 1F0YA 3AY3A 4II2A 2G82A 3LLSA 3ITKA 2VYND 3V8BA 2AHRA 2Z95A 2PK3A 4QO8A 4ZVVA 5IXSA 2CZCA 1ISHA 2AEFA 1WXDA 1UZNA 5CHEA 2I66A 3ZNQA 3SLGA 4BNWA 1I5RA 5COAA 1SAYA 3AFNA 1OMOA 2DTXA 1LQTA 4MVJA 4NJMA 5TC4A 4AJJA 1B0AA 3EW7A 4PFJA 1PQPA 2B5WA 3RKUA 4ZICA 3PIIA 4YVFA 4B7UA 1NQOA 2VZ9A 2EV9A 1DFHA 5C5IA 4K9DA 2DPGA 3BMOA 2GGSA 4RGBA 1ADBA 2O7QA 3DZHA 4UVDA 3ZWBA 4HV4A 3F9IA 5JYDA 3R3SA 4GKVA 4IJKA 1GQYA 3OJOA 1YE3A 2AE1A 3E5RA 5IZCA 1YJQA 3HG7A 4ZQGA 4NG5A 4HKTA 1X13A 1ADGA 3C7AA 2DUWA 2O50A 5F3RA 1YQXA 2CVOA 4E2WA 2FR1A 2OGUA 2EP7A 3NGLA 3ZNOA 5CEEA 3W4IA 4DYVA 4NK5A 1WDKA 1AHIA 2CSUA 3ADOA 4U5QA 3I9OA 1VJ1A 2QZ9A 2ZYGA 1PSDA 3WGTA 2UYYA 2EERA 1VC2A 2YV2A 3JQ6A 1ULSA 4R1TA 3DB2A 4P22A 4NZ9A 4CQMD 1HSOA 2X1HA 3ZU2A 1BTOA 1EDOA 3LYLA 3O03A 1YBAA 3ULKA 1RYEA 4L74A 5KVCA 2H63A 3ANLA 3CKYA 1BWSA 4XA8A 2YJZA 4ZRMA 1QRRA 1Q7BA 2J3HA 1MXFA 1HYEA 5L95A 4BO4A 1R0LA 4NBRA 4H7PA 2CF6A 3HNPA 1GPJA 1ARZA 4YCAA 3PRJA 3SLKA 1EUCA 4I8XA 2VWQA 1Y9AA 2VHXA 1Q0QA 3U62A 3L4SO 1Y5MA 2RH8A 1YS4A 3EZLA 3LSYA 3OSUA 1W0CA 3RJ9A 1ZKMA 1SB9A 2XOXA 3JQ8B 5G4KA 1JKJA 1R6DA 1C1DB 3UHAA 1LRJA 4BMSA 1GAEO 1JWAB 3EUWA 3K73O 5LDHA 5CPFA 1P1HA 2A9FA 5JDCC 1B7GO 1DXYA 4BNGA 4E0BA 1PJ2A 3ETGA 4TSKA 3HWRA 4PRLA 5JS6A 4L4SA 4M54A 4IM7A 3IDSA 1QXSA 1V8BA 1B15A 1R4MB 2EKLA 3GC6A 3V2GA 3D4PA 3PFFA 5JPIA 3ANNA 2PZLA 4ALKA 2O3UA 4IDAA 1PGNA 1WDLA 2C82A 3MOIA 2LDXA 4W99A 4ND5A 4XX0A 4BV9A 4FR5A 4RPJA 4ND1A 3JQFC 4YBZA 3PQDA 5JDIC 5I8ZA 2C20A 1IHYA 5BR7A 3OIGA 3C85A 2BH9A 5DN9A 4R51A 4BKPA 1W6UA 1H5QA 2DPHA 3G79A 4FJ2A 3RUDA 3PHJA 4FD3A 4IPTA 2JCXA 4E30A 1B8UA 2WM3A 4M89A 5B37A 2I3AA 1PZFA 2IDZA 3QVTA 4P4NA 5C7IO 1Y5RA 4I08A 1IZ9A 4DBVO 5IAAA 4PZCA 4TKLA 1Y8RA 2GZ2A 3WDSA 2BF7A 4UEJA 1WW8A 3RBZA 5FYDA 2NACA 1WLYA 3F1LA 3I9NA 1TVEA 4GX1A 4KWHA 3GVHA 4TMFA 3WGQA 5JXWA 3MJTA 4R5HA 5IDQA 5HA5A 2Q99A 4KUEA 1IY8A 3ICCA 1Y8QA 1PWXA 3FNGA 2YHIA 2ZTUA 4LMRA 4FFMA 4YJFA 5L7WA 4E33A 1GZ4A 3WICA 1ZCJA 2Q4EA 2W98A 1SO8A 3GZ4A 2EGHA 2IYPA 2X0JA 3W6UA 2QX7A 5L51A 3QY9A 1TI7A 4YEDA 5KJ1A 1CWUA 2BFOA 1LDYA 1TA4A 4AJKA 1H9BA 3Q6IA 2E37A 3WS7A 4IDCA 4XB2A 2P4HX 3TN7A 3U9LA 4YB8A 1T2FA 3DBHA 3EYWA 2RIRA 3KHUA 4NBVA 4OXKA 4UULA 5AXAA 3RU7A 3CINA 4FPXA 3HDJA 1X1EA 3JQGA 5H82A 1JWBB 1R37A 4CJXA 2F00A 3H9EO 5EN4A 4FW8A 5H81A 4W7IA 3WGHA 3WJ7A 4I5FA 1SMKA 1RM5A 4IQGA 2VWHA 1ZK1A 3SC6A 3HDHA 4RPLA 2IEDA 4YWJA 3RFXA 1I01A 3PTZA 1PZEA 4CM9D 2B4TO 3L4BA 1LU9A 2UUPA 4Z9YA 2OMEA 4OYRA 4BB5A 3NYWA 2DM6A 4B3IA 2O3JA 2HCTA 1E3EA 3LT2A 2I6TA 4GMFA 1J5PA 3DBRA 3R3JA 2X9VA 5TRTA 4Z0PA 3WXBA 2QRKA 4E3ZA 1ZK4A 1YJ8A 1UXIA 1EE9A 2X5KO 3PHHA 1RM4A 4DIFA 3GZNB 4B7XA 3ASUA 4JIGA 2UAGA 1L7DA 1H9AA 4NMHA 4XB1A 1I2ZA 4IMRA 3MWDB 2CDCA 1UR5A 1TLTA 4JJFA 4Y6PA 2DBQA 1QG6A 4YAEA 1E1NA 4TVBA 5ES3A 5KJEA 4YDRA 1AHHA 3RIHA 4QFDA 2JJYA 3D3EA 3F46A 4LGVA 4BO5A 3U4DA 3HSKA 3JYLA 3IC5A 5DBGA 4YAGA 4FFRA 4FB5A 4PG7A 4J7CA 2OHXA 1G0OA 4B8WA 3IIEA 4HY3A 3U5TA 4Y6SA 1PJTA 4P4LA 3E9MA 4OJNA 4CMAA 1K0UA 4PRKA 3QA9A 2Y67A 2AQ8A 2DT5A 3NT5A 5LDGA 4B3JA 3WX0A 3DAFA 3M1AA 1T2EA 5A5FA 3DOJA 2W4QA 4OHUA 4RPHA 3KRTA 2Y1GA 3Q0EA 1GYQA 1R4NB 3GDGA 1XELA 2O23A 4CM9A 1KY5A 1HE5A 3PYXA 5A9SB 5ADHA 1TEHA 2HSDA 4CMEA 3LF1A 5JC1A 1KIFA 4F46A 8LDHA 5B4VA 3OBBA 1QYWA 5C37A 4L75A 4LVUA 3STHA 3GGOA 3LVFO 3U4HA 3ZGYA 1GL3A 1VL0A 2X7HA 1H93A 3SEFA 1GZ3A 4RORA 1F17A 3WQQA 1X15A 3SC4A 3PWKA 1NWCA 1VSUA 4BO0A 2YHUA 4AJ2A 1BRMA 2FZWA 4FFOA 5TT1A 4CLRB 3MOGA 3RC7A 4WOKA 4WNCA 2POQX 4J1NA 4ZGWA 3ZWVA 1U4SA 2VQ3A 3HADA 2YFQA 2AQHA 1GYPA 2DVMA 4HUJA 1ZXLA 4TRJA 2X5JO 4M8SA 3KLPX 3AW9A 4BNXA 1C1XB 1IULA 4JP2A 2JAPA 4RL6A 5CG1A 1YQGA 5DCUA 4LRTB 4XWYA 5TGDA 4BO8A 4YT4A 1ZNQO 3JYNA 1GUYA 1T26A 1EVIA 1FJHA 3H9QA 5DP1A 4F45A 4RO0A 1F8GA 3G3EA 2PGLA 1NASA 1T24A 3PZRA 2HMVA 3ZU5A 1F06A 1O6ZA 3DAPA 4UUPA 4ZHSA 5CDTA 3NTRA 4NJMB 4CLOA 1CJCA 2R00A 1P77A 2GASA 2P5YA 5L9AA 1RYDA 2JCVA 3GDFA 1FDTA 4WECA 5KTKA 1KEVA 4U0JA 2ZK7A 2B35A 1ZFNA 2JHGA 1MX3A 3A9WA 3BMOB 4P8RA 2J3IA 5CP8A 1S6YA 2AG5A 3QHAA 3QW2A 4BO9A 4J9VA 3DR3A 3H3FA 2CF5A 4II3A 1LLUA 5LCXA 4XRGA 4FS3A 4E31A 3GNQA 1BW9A 2GSDA 1I30A 1UH5A 5HTOA 3FCOA 5G2OA 3PHLA 5JE8A 4O59O 1SEPA 1PJ4A 1V0JA 3S8MA 5I7EA 1LSSA 4HNGA 2C54A 5KIAA 4WUVA 4YRDA 3JQ9C 5CFZA 3K31A 2H9IA 3GEGA 2EXXA 4R68A 3NTOA 3L6EA 2FR0A 2WE8A 2CMDA 2SCUA 3ASVA 3KSDO 4CR8A 4BO1A 2UV8A 4OGWA 4IXWA 3EGOA 4PZDA 2Y93A 2XF8A 3FTPA 3GGGA 5K6AC 3OA0A 4RLSA 2XXBA 5HWSA 2P2SA 2F1KA 4IZIA 3WYBA 3FD8A 3OQ6A 3DDNA 4BNNA 5A3JA 1MUUA 1M2WA 3DQPA 1VJ0A 4EEXA 4FFLA 1EFLA 5KJCA 1ZMTA 3OJEA 3LC2O 2BHLA 3QP9A 3F4LA 4TZTA 4ZRNA 1QSGA 3C7CB 3VPXA 2WDZA 5I9NA 4MP8A 3WFJA 4GMGA 4BS9A 2W90A 1KC3A 3LU1A 2VUTA 4J7XA 3OETA 4OOFA 1PJCA 4TKMA 2NQ8A 1JKIA 5CPBA 1JVSA 1YBMA 3W6ZA 4C7KA 2CFCA 5G4KB 2GLXA 3BHJA 5HM8A 2GRAA 3UCEA 4ZQHA 3OJLA 3NUGA 2EGGA 4DUPA 3GY0A 4QQRA 1A7KA 3FWNA 1N7GA 3ZHBA 4RPKA 3VVCA 3ICPA 2VUUA 3KO8A 1G6KA 4DIOA 1KY4A 3B6ZA 3C1OA 3DXFA 4M49A 4R1SA 4W7HA 3VPGA 2PD6A 1SZJG 2D2IA 2HJSA 3IKVA 3ZV6A 2O4UX 3B1JA 3OEYA 4B4WA 5JYEA 2CVQA 1JVBA 1W8DA 2WTBA 1E3IA 3DZGA 4UVIA 4FOSA 1H94A 3EHEA 2PKRA 1A72A 3PHGA 4WEOA 1ENOA 1KOLA 4TRMA 2PGJA 3UF0A 1ZSVA 4AG3A 1OBFO 4NFSA 2HRZA 1MV8A 1U3VA 4I9NA 3SJUA 3DTTA 1DAPA 4J4HA 4ZQFA 1E1LA 4NFYA 1LDGA 3WTBA 4J9UE 3HHPA 2Q1WA 3VZQA 2YDXA 2X58A 1ID1A 2Y68A 3JTMA 4BGIA 3B1FA 4RDHA 1NHGA 4QT0A 3SBOA 1SOWA 1LEHA 3UOGA 4HFJA 4CUKA 3E1KA 2WD8A 3H4VA 3MJ4A 1BSVA 1ULUA 4IS3A 1Z75A 3E9QA 3TPCA 3JQBC 4XRRA 1RKXA 3KOUA 5L4LA 1DHTA 4GH5A 4N5LA 3A28A 1LRKA 3O4RA 4GSKA 3PIDA 4LCEA 4CUJA 1Y8RB 3VTZA 4Q3BA 3AUSA 3VZRA 4I5EA 3JQAD 3RWBA 3W8FA 2GYYA 4XYBA 3JQ7A 3MJEA 5DOVA 1Y81A 1E5LA 1DHRA 5GZ1A 5DCYA 3VPHA 1EQUA 1M76A 3BHIA 1O9BA 1RM0A 2H1SA 5DT9A 5CDYA 3D7LA 1H6AA 2EIHA 3MJSA 1Y8QB 5K0ZA 2C5AA 2YHIB 3A06A 3AM3A 4YJFB 4QEDA 4XGKA 1JAXA 3DWFA 3T7CA 1F8FA 3PLRA 1SNYA 4CR7A 1O8CA 1SBYA 4YAJA 3D5QA 1HF3A 1FF9A 2IRWA 4J6FA 4LN1A 3RKRA 2VTEA 3LDHA 4Q39A 2WE7A 4XDZA 1HZJA 3PJEA 5I7SA 1GUFA 2EJWA 2P4QA 4HXYA 3RUCA 4I5GA 1ENYA 5B1YA 3UGKA 4OOEA 3FBGA 5A3VA 4B3HA 4F3YA 4CMGA 3EDMA 1QORA 4XCVA 3QIVA 3GHYA 3JQGB 4D7AA 4ND4A 4BV8A 1IB6A 5B4UA 2GN8A 4JX8A 1E7QA 3OEWA 2O7SA 4P4GA 1P9LA 1YDEA 3G0OA 4KOAA 4R5MA 3C3XA 3VZPA 4ZU3A 3ZWOA 2FHSA 3ORFA 4WLUA 5AYVA 4I1IA 1Z74A 2D4AA 4KDFA 2O3RA 2GR9A 2ZIZA 1NAHA 3GMSA 1D7OA 4PLCA 2HMWA 5CDUA 3ROKA 5JBIA 3GNSA 2C2YA 3JQAA 1ZXBA 3DBRB 2I65A 3LT0A 3D0OA 3I1JA 4J1QA 5CEJA 4I9HA 5EJ2A 4PLGA 1NAIA 2NU9A 4E13A 2NU8A 4L0QA 4FFPA 1DSSG 2WD7A 3INRA 5EESA 4URFA 1XIVA 1C0IA 1GPDG 3FPCA 5T67A 3NJ4A 4WCFA 2P5UA 2BFMA 3UH1A 4IINA 3CSDA 2HRBA 3UVEA 3ZV5A 5T8KC 4A73A 1BXGA 1GEEA 1PS8A 3PDUA 4D0SA 1GU7A 4G5HA 1XLTA 3ROQA 1K6IA 4J49A 1HWYA 1LUAA 3RU9A 2ZB3A 1EVZA 3WBBA 2IXBA 5C7OO 5CEFA 2Q1TA 2ZATA 4RPGA 5AXBA 1NPDA 3TFQA 3HUDA 3BMNA 1XKQA 5G0WA 4NFHA 4MKZA 3RUHA 2E82A 1JKFA 4LISA 4DIBA 5KOIA 3JD4A 3NEPX 3QVXA 1SB8A 3HDYA 3WFIA 4PLYA 4BNLA 4H16A 3EAGA 2QRJA 4MKRA 4GSLA 4BHTA 1A71A 2X8LA 3EVNA 3FBTA 3FI9A 1YL6A 1I33A 1TXGA 4PLFA 3LT1A 1DC5A 4BKOA 2D0IA 3M6IA 2BI8A 5BNIA 4GGPA 3ZZNA 1IPEA 3OJ0A 5THQA 5JW6A 4J2OA 4CMKA 1VKOA 3HJAA 2WYWA 4QUKA 4Q3NA 5A4DA 1O89A 5KKCA 4FGWA 2WYUA 1V9LA 2E48A 4FCCA 1NP3A 4MVJH 1BDMA 4J7UA 2VWGA 1N1GA 5AVOA 1M66A 1Q1NA 4B8ZA 3MJVA 4MDHA 2QG4A 4B4OA 4DYDA 3DMTC 3BMQA 4PCVA 1WZIA 4WKGA 5AXDA 2GN9A 2ZYAA 4LK3A 3ADPA 1EK6A 3KYDA 3EMKA 3WBFA 4BOYA 4ESOA 3K6JA 1X7GA 2OL4A 1R16A 3FNEA 4PLWA 5JO0A 3IP1A 1Q7GA 1V35A 2RAFA 3CUKA 1FXSA 1EBFA 4HWKA 2RCYA 3PZBA 4RF2A 3DONA 3V1UA 1E7MA 2QYTA 4DC0A 1ONPA 4JGBA 4E5PA 1GZ6A 5DBFA 3TL2A 1N9GA 1ZSYA 1U2DA 3C1AA 4LW8A 2CVZA 5ILGA 4U6SA 4EDFA 4XYGA 2W8ZA 3PJFA 1UDCA 2D59A 1OC2A 4J0EA 1J6UA 2CNBA 1B14A 3ZU3A 3A4VA 2I5PO 3AY6A 1YKFA 3UCXA 4I5DA 4EEZA 3NRCA 4CLOB 3K30A 1SC6A 2G1UA 1P1JA 3RC9A 2PZMA 2PNFA 1NYTA 1XSEA 2P9EA 2VYNA 3KYBA 4N18A 5EQFA 4CQLA 4FC6A 2P9CA 2PKQO 1Z45A 3KBOA 2GO1A 3GNTA 4KUGA 3Q1LA 5TNXA 4FDAA 1UAGA 1T1RA 5GZ6A 1LI4A 4XDYA 1BW9B 1WDMA 3TL3A 1KS9A 1EBUA 1KVRA 4LCJA 3RUAA 1B26A 2VHVA 2G0TA 1U28A 3INGA 1CERA 3QVSA 4S1VA 1ZEJA 4Q3AA 4QSMA 4XYMA 1WNTA 4NJOA 4WLFA 3NDIA 4MP6A 2Y1CA 1EFKA 3GRPA 3WMXA 1AN9A 5IF3A 3NV9A 1P0CA 3ABIA 4AJ4A 2CDBA 3PK0A 2OBNA 4RVGA 4YJHA 2DFDA 2ZTMA 3BTVA 2Y1EA 1L1FA 1YXMA 5TJ9A 1HKUA 3FWZA 1AGNA 4YT8A 4Z6KA 1DIAA 1YL5A 3H9JA 1XQ6A 5EMHA 3TWOA 4E4YA 1ZBQA 1MG0A 2AXQA 2DUUA 3ZW8A 4CV3A 2ZCUA 2BMAA 4FOOA 3CXRA 5JDCA 1O95A 3OHSX 4EGFA 5BSEA 1ZJZA 3Q2IA 4A0SA 1DIRA 4CM4A 3AK4A 3IJRA 4OAQA 2VZ8A 2BFPA 4CQMA 2C7GA 5COBA 2FR8A 1I3NA 1NBOA 3L6DA 1UXHA 3OQ1A 5A06A 4NNJA 3UW3A 4CM8A 1B2LA 4QFCA 5KWEA 2AQIA 4CMCA 5DNAA 1TT5A 1J49A 3NTQA 3WIDA 2FRDA 4INAA 3B70A 2OZPA 4MVJF 4MVJG 4BNMA 1ISFA 2YW9A 1ZO8A 4R4JA 2B69A 5G4LA 5A1TA 5JDIA 4R16A 1HLPA 3CMMA 5JSFA 5JLAA 2E49A 3V1TC 4ZD6A 3P19A 1CRWG 2NQTA 3AY7A 1P1KA 3W8EA 3GVIA 2PFGA 4PG4A 1LXCA 1V3UA 1JU9A 2FSSA 1EEHA 5HS6A 3E9NA 5B12A 3FTNA 3I6IA 4OH1A 1ADFA 4YJGA 1P31A 4ID9A 4AVYA 2NLOA 2QIOA 3CEAA 1HE3A 1WAMA 4W6ZA 5CG2A 1GQQA 2VUSA 4D79A 1C3VA 1U8FO 5DULA 3H7AA 1DOHA 4XZ3A 3E18A 4RZIA 4A7PA 4D44A 2ZB7A 4CODB 1E7YA 3U4CA 1PGPA 1U1IA 1QV7A 1D1TA 3CH6A 4B7CA 4BGUA 4AJIA 1UXKA 4HFRA 3ZH2A 4R1UA 5FWNA 2X9GA 2VOJA 1DRUA 4H15A 3JQDA 1BGVA 1NNUA 2D3TA 4PG8A 4IIVA 1X0XA 3F1KA 5IG2A 3BAZA 5JO9A 4WE3A 4XGNA 2AEMA 3C8MA 4BL5A 2PZKA 4CM1A 1NWHA 1XG5A 4DC1A 4K1LA 2HUNA 3DZKA 1PX0A 3JQ7B 5AQ1A 3BTOA 3DZJA 4HBGA 1PL7A 5TS3A 5U1PA 1LA2A 3LQFA 3S2EA 1VSVA 1A5ZA 4GKBA 4KTTE 5GY7A 3ZWPA 2NU6A 2V6GA 3VTFA 3DOCA 1IE3A 4ZQEA 4O6VA 2ZJ0A 3I3OA 1I0ZA 3HDQA 2O3QA 5EPOA 1PL6A 3AI2A 3E82A 2GN4A 3FHLA 4JROA 1EVYA 2BELA 4W9NC 5ITWA 1MG5A 2TMGA 3ETEA 3H5NA 4OSPA 5BSGA 1FMCA 2FSVA 3DOOA 1LSJA 4EJMA 4RQUA 4WGGA 1YONA 2P9GA 4NH4A 4J4TA 4XQCA 2NADA 3RQSA 3MJCA 3WGYA 1JW9B 3GDOA 5TF4A 1SCUA 2VRCD 3IMFA 4BQRA 5I9LA 2HK9A 2YY7A 1JLLA 1BHSA 3TSCA 1ZW1A 2IXAA 2YQ4A 3O38A 4BGVA 4E5MA 4BKRA 4QECA 2NU7A 2W2LD 2Y66A 3GN2A 1WWKA 3D4NA 2GCGA 4R9RA 3D1LA 3GLQA 4PG6A 1XA0A 3NGXA 3Q9NA 4IJVA 4JXKA 1HEUA 2JFFA 4IDGA 4YAIA 3TOZA 4XQGA 5KJFA 5IDXA 2NM0A 4UREA 5A03A 4IDFA 3BMCA 3CZMA 4KTVE 4RF5A 1GYRA 4HX5A 5JCJD 5DCWA 3ZWWA 5F5LA 1E1KA 2VTDA 1I10A 4R3NA 2I3GA 4JQCA 4JBGA 4J16A 5G0VA 3VH1A 1GD1O 4J3FA 1QV6A 2WD7B 3D4OA 3Q9UA 1X1TA 3AUUA 4AL4A 3INTA 3RC1A 4BUCA 3WQSB 5EIOA 1YBVA 2GDZA 1MFZA 1E6WA 1YQDA 2OBYA 4DQXA 4DMLA 3I9KA 3AUTA 2XPCA 1BXGB 3ZWAA 4RF4A 2YV1A 4KP7A 3TDKA 3QSGA 1MC5A 2BGLA 4LSMA 4NHEA 4GLLA 1XU9A 1U7HA 3Q2KA 1H2BA 4Y6RA 2Q3EA 4WPGA 1UXGA 3T4XA 3VZSA 1Y7TA 3BMNB 1AXEA 5FFFA 1PZHA 2X22A 4PLPA 4Z0TA 2ZKLA 2XAAA 1MC4A 4DMMA 2W2LA 1T2DA 2I9PA 1PEDA 4EW6A 1XCBA 4XJSA 5T57A 3CMCO 1MGOA 1KEWA 2O4CA 1E7WA 1SPXA 4CMIA 1S7CA 2JKVA 2Y1DA 1I8TA 1W73A 3WG9A 4Z3DA 5F1OA 3VH3A 4D46A 4RLHA 1PR3A 1T2CA 2EJVA 1DJQA 4A2CA 4O1MA 4AJOA 3I9MA 2G76A 4L76A 4D45A 1OZAA 1NVGA 1NXQA 3X2EA 4U8GA 4IGEA 2IZ0A 5KNLA 1NHWA 2Y0EA 1MLDA 3GEDA 3KYDB 3I4CA 2R2GA 2NVBA 4Y98A 5DZSA 3H5AA 3K92A 3U0BA 2PTGA 1NQAO 7MDHA 4RVHA 3ROMA 1Q0HA 4J90A 4U6QA 4OKIA 2UUOA 3DL2A 5I7VA 1IL0A 4R3WA 2IZZA 3QWAA 3LF2A 3FNFA 3ZV4A 4EUEA 3JD3A 4K26A 1XYGA 1N9GB 4ZQBA 1PJLA 2EKQA 3L0DA 4YT5A 4G65A 3G1TA 1I2BA 1DDOA 7ADHA 3G1UA 2D8AA 3TQHA 1PIWA 5ICMA
chains in the Genus database with same CATH superfamily
4XVCA 2H07A 1JA1A 4QU0A 1BVRA 1RLIA 3LO8A 1YDFA 1LSUA 2QN9A 3CEPB 4RMJA 4Z1MA 5TT0A 1JFTA 5CA0B 2QYOA 3IURA 4KE6A 2NZVG 3H19A 4KGDA 4G2NA 4YRKA 2AMYA 2KSQA 4TTIA 2GM5A 4FEYA 4O1HA 4YAKA 1T35A 1A9TA 1FMTA 1LLDA 2OB2A 4WQMA 4DS3A 3QWBA 2DEUA 4IJQA 1YVDA 2JIRA 3GFFA 1N3IA 3DE1X 4ZO8A 2VHEA 4CEIA 2ORED 3VKHA 3BZBA 1J06A 4K88A 3V8MA 3O2SB 3H5TA 2DQ4A 1Z16A 5JNWA 5K6AA 1H4SA 4R8MA 1PJSA 4AXXA 4OMDA 4FFDA 3GRRA 1JA9A 2YWDA 1P2SA 3B1KA 3ONDA 4J2TA 4MYTA 4MW0A 4NZOA 1P33A 3C8ZA 1C8LA 1N2BA 1MAHA 1G5QA 1KBZA 1I4WA 2BSXA 3O83A 5JU6A 1OZ0A 3TR6A 1N4DA 2UVPB 3OMLA 4BZQA 1JA0A 3U5ZB 1Z0ZA 2DBZA 1QYVA 1XXHB 4NPCA 5IKPA 1N5KA 4OXNA 1MF7A 4X1KA 5FPQA 4C9BA 1TAQA 3U49A 3AU9A 5MGBA 1ZI8A 2RGGA 5FAXA 4YJHB 3VU3A 1MB4A 1EUYA 1Q0UA 2Z1NA 4MQ5A 3IA7A 4D82A 2V7BA 3QXGA 4E3WA 4LSZA 1DAOA 3RTGA 3HQ4O 3R7SA 2WF7A 2VAVA 4OEHA 1VE7A 2ALJA 1N2CA 1D4ZA 1OPRA 2QJOA 2VSXA 2VDJA 4MRPA 4GAEA 3S28A 3JX9A 2X4IA 1EWYA 1EHIA 1LC0A 2E21A 1RKBA 1SC1A 4GL4A 1KYVA 4BQIA 4EENA 4CG1A 1RLMA 2WV7A 5AM2A 4HNVA 4R1NA 2C3UA 3BYZA 2JARA 2W48A 3ACDA 2R1VA 2WWRA 3AOEC 4M1TA 1I3OA 4NEGA 4Q12A 4CQMB 3PNSA 1TQ2A 2HEIA 1US8A 3FHJA 1W9HA 4CPDA 4ER3A 2QTGA 1Z5NA 5IDYA 1G5RA 2NWQA 1JDJA 3NHWA 4E09A 4PLTA 1NNSA 1KDZA 4TYYA 5SZKB 2ISCA 4CM6A 3FSJX 1VIYA 2ZZKA 1TT5B 4AM8A 4BVGA 1KRHA 4OFWA 1V11B 1Y1KE 3HXLA 1R0XA 5GONB 3AJ8A 3NDRA 4J43A 2D1SA 4JI0B 2IK8A 4FNMA 4M6WB 4DIEA 3DEJA 2ZAGA 1HDXA 2ZQZA 3RF7A 4PLVA 3W4JA 1DTWA 1NQTA 1Q57A 1SOVA 1X7ZB 4WACA 3UJAA 1HTTA 4ETWA 4G67A 1NSFA 3RC8A 1V45E 3F97A 1FSPA 4L3VA 1Q77A 4Y2PA 1D1SA 1J8DA 2JASA 3W5CA 4YK7A 1EP1B 5ED0A 1T3ZA 1ATIA 5KVVA 3F3YA 4JT2A 2WYVA 1K7SN 2EQAA 3JQBA 3KZXA 2DHQA 2WZCA 3L41A 1W29A 3I42A 3KSZO 4JLOA 2EZ8A 4BMVA 4XEHA 4NENA 4ALNA 2GJ4A 3H1PA 4HWTA 4D0RA 2P62A 2VUIB 2XD9A 3JYPA 4MGYR 4EZBA 4HDCA 4ZV7A 1W36D 4X00A 1SXJA 3ZWXA 1AHPA 1GCOA 2CFOA 3UUWA 1KZ6A 1UMCB 1YRHA 2DU8A 4JBWA 3WSVA 1N6HA 2CXTA 2O48X 2EQBA 4X3CA 5F9HA 4RNCA 1TEZA 2PKQP 2OKGA 3L9WA 3GLGE 1E1CA 3G2KA 3LYUA 3CNBA 3AFMA 1GG8A 1KPIA 1XEAA 4QYMA 4DLVA 3ZZMA 5JVDF 2Z6AA 5EJ9A 1K89A 2RHMA 4YWHA 4Z9FA 1A95A 2BP7A 3KXDA 1T2AA 4LXTA 3OZEA 2R25B 4MUMA 1K7CA 1GDHA 2XR1A 3MOSA 2OYRA 2EHJA 1RXIA 1M2OA 1JL3A 1Q0SA 4I3GA 3RAGA 4PTZA 1Z3CA 3T1VA 1AS0A 2IVFA 3W6NA 4ARVA 4YPFA 3JY6A 1A2QA 3PDJA 3HKCB 3IP7A 2Y0BA 3BJRA 3WGLA 5JFTA 3V4SA 3ECSA 3TLAA 5A7GA 2XCRB 5LVAA 1XVIA 4XJXA 2H59A 3RTDA 4DXAA 2X4GA 1RYHA 1DZIA 4M9ZA 4F11A 1NNI1 3COVA 2G88A 1WMSA 5A3RA 4KXWA 4BX2A 1XJWA 1ELOA 1F12A 1TDJA 1DBQA 2ZRHA 4GRAA 1P8AA 4HEQA 4ZCTA 3FZEA 3P2MA 2GF9A 3AEXA 3G6WA 1A5BB 2I3ZA 3C8HA 3LY5A 4LRYA 3V8RA 5C35A 2YJ3A 1YGYA 2OP1A 4D74A 5HILA 3SG0A 3SZGA 3WLAA 3MTBA 3MQ2A 3P0RA 2Q7OE 1GFZA 1QX4A 2TMDA 2G28A 3N8GA 5J40A 3SJ7A 2V7VA 2W83A 3UANA 1H6BA 3ZV7A 2WAMA 2IV2X 3HI6A 1DAHA 1KK3A 1SBQA 2WEKA 1K6JA 3DLTA 5JADA 5JMOA 1FQJA 4X8MA 3WIOA 3S44A 1T8RA 3QVLA 3U4QB 1T5SA 4CV0A 4CEJA 2IH4A 4A8JB 2EEPA 3IJ5A 4M9QA 3F3MA 1EH5A 4K7JA 3I92A 4I2VA 1L5HA 3SYKA 3UT5B 4K28A 3WLHA 2L82A 2X9LA 1A2OA 1GUDA 1VKJA 2XRMA 1N7JA 1D2RA 3NKLA 2PD4A 1SOUA 1UAYA 3M49A 3NBYC 3QKSA 2EKZA 1FS5A 4YCSA 1W94A 1Y6FA 1EP9A 1K5HA 1JILA 1ZD3A 2A35A 2QVYX 5AM4A 2N1MA 3I3SR 2W2KA 5DGTA 1BJTA 3QEAZ 1NF3A 3SF0A 4Q19A 1IXKA 3R8XA 2Q5QA 4ZIRA 3V55A 4URXR 4ABTA 1WEKA 2FAXA 1M75A 2O5RA 5DLPA 5T5QA 2RE8A 4CKCB 2DGDA 2JL1A 2O2SA 3QU4A 4F72A 3IBFA 3DNPA 3ZDCA 2P78A 4JX9A 2O8DB 1T6BY 3G2QA 1S9HA 1SU6A 5BW5A 3Q3VA 3QXCA 3ZJYA 4HGOA 2VPQA 1OAAA 5A6VA 4KK4A 5T8KA 4BVKA 2G17A 3W5VA 1FRFS 1HDGO 1Y4AE 3CB4A 3IIJA 3KB2A 3LW8A 3WLLA 4X60A 3BMCB 2QXYA 4D8YA 2MSWA 1CPYA 3IUBA 3L92A 3UV3A 1FPQA 2JH9A 2XNKA 1HE1C 3DC2A 3WGZA 3V8VA 2MWMA 3GH1A 3MCVA 5JAUA 1Q2XA 3H18A 1ZR2A 3BTUA 2IDKA 1C3XA 5BOSB 4YQZA 3TQTA 1OWPA 3DHEA 4EATA 4MA5A 1R9MA 5P8WA 1JIKA 1FZQA 1QO0D 1QHEA 1QIFA 4OFBA 4I4TB 5COQA 4C2AA 3ZU4A 1RAGA 2WFMA 1Z73A 1UEJA 4RL4A 1ZL0A 4AF7A 4ZQIA 5JC8A 4IGKA 5JBQA 4OLJA 3NTVA 4IF6A 4MDYA 4BNHA 3RI3A 2H00A 4EGSA 4BLOA 5INTA 2OHOA 3ER8A 1PFWA 2WJVA 3FPLA 3GCWA 3OZXA 1TU3A 3SZUA 4ZGBA 1IHOA 4IZHA 2ACEA 1M34A 2GAOA 3FM9A 2LV8A 2OB1A 2Y1OA 1LJLA 3LE8A 4HEJA 4EX7A 2QE6A 1DZ3A 1F3OA 1QDEA 2YHSA 4OQZA 3VYRB 5CNIA 2PY6A 3LPNA 4KZPA 1I4TD 4U63A 2GKGA 2HK7A 1N5OX 1K6MA 2BGIA 1ODJA 2REQB 3ST7A 1MEJA 2YUIA 3FNHA 4BNUA 3OQBA 3DMTA 3AV0B 3PFNA 1JFRA 3OLZA 1S8FA 4PCAA 5ECDA 4B32A 4MKXA 5H80A 1J2RA 2Y0PA 4A03A 4GZ6A 4B8YA 5KWSA 2VLBA 5DYTA 2VAMA 2EGUA 1PEAA 5CNKA 3RABA 3L06A 4ZOLF 4LECA 5F3DA 5K0TA 2F2TA 2WT8A 1HYHA 4RHCA 3PQ5A 3WLPA 2OOSA 1M1NB 1UP6A 1MH1A 2PJUA 3USZA 3B3QA 2QI9C 3HCAA 5F4BA 1R0BA 1VJDA 2I4RA 2WJ6A 2OECA 2W2QA 2EBHX 3M6FA 4YJDA 3FKSD 3LRPA 3AP3A 4WXRA 3A26A 4E5YA 5HEKA 1CY7A 3OE5A 4L73A 4Q3EA 1HDRA 4IFTA 4BKUA 4F6CA 3C98A 3JRWA 1E92A 2VA8A 4LDZA 4W5NA 4RH3A 3R1IA 1U7PA 3BRQA 3MC1A 5KYVA 2PKXA 1QGAA 1I51A 1E3QA 3F4KA 4AZ3A 2ZCVA 1E8DA 1G3QA 2PT9A 4ZDWA 5JUWA 4U9IS 5TR9A 4F4DA 4HQLA 4DXHA 1VRWA 2UKDA 1Y1LA 2HSJA 4WH0A 4BLRA 3FN4A 3M82A 4AURA 4EHFA 3SHTA 5JH7A 1BWQA 3ADCA 1VMKA 1Q1AA 1R10A 3I5MA 1DFGA 1SCJA 1LNQA 3ZI0A 1L1EA 4PV7A 3MFYA 4DWVA 4P53A 5HKKD 1AUPA 1I32A 5K9ZA 4AF8A 3HMKA 1UJMA 3ZWDA 3B20A 4AIRA 5FLXA 3D3JA 4N41A 5JJIA 5IJAA 4Q47A 5EZQA 1K9SA 1C9NA 4Q9LA 3ZE8A 1RLUA 3ON5A 3MB5A 4KQ6A 2J3MA 1C30A 4LYHA 1NT4A 3ETDA 1LPBB 2I80A 3KTDA 4WTOA 3SQWA 3GAZA 3D4LA 4NE2A 4IW3B 3U44A 1PDVA 3VYTB 4G07A 2Z5VA 4ND2A 1X14A 2QY6A 1EVLA 1IRXA 5FXMA 5CJJA 1U98A 1QZTA 3A4NA 1CFJA 2FUG6 5DWQA 4B4UA 1OYOA 4URVR 2FFAA 4UTPA 2A3RA 2M6SA 1TO2E 1U9CA 3MEQA 1RVV1 4KKVA 3H84A 4HRYA 3TD9A 3VPDA 5KCMA 1S8AA 4NAUA 5D51S 3WIEA 1LVUA 4DCNA 1ORDA 2L2QA 3KKZA 3F90A 3UC5A 2NT3A 3OU7A 4O2AB 4JLUA 2OD2A 4I1OA 5A6SB 3PC3A 5HJ2A 3OFKA 5E4JA 4RXMA 1CF2O 7REQA 1LNSA 1NJSA 1SGWA 5J5VA 4ICIA 1CS0B 4C6TB 4NCXA 2XECA 4DSUA 1TZJA 1NP7A 4JJ8A 4DRXA 1ACJA 2XUHA 5FO1A 1T4CB 3CLRD 3DMFA 1QIKA 4O33A 4U7PB 3KZOA 3JQFA 4O63O 2IX9A 1R66A 2G4LA 5EXDA 4EHDA 2WF6A 5B4TA 1Y9JA 3IP3A 4OG2A 1N0VC 1HXHA 1SHLA 1I0IA 1A76A 1ESNA 1A5SB 1TYCA 1BX3A 2XUDA 1GQ2A 2R6DA 3D2LA 2KPOA 4O0LA 1JDTA 1TCUA 3HMQA 3JAKA 2M6KA 2PXHA 4ZYWA 2JAHA 5F2NA 1OLOA 1FX0B 1V7ZA 2IZOA 1FDUA 2JFHA 4ESEA 1XL0A 1GTRA 4PXSA 3O8QA 2V0CA 2QUAA 5FDFA 2J08A 5A62A 4DVJA 1K2WA 1C3JA 5L53A 4P98A 1YUBA 2ZE5A 2PTHA 3FJ1A 2FUNB 4ENVA 4M7WA 3KYJB 1UBNA 1G8HA 3WB9A 1E3MA 3I58A 3K2BA 3QRWA 1UQRA 5E1BA 1GADO 3WNBA 1EA5A 5D01A 4LQLA 1TUEA 4GZMA 2GXSA 3OFJA 3LUBA 2BEVB 4L95C 4U3JB 4X8LA 3LNTA 4RTJA 1B93A 3MGCA 3GFOA 4GLOA 1CEQA 4RSHA 2A1IA 2NXEA 3CW2A 4ZRDA 3C7TA 3N2YA 4O1IA 1LBIA 1ZQ1A 2PVCA 2AZMA 1L4YA 1DC3A 1FDWA 1VLQA 1P5FA 2E7ZA 1VRCA 1HT0A 2I6GA 3AUJB 3GCXA 2OCYC 4OLHA 3BBPA 3I6ZA 2I0FA 4ZT6A 5TPZD 2HLPA 1JIUA 3GRYA 3N2KB 3WADA 2WUDA 2WTUA 4URYR 2NUTB 4HX9A 3KV1A 3MBKA 4ACBA 5J1SB 1U8AA 1OFUA 1K1EA 2BHNA 2DBVO 1MZVA 3UTDA 3GRVA 1P17A 4ARUA 5B6IA 3OCJA 1EHYA 3EIWA 5EVCA 3TQFA 5K2OA 3WGIA 2J85A 1ZD9A 4RMIA 3Q41A 3WGOA 4UBOA 2X2FA 5EWLA 4YJKA 2HSWA 3Q1KA 1MB3A 1VL5A 3BFXA 4LKOA 1IPFA 3HB5X 5J4KA 3VNUA 2P2ZA 4CCSA 2JFXA 4L07A 3VU1A 4R8KA 4N76A 3V48A 1ISSA 1XDUA 2QZJA 3JARA 2Q7DA 2IODA 2V7GA 3AFOA 2I7VA 2B8TA 3A05A 4RAQA 1DCKA 2UZ3A 1B41A 5FWDA 2JFGA 2QVBA 3TM4A 4WLOA 4YA6A 3T3DA 3E23A 1MRSA 3R20A 5EHGA 3L4BC 2A84A 2VTKA 5FV7A 3ZXXA 1FFXB 1ZJJA 3HJGA 3VTAA 3NDBB 1K5GA 2CFTA 3NEYA 3A9CA 4J0HA 4PFKA 2LDBA 1F5NA 1KC1A 1P0PA 1CUXA 1PFUA 1TUIA 2X8JB 2X86A 3B51X 4XPIA 2F3RA 3WNQA 4J0JA 4QJ4A 3RSSA 4XLZA 1WZCA 2JGIA 3MD0A 1E64A 3OWOA 3BH0A 3I6BA 4YAUA 3D6HA 3QX9A 1K6XA 2Q5LA 4ZAVA 3FETA 4HQOA 1E2EA 3VDNB 4FEEA 5HFAA 1NNEA 4N12A 4RYLA 4YCMA 5IDWA 3ZH9B 4P3XA 4OM8A 1SKBA 2PMKA 1DT3A 3K71B 4HAIA 2ODWA 3E05A 2HO4A 1GZUA 4YDQA 3S7ZA 4C20A 3C4VA 2HDHA 4C0XA 4YUZA 3FCSB 3OPYA 3U3OA 1K2VN 1TU0A 4YUXA 3G9TA 2ACKA 2OBXA 3TZHA 2IYUA 2G9NA 1YAHA 5A2GA 2J41A 5HSGA 3WK4A 3NV7A 2QTWB 4LYGA 4KGZA 2O8CB 4KLNA 1U6JA 1IBRA 3ZG6A 5EPUA 4B34A 2ZAIA 2A78A 1CUYA 3CPSA 2C07A 3TE7A 3T7TA 4L50A 4Z4GA 4Y0NA 3VVBA 4YPVA 4OIMA 4WWHA 4NESA 2P91A 4ENSA 5E6UA 3QTLA 4Q3CA 3QUBA 3TKAA 1TMGE 4MIYA 2WZBA 4QQNA 1Z6QA 2REBA 1RYBA 3M6UA 4UPVA 2PRSA 4EZEA 1FFDA 2B1GA 1E8NA 3TFWA 2AFHE 1H05A 2HQ1A 1M74A 1UEIA 2AUNA 4PFSA 1MRNA 1U8XX 3W3AD 4DL9A 2HM7A 4F6LA 4OQFA 1RZ3A 1RXWA 5DBEX 4EA9A 5CYGA 2NXJA 1NX6A 1WCXA 2HGSA 2P4EA 2VPPA 4ZEVA 1E79D 1KYQA 3FE2A 1QTIA 3L0BA 3EQ8A 4R31A 5TMDA 4B7AA 2BKLA 4JVSB 1X38A 3PYLA 4IDBA 4IIEA 5AXCA 5IXYA 3DQQA 3CN9A 4MUFA 3IHLA 4O2BF 2O3TA 4OGFA 5L7YA 4U2FA 3VH2A 4DZTA 3BE5A 3PFIA 4Z5XA 2VDUE 2RHCA 3O26A 1SXPA 1HE4A 1SU4A 4WFQA 4HDNB 1YC2A 3S70A 4WLVA 4PC1A 5TV2A 2IUSA 4UVEA 4ISBA 2E5LB 4V0OA 1X1DA 3O3OB 4PVDA 2C4HA 4UZSA 3WDKA 3V2HA 2GTIA 3PNQA 2IU4A 2QD1A 4EJ0A 1G41A 4I5IA 1W581 2HHHB 1XTSA 1HZZA 4IOJA 1Y63A 3S2FA 4IIGA 5GGXA 5F21A 1M73E 2CV1A 3O2NA 4U7TB 5TQ2B 1O2DA 2VT3A 3O90A 3OQNA 2CV0A 5GQSA 3Q9SA 1T5DX 3HEMA 4MAAA 2HB6A 1BH6A 1QIGA 3BWEA 1T0HB 2CB0A 4H0CA 3SY8A 3LPAA 3OZAA 4MUNA 5ILOA 1CRLA 2HPAA 1YB4A 4K9SA 4UATA 3IE1A 3FUXA 1FS4A 2XF2A 3OP1A 4YRRA 5IVDA 2FWJA 1FRZA 4KR0A 1JG3A 1G7RA 1QS0A 3QWIA 3VR5A 5BWOA 5FD8A 2QRGA 4IJWA 1WOMA 3BM5A 1X7WA 2ZEJA 2GEJA 3E15A 3AB3A 3K9QO 4UEOA 3L6BA 5G41A 2WWVD 2HJGA 4BQQA 1WSAA 2DSTA 2HY7A 2XA1A 3H3JA 4KYVA 3ZGNA 2BBSA 5HQ3B 2O5CA 5IULC 4L57A 5JRDS 1NJFA 3RIMA 2R00C 1VLVA 2EJBA 4GX5A 5J59A 3VNRA 3ZR4B 3CN7A 3C5WP 4RDIA 1T4GA 3R5XA 1YI1A 3WLOA 4LJKA 3O1JC 3W5HA 3NKVA 4AFNA 4UNRA 1QBGA 3ISJA 3EGWA 3RW9A 4CTOA 4YCLA 4ARIA 2PVPA 3R7FA 4B3RB 3STXA 4BP8A 4CCYA 1A7AA 4PYRA 1E6EA 1CK4A 1I5OA 1KI9A 4DLTA 4DZZA 5KU1A 1ZC4A 1U7XA 3BIJA 3C0KA 5ARBA 3U7GA 1PQWA 5HGJA 4HNSA 4NC9A 1O94D 3HLYA 2G1AA 3QLVA 2HWXA 4RHTA 3T8YA 2HGZA 4FW9A 3MUOA 4CLDA 3LDFA 5IZ4A 1HG0A 2OAGA 1BE0A 4DSOA 2JCSA 1QAOA 1Y82A 2PZAA 4NU6A 4CIVA 4JLDA 3N0XA 4E1BA 2XCQA 3K5HA 1L8QA 3R0IA 3KR0A 4KBGA 4QIHA 4AI6A 2W8BB 3VNBA 5IK2A 3PU6A 4ALLA 4EAQA 2VDQB 3TSOA 1UK6A 4DIMA 4JITA 2ACVA 3SEQA 2XUAA 3BE8A 3JD1A 3S8EA 5DN6A 1KPHA 1CVRA 1JXQA 5LZ9A 1R9GA 4DLXA 2OV6A 1QU2A 2BGNA 2P11A 4IMPA 3FOWA 4IDNA 3AY0A 2WJJA 3GLGB 5BQPA 2XODA 1UAAA 4RK6A 1H65A 1VG1A 3T34A 1IOLA 5BQ3A 4G1CA 5YASA 2CJPA 1R64A 2BFCA 1Z0DA 1FRNA 4I1UA 2Q2WA 4XIYA 2IYEA 2P7HA 1IQPA 3WLTA 2BLLA 5DLDA 1YA6A 1WBBA 4FKZA 2A3NA 1K8QA 3MTGA 1CUAA 3K9LA 3C5VA 4HLQB 2E4AA 2PUJA 1MTOA 3CA8A 1DOAA 1DAKA 3CX8A 3GYBA 5AVJA 5HBRA 5KOJB 1G3UA 4XWOA 4L4XA 1I36A 2JGAA 2GNAA 3QELB 4Q15A 3IEVA 4B0PA 3QHPA 1OX4B 1CZRA 2GHRA 1JG6A 1XMSA 3AVOA 2CWDA 4LV5B 4PYNA 4U9HS 4DUZB 5TLSA 1ZGAA 1XZEA 3EFHA 3ONFA 4JC0A 3A3NA 3KLOA 4MIEA 4JT4A 3GBPA 2ONKA 1W75A 3AWDA 2GCOB 1OPXA 1ZONA 3BFPA 1EM8A 3QVOA 4HJXA 4MQUA 2PX5A 4PINA 4WNAA 5CT8A 5IBQA 4KUHA 1LI5A 3OH8A 4OMUA 3LC0A 3U2QA 1NF2A 4HH3C 5IUNC 4LF6B 1MAVA 1V16A 3VO8A 1RD4A 2CLIB 3IKLA 5AI8A 5BN1A 4I0WB 4CIYA 1EG2A 1QLJA 3GX1A 3IHKA 3L3BA 4AWAA 4CFSA 3H16A 3B7PA 1KVSA 5LXTB 1UDAA 1UP4A 2HJWA 2P1ZA 2WM8A 1WKVA 4UASA 2C5HA 1E0JA 1X1QA 4M8KA 4PAWA 3RYCA 1OBOA 1XZAA 1J90A 3UCFA 4F3CA 2DHRA 3F6YA 5KEIA 3OLVA 2F67A 4MP3A 3GP8A 1ECJA 1ZZEA 4FJ0A 1U4OA 4YGYA 4HB2A 2CHFA 3GP5A 1OFGA 3R9XA 3RROA 1NVMB 3D31A 1JZQA 1MN6A 3NH9A 4N5NA 2FUKA 3NOQA 5EINA 4EG5A 9LDBA 5C8ZA 2H6EA 4B7ZA 4KK3A 4TYPA 5GMOA 1CJVC 3P9NA 4P86A 3ROPA 1X80B 1LRLA 1XVTA 3AF2A 3DUFA 3HL0A 4MO2A 4UPDA 5DSXA 3T7AA 4DBZA 4EY7A 4B2YA 4EUKA 1LS6A 1TK3A 3KR1A 4JC5A 3ZCXA 3TSWA 5EMJA 3KHTA 3KCQA 1BVUA 2NZYA 3DZIA 3AOEA 4WY5A 4MJXA 4TV9A 2V03A 4XARA 5GOZA 4D3XA 5BN5A 2BGGA 2VRWA 2JW5A 1ZNYA 5EEHA 4Y8VA 4ZCPA 4LMPA 2FXIA 3HM9A 3V4RA 1Y6GA 4L6AA 3PGMA 4RACA 4CLXA 2I67A 1SWWA 2SHKA 1SIUA 3ESDA 2HT6A 3QX8A 4JBNA 5U4XA 2C95A 1QTNA 3ET5A 2OM2A 3B13B 3KJGA 3GOHA 4QYTA 3ZKWB 2ODAA 1J0CA 2HLNA 3OLCX 3EWSA 3NXSA 1YFLA 4FIZA 2QU7A 4RU1A 1CJKC 3D7KA 3GOQA 4FLMA 1GPKA 1SQFA 1KO5A 3LYAA 1UBSB 1TQ8A 1P0MA 2L0XA 2V9CA 2Y27A 4BXOB 1ZUWA 2QJFA 4BVAA 1KMQA 1YA8A 2B37A 2H5EA 2UZAA 4A3SA 1MU0A 4EFLA 4HATA 1EHCA 1H42A 4XR4A 1OHHA 3RS4A 4E6PA 3G5AA 2ZR0A 5AD1A 3CEJA 3KLMX 3QSYA 3PUJA 4FGJA 3NM4A 2BFAA 2W2VA 3DPUA 4O4IF 4POAA 4D6YA 1LJ8A 2OT3B 4P7JA 4NK4A 5BSWA 2ZPAA 4UEKA 1ZSNA 5E9QA 4EB6A 5C1OA 3DVAA 4FJ1A 2DE0X 1EE1A 2K7ZA 3P0JA 3U7IA 5I6DA 5AVWA 1YQQA 1QC5B 2QD3A 2WR8A 3H5RA 2QYSA 1WZUA 3TPFA 3QOFA 1FRVA 4HQNA 4BYGA 4N3BA 2NVOA 4KFRA 4PZUA 5BO5A 1XRRA 1IMJA 3EG9A 1P60A 3CNOA 4D6XA 5M2QA 3GH3A 3IIIA 1UXJA 1NG9A 4GBMA 1TJYA 1ZK2A 4ABYA 5HIMA 4LY9A 2I2AA 5ER9A 4MWOA 3GQVA 1GV1A 4MW5A 1R9JA 3WTCA 1LTQA 2J5RA 3D64A 3I6QA 3R7LA 1A0OA 1FDSA 1P74A 2IIBA 3TDMA 4C7VA 5IAOA 3RAJA 1H1DA 5JAQA 4V1CA 5GZ3A 2PGDA 3H2YA 4TTVA 4W63A 2IUTA 3UWPA 3OHMA 2DFTA 5IH3A 3H13A 4Q02A 1NW6A 2OQ2A 2CBXA 1W7AA 1E3JA 1LPAB 1IHUA 3ILVA 1GHTA 3NHSA 5LZ7A 3RV3A 3ZI4A 4B2IA 3RTAA 4C5AA 1GPMA 3DE4X 1X1SA 2ZM5A 1ZK3A 2PCLA 2BRUC 2QLMA 2VNAA 4UMFA 5FI0B 3HZZA 3RRZA 4Y30A 2NP7A 2PS0A 1ZK0A 2I4OA 2NUPA 1OOEA 2V6MA 3L07A 2HA4A 5FJIA 4PIPA 3M1IA 1A4XA 2P3SA 2FWBA 2YY6A 3PL1A 3UNXA 4E12A 1VI5A 1N2SA 5A4JA 3IDOA 3MLAA 3FLBA 2X0NA 2I7DA 3V2UA 4DANA 1GUZA 1CVLA 1RAIA 1XI2A 3FAZA 3L46A 1VGVA 2CLEB 3QXJA 4DA7A 2QZZA 1I94B 2CY0A 3RIEA 1GTSA 2PS3A 2BZ1A 2F1OA 5KOHA 4UM7A 3ZIUA 5FAKA 2HFKA 1BCSA 2KBFA 3WB2A 1CNFA 4H9GA 4GPEA 3E5MA 3JQCA 4FQ7A 4MVJD 1PFKA 1TRHA 4WLEA 1SHZA 5A4IS 3BRSA 3EDOA 2RKWA 1TGYA 2WJ3A 1MX9A 2GS9A 4HN9A 4JEMA 4MCHA 4BQOA 5CXXA 1P3DA 1SKMA 4OO3A 1UT6A 3PQ4A 2J9GA 1GLNA 5F2OA 1RRCA 5B57C 3TFOA 3T12A 1BXKA 1OYYA 1T3SA 3LCUA 1ZIDA 5IMBA 1L7NA 1GY8A 3HJBA 3MTJA 4MGEA 3T3IA 4IDEA 3IUSA 4M38A 2WSYB 1T8SA 1RM3A 3UG6A 5KYUB 3KKPA 3K8ZA 3ZK9A 5JQWA 3Q3HA 4COKA 3NAQA 1CUHA 4JK3A 1AOXA 2C88A 3KAJA 4ZAFA 3ADDA 5DNDA 1B4DA 2NO0A 4A2WA 3HYTA 4GX0A 1UT8A 4ZT7A 3WQBA 5K8UA 1FSSA 3PDCA 1O54A 3LG2A 1NSTA 3BFJA 4PZEA 3RR2A 2KQUA 2ISSD 2YL2A 4CHGA 1C7ZA 2AVDA 2AMVA 2IYZA 4MPDA 4X7MA 5CH3A 3Q5DA 2JFYA 3PQFA 1B8VA 2C5SA 3E2PA 4G0MA 4I4LA 3KAQA 2Z6VA 3FB4A 2Z6UA 2RHOA 1XEWY 2RGDA 5HG0A 3HXMA 1PQ4A 1XDDA 4JODA 4B4VA 1MBZA 1SVIA 1XEXB 3CUYA 3FPJA 3IV7A 1CQIB 1NRWA 4HRAA 3IJPA 5AK5A 5I48A 3AF6A 1UL1X 2UYQA 4H3HB 5T4EA 2H0AA 1P44A 2QAGB 3GVXA 3HO8A 3ORSA 2I4NA 3D2BA 3O8OB 4JJ4A 5DV9A 3AG6A 5FOVA 3RTCA 1RFLA 4IV0A 4D8WA 2PS1A 3UXMA 3TBFA 4XWKA 4GG1A 1ZGZA 1KAOA 1X8KA 4NBSA 2AHRA 1MNQA 4HWPA 3TCXB 3ZNQA 1WXDA 3WDMA 2I66A 1KDTA 5B3AA 2O1SA 1BC5A 4ROTA 5COAA 1R6BX 4IIBA 4P93A 2DTXA 2J09A 3AZOA 4AJJA 5TC4A 1DV2A 3SDZA 1JIVA 1PQPA 4ZICA 3DCJA 2WNIA 3WYAA 4PHTA 1HMYA 1NQOA 5FTLA 2AKYA 3SVLA 2BDEA 1M3SA 1R7RA 1UOOA 4BASA 3BMOA 4OB8A 4ARZA 1Q50A 5FTJA 2GGSA 2O2EA 4DN6A 4RGBA 1RHKA 3DZHA 3ZWBA 4UZEA 3O4IA 4KPUA 4C2UA 1PCXA 4D6PA 1SUFA 2QBYA 4C4ZA 3R3SA 3LUCA 1GPLA 3ZWOA 1YE3A 2D7JA 2YY5A 4HEHA 2GJKA 3HG7A 2D2FA 4ZQGA 3ME5A 4NG5A 3CXUA 1E6LA 1YI8A 4RIGA 4LNUA 5KU7A 5B7NA 1SULA 5BUSA 5JATA 2OGUA 4QICA 2PLRA 3JTEA 1U2QA 221PA 5CEEA 1JB9A 3TNYA 4ITRC 1O0CA 1WDKA 4RTOA 4UTRA 1IIBA 4UTVA 4U5QA 4XFJA 4K9RA 3I9OA 1QO0A 4KVFA 5T4HA 4LOIA 4YP9A 1PSDA 3WGTA 2UYYA 3ZTYA 2EERA 4TL9A 4HQ0A 2C9ZA 2YV2A 3HCEA 2GPAA 1ZRHA 3PDIB 3LO5A 6REQB 3U60B 1WX1A 3DB2A 1ZMBA 5AJWA 4CQMD 5IYZA 5KYWB 1BTOA 3KUUA 3LYLA 3DE6X 4FWIB 4L74A 3T4PA 3CKYA 3ZOKA 3BK7A 1BWSA 1UJ4A 1WDTA 4M0LA 5AWFC 3HU5A 4ZRMA 1PZMA 1QRRA 1R5OA 1HYEA 4BO4A 2AJTA 4JI4B 4OQXA 3W5SA 3ZE0B 3TECE 5K0BA 1GPJA 1TAHA 3O3CA 5ALPA 4BE4A 3TG8A 1RI2A 2V6IA 1Y98A 2IU6A 3PRJA 3SLKA 4X6UA 5A4MS 3NDPA 3OF3A 4G0QA 4I8XA 2VWQA 4UBMA 1FFGA 5F9MA 5EJ6A 4JL5A 5MN6A 3JZDA 2QX4A 2ZREA 5GIOE 3EZLA 2QUBA 1Q15A 1SIBE 2J32A 1W0CA 4FWBA 3OT4A 2B8NA 2H4WA 3AIKA 4BMOB 1I6WA 1XF1A 2Z1DA 3TSZA 3K20A 4MVYA 1MW8X 2QNBA 3FNIA 1WL8A 3DL4A 3MWGA 4QGBA 2Z8ZA 1NLUA 3R3HA 4WUTA 3O6VA 2Q9CA 4KPFC 1JWAB 3BWVA 3HR4A 1E99A 1Y3DE 3K73O 5CXSA 3UJDA 4JJKA 4IFIA 4XE5A 4QLBA 7ABPA 5LDHA 5CPFA 1VYHA 2P4UA 2A9FA 1O95C 1B7GO 3FOFC 1NT2A 2AC2A 5KNBA 1IZZA 1V4NA 3FKSA 1WEHA 4KIUA 4TL6A 2H2FA 4E0BA 2R7LA 4PRLA 1RZUA 4L4SA 5E9WA 4N8SA 4E14A 1D2GA 2VO1A 5LWHA 1N36B 1EX7A 1KDYA 1U8YA 1JTEA 1R4MB 3V2IA 4JVLA 2FR8C 5CT9A 2Z4TA 3D4PA 4G5FA 4H7FA 1KH2A 1R8QA 2W2OA 2V0NA 3ZXIA 2O59A 4QU5A 2XB6A 1PYDA 2O3UA 3MMZA 1Q19A 3DJFA 3SKVA 3MOIA 4HB0A 2Q3JA 3IVRA 3UBMA 2I8LA 3K0HA 4W99A 1WP9A 4ND5A 4XX0A 3NVKI 2FU5C 2ONZA 2OXFA 3KTFA 3HGTA 1AK1A 1WIWA 2HDNB 2K2WA 2AF4C 2OEPA 2YIJA 6YASA 5BXQC 1NBWB 2QMUA 5TGZA 1XA3A 4EW1A 4NP6A 2UZ4A 1OFVA 1FXUA 1ZBDA 2C20A 3G68A 4F9FA 5HKKA 5EXEA 4F4HA 1Y1QA 2JBHA 2WFAA 2ZT8A 4FX2A 4DG5A 1EYZA 3C85A 2AFHB 1WXEA 2BH9A 1ZGJA 4Z51A 5DN9A 4BN5A 1TADA 1M0EA 4HG2A 1GZSA 1KAQA 2AYYA 1SBZA 4MW7A 4UUQA 5ALUA 5EFOA 2UUCB 3M4ZA 1MEEA 1G8AA 1W6UA 1TPYA 4D98A 2QMQA 3D3KA 2HQBA 1O1YA 3PHJA 2JCXA 2VR1A 2BTQA 2WM3A 4M89A 2Q6LA 5B37A 2CWWA 2WQZA 4TTPA 3FVVA 1Y5RA 1IZ9A 1J20A 4IFBA 1FSFA 2K7FA 3Q8MA 4DCSA 3P0FA 1Y8RA 2R5FA 4DTCA 4B35A 4ZYZA 1CFZA 1WW8A 2PAFA 2ZBQA 2FPGB 2VK8A 3F1LA 3LQ2A 5FYDA 3F78A 3GVHA 3DDCA 4H2DA 5JXWA 1K5DA 4ZI7A 5FA8A 3JVUA 2GX6A 5HA5A 4YJ3A 2W93A 1IAQA 1IY8A 1XJ0A 4KUEA 3BERA 3CO0S 4B83A 5CFRA 4CKZA 1Y8QA 4MW4A 4PQRA 3FNGA 4YJFA 4AKEA 3A3KA 3ZVRA 4DJAA 2EL9A 3BMXA 4A6PA 2Q4EA 4MWGA 4EH1A 4RE6A 2W98A 3GZ4A 2EGHA 1MQ9A 5L51A 1BX1A 3HRHA 4HXEB 1TI7A 1TVMA 3C6ZA 2EDCA 3TX6A 2HIHA 1LDYA 4QTUB 4NCIA 1JDSA 2ZR9A 3Q6IA 3UMVA 5DIFA 5ECYA 2EX0A 3AKZA 5BN3A 1IM2A 3CUUA 3RE1A 5FBRB 5ADWA 1J7KA 3VR0A 2P4HX 3TN7A 4AXBA 4DMHA 2LKDA 2FN4A 1WSWA 1X9HA 3DBHA 2Q0SA 2RIRA 3KHUA 4OXKA 4WZBA 3N76A 3W90A 3I53A 1SUDA 1X1EA 3HDJA 3I28A 5AKLA 5AMXA 5H82A 3W7AA 1UM9A 3TQIA 3UJNA 3T9AA 3N2LA 2ZSHA 2C2ZA 4QTTB 1SBCA 1C2TA 1J00A 1GSIA 4LXXA 4QJ5A 1AN0A 2Q3LA 1OB2A 2O8FA 2F8SA 4W7IA 3WJ7A 1FTNA 3HSYA 2MSCB 3T06B 2BWJA 1CF4A 4RPLA 4MUYA 4PO9A 4GOXA 4BZWA 4CDMA 3PTZA 3QOYA 4A8JC 3L4BA 3A6GA 1LU9A 2AGVA 1CQPA 2XGSA 4OYRA 2FKNA 2A9VA 3QU5A 3NYWA 5TQ0B 5D87A 4GMFA 3DBRA 4JI7B 2VZLA 2ZYIA 3HBJA 5TRTA 4A2QA 4GXNA 3CR7A 4LBVA 4HZIA 4HSGA 1G20A 2HDOA 4OCZA 1UXIA 1DBRA 1EE9A 3M89A 1YZ3A 3PHHA 2B7LA 1EUQA 3V33A 4PPFA 5DGHA 1K3FA 2PBRA 2UAGA 3RK0A 1H9AA 1Z83A 4CF7A 4H6XA 1QFYA 4NMHA 4WNYA 1WHTB 1S89A 1ZG3A 1NVXQ 3COYA 1U0EA 1T6XA 2RHDA 3PWTA 1UR5A 2QUZA 4GOOD 4ZOLB 5HUJA 3N05A 1A5AB 3OMWA 1OFHA 3RPEA 4IHJF 4FYJA 3AJAA 3EH2A 3V8NA 3HSKA 2IL1A 5DO9A 1U04A 4BTLA 2XIQA 1N9ZA 4U2BA 3O1LA 1QF6A 1QGUB 4FYKA 2OHXA 1L4KA 3PS9A 1SH7A 3IIEA 2W4MA 4JAVC 4TTJA 1UBFA 3VDXA 1K0FA 2WTNA 1H8EA 1T5LA 3FCAA 5LLDA 5BPHA 3IAXA 2DPLA 4BMDA 3UGTA 1UMBA 3GZJA 5IWCA 5KI6A 2O0KA 3LVBA 1RDFA 4FYIA 5NULA 3KKQA 4D4MA 2XE8A 2JH3A 2IOFA 2AQ8A 2KM1A 4NMLA 3T1YB 1OUMA 2DT5A 1NOKA 5CB6A 3DAFA 2RGNC 1UCFA 4F86A 3TO5A 3W79A 1ZA1A 2BMEA 1ZVVA 2H5IA 2JFZA 2VJPA 2W22A 2XNCA 3PHCA 3U1TA 1HOXA 5FTKA 4M1ZA 3NWBA 2O23A 1BEEA 4F56A 3GZTB 4NYJR 2P2YA 5ADHA 1V41E 2IPMA 2BMDA 3CUVA 3LF1A 4JP8A 3N59A 4LVNA 3OOYA 3EGXA 5C4IA 1QYWA 3I1YA 3P0EA 4QOFA 1UOEA 2LTAA 3D7MA 3EF1A 2ZPUA 3LVFO 3L7YA 1ZL2A 1BXRB 2VF5X 1JSZA 2AJCA 3MCZA 2R6FA 1N0HA 4E51A 4UE6A 1WO8A 2HF9A 2GI4A 4RVDA 1CV2A 1RRKA 2K6GA 4CL0A 3DL7A 3RU3A 3ENWA 4G0PA 3AF4A 1L3IA 4BO0A 4EZIA 4MW2A 4EARA 2VAXA 3UOAB 1UIRA 1II8A 4WZAA 4E5SA 1V26A 5TT1A 4CLRB 2OGTA 2ZZNA 4LZNA 2J6BA 1HEYA 4M76B 4WOKA 2AX4A 1X87A 2ZBVA 3MCTA 1OXBB 4J1NA 1NW7A 3P0IA 4PW0A 3B7WA 1P4HA 3ZWVA 2VQ3A 3HADA 3PUYA 1W4LA 1EB8A 5T7BA 5GVRA 2A57A 3ZHTA 4BRSA 3OCYA 1GYPA 3O4FA 3W3AA 4HUQB 1ZESA 5C8DA 5JD5A 1ZXLA 4C05A 5K6TA 4JYAB 3GUZA 2NGRA 2POCA 3KLPX 4A8TA 4JP2A 2H3HA 5K09A 2LWIA 4XUCA 1AKTA 2JVIA 1YQGA 2W9XA