3TWOA

The crystal structure of cad from helicobacter pylori complexed with nadp(h)
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
347
structure length
347
Chain Sequence
MRVQSKGFAIFSKDEHFKPHDFSRHAVGPRDVLIDILYAGICHSDIHSAYSEWKEGIYPMIPGHEIAGIIKEVGKGVKKFKIGDVVGVGCFVNSCKACKPCKEHQEQFCTKVVFTYDCLDSFHDNEPHMGGYSNNIVVDENYVISVDKNAPLEKVAPLLCAGITTYSPLKFSKVTKGTKVGVAGFGGLGSMAVKYAVAMGAEVSVFARNEHKKQDALSMGVKHFYTDPKQCKEELDFIISTIPTHYDLKDYLKLLTYNGDLALVGLPPVEVAPVLSVFDFIHLGNRKVYGSLIGGIKETQEMVDFSIKHNIYPEIDLILGKDIDTAYHNLTHGKAKFRYVIDMKKSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Mannitol dehydrogenase
publication title Unusual NADPH conformation in the crystal structure of a cinnamyl alcohol dehydrogenase from Helicobacter pylori in complex with NADP(H) and substrate docking analysis
pubmed doi rcsb
source organism Helicobacter pylori
total genus 104
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 1.1.1.195: Cinnamyl-alcohol dehydrogenase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3twoA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3twoA01
5TLSA 4ZGWA 4BNIA 2DBQA 1W0CA 4LVUA 4IZHA 3PEFA 4FFNA 1ORRA 1LDGA 3A1NA 2HK9A 4CMCA 3MWDB 1YQGA 3JV7A 4QECA 3BMQA 1QYCA 3C1TA 2VQ3A 1PJ4A 4NBUA 3PJEA 1PGPA 1OC4A 1Q0QA 3DL2A 3I52A 2PD3A 4JP2A 3S55A 4BO1A 1XLTA 1Y8RA 2PD6A 5DOZA 4R1TA 5TC4A 4OL9A 2NVUA 4LSMA 2NACA 4J4TA 4B7CA 2QRJA 2PK3A 2JKVA 3B70A 5LDGA 5HBRA 1YH3A 1ADBA 2DC1A 5IZCA 2X58A 2JJYA 1KEVA 3FNEA 1YDWA 2EV9A 1ISIA 4K28A 4OOEA 2NADA 5FFFA 4KTVE 1XQ1A 4UEKA 4XEHA 5CDUA 1BVRA 2X23A 5IDQA 1MG0A 2IXBA 1O0SA 2WE7A 4ILKA 4UVEA 5TX7A 1J49A 5KCZA 4CLHA 3VPXA 1N7HA 2DTXA 2IZ1A 4ND1A 1DC4A 1I2ZA 3GEGA 1KC1A 4LK3A 2JHFA 3G1TA 1QYWA 2X9VA 3RC7A 1JAYA 1KETA 1C0IA 1ZO8A 4J91A 2AE1A 3G0OA 4WLEA 1DC3A 4B79A 2P4HX 3CMMA 5I8ZA 1WDMA 2EG9A 1IPEA 4D3SA 4NFHA 3H8VA 1EVIA 4PRKA 4R3NA 9LDBA 1XKQA 4Z6KA 4MKRA 4E3ZA 4ZICA 2HDHA 3L6DA 4OMUA 1LDYA 2Q4EA 4IINA 4HX5A 5HM8A 4GMGA 4U0JA 1HDYA 1I3NA 1K6JA 3PHIA 1Z7EA 4XQEA 1LRJA 5G0VA 5JDIA 2P9EA 3V2GA 3DOJA 2ZQZA 3FCOA 3BYZA 1UUFA 3HQ4O 5A02A 4I5GA 3T4EA 3ZHYA 4FPXA 3BZUA 1NP3A 2CMDA 4DIFA 2WYVA 3U9LA 4DLBA 3JQ9A 5A3JA 4D42A 1FF9A 1RWBA 1H94A 3I83A 3RCBA 4BNGA 1GZ4A 1C14A 4J1SA 1OC2A 1U7TA 4XD2A 3WX0A 4A0SA 4WLFA 1BSVA 2VHWA 5TQVA 1P74A 1GV1A 3GVCA 4IGEA 1HDGO 1JVSA 2AMFA 3DZJA 3E9NA 2X8LA 3ZNQA 1PZHA 4CM9A 1HLPA 1XA0A 4JJFA 3OQ1A 3DTYA 1PJCA 4MVJM 1KY5A 3DMTA 1DEHA 4P8RA 2GLXA 1NQ5A 1DFHA 2ZJ1A 5ITWA 2FSVA 3WQQA 4OH1A 1Z75A 3G17A 4PGFA 4RQTA 2C2YA 1Y8QB 2W98A 3K2BA 2I6TA 5K9ZA 2CNBA 1PS0A 4Y8VA 1EEHA 1X14A 1ZBQA 3IKVA 3VH3A 3AY3A 5EL0A 5AXBA 3PYXA 2WWRA 1I10A 2D1YA 4ALMA 2PZLA 3V5NA 3HB5X 5KVVA 1F12A 1PJ2A 1LDBA 3NGLA 3LSYA 4JK3A 4DREA 1LDNA 2DFDA 3GZ4A 3EAGA 3GQVA 3RKRA 3S8MA 4YQZA 2IYOA 2EJVA 3TQHA 3KV3O 2HUNA 1UXHA 1HE5A 2WE8A 1U4OA 1YL6A 3QSGA 4IIUA 4TRJA 4TROA 4MP3A 2EIHA 1YWGO 5IFLA 2YHUA 1M66A 4DIBA 4B3IA 1E7RA 3KYCB 1T24A 4PLYA 3U0BA 3GAZA 4UVIA 2IXAA 2IODA 3CUKA 4LMPA 1X7DA 2FPIA 4NU5A 4BV9A 4WLUA 5EMHA 4E5PA 4PZCA 2FWMX 2VWQA 1BMDA 1I24A 2Y66A 1JWBB 5GMOA 2GSDA 4CQMB 2X1HA 3I4CA 4ZU3A 3ST7A 5IN5A 4BNHA 4E5KA 1P0CA 4D0SA 5TNXA 3WICA 3AUSA 1VI2A 1PQPA 3CSDA 4EGFA 2I3AA 5IF3A 3GY0A 5DDIP 5A5EA 1ML3A 1PU2A 2OZPA 3SXPA 4HXYA 2O3RA 3H2ZA 1T2DA 4YT2A 2NWQA 4YB8A 4UREA 1WW8A 3RKUA 2AE2A 1WDKA 2HK7A 2PV7A 1XGKA 1J6UA 1P1RA 1Y5RA 4L73A 4YJDA 5AOVA 3PYLA 1JVBA 5DP2A 1UXKA 1YGYA 4WASA 4ND4A 1DHRA 1U3TA 2FY8A 5IXYA 5IDXA 4XJTA 4O63O 1OFGA 2HJSA 3DBVO 4YVFA 4DQUA 1BXKA 3D0OA 1E6EA 3OQBA 5ILGA 4ALLA 4UEOA 3ZHZA 3GAFA 1YONA 4DA9A 2PGJA 1VLLA 1LLQA 2YQ4A 4BNYA 3PGXA 4GGOA 4B8ZA 4TVOA 4W7IA 3DBLB 3ZV4A 3H9UA 3AU8A 1LLUA 5CAEA 2BELA 3ZU3A 1P1IA 5G0SA 3WYBA 5KWEA 1Z45A 4R16A 1NYTA 4R9RA 5CPBA 1SOWA 1NASA 1X13A 3KLPX 1E77A 3AUTA 1PL8A 4W7HA 4LSWA 4RF5A 1CJCA 5GY7A 5KJFA 2GRAA 4F45A 4AL4A 1B14A 3X2FA 2DKNA 3KETA 4ZHSA 3AOEA 1UXGA 1G0OA 2JFFA 4K26A 1CYDA 1GEGA 4DGSA 3D5QA 4IM7A 1S7CA 5TT1A 1IZ9A 4CQLA 1YVEI 2BFOA 3D1LA 4MIOA 3RJ9A 4E4YA 4JJIA 4O6VA 3OF2A 1NAIA 4XGKA 3HFGA 4PLFA 1LRLA 1LA2A 3GLQA 3E03A 2D2IA 2O48X 2RH8A 2XXBA 4DPLA 1DB3A 1VSVA 4IY1A 5DBFA 1CEQA 3GNSA 3AFNA 2B83A 4D0RA 3WLEA 1OZAA 2DBVO 1PZEA 3P7MA 1SC6A 1ZEMA 1YB4A 4BO6A 2HMTA 5A9SA 1W6UA 4ZQGA 1R66A 3TL2A 2BH9A 1HF3A 5DULA 5BNIA 1VKNA 2EXXA 4MVJD 1ENOA 2B4TO 1KEUA 1QYXA 2OBYA 4PLZA 5EERA 1XHLA 3CZRA 3I6QA 2VYND 3JQFC 1IPFA 3D7LA 2J3HA 3WLFA 1V35A 3RC9A 1HTBA 1SB8A 4RJTA 1TVEA 4GAEA 2DBRA 5DBIA 4YWJA 1TT5A 1I2BA 4IMRA 5BNFA 3E5RA 3FNFA 3EC7A 5TJHA 1GQ2A 3JQCA 2OGUA 5ER9A 1DOHA 4Y6PA 3P2YA 4IS3A 4XYGA 4F6CA 1E7YA 4UVGA 1LXCA 4J43A 3ROKA 3VH4A 2ZTLA 4ALNA 1LQUA 1HL3A 4MDHA 2B5VA 4EI2A 1O95A 2XAAA 2RCYA 1NQOA 2GCGA 4WGGA 1RPNA 2CUKA 4GVXA 2P9GA 3FBTA 3GEDA 2NU8A 4QT0A 4P4LA 1RKXA 1ONNA 1DSSG 3FBGA 5T8KA 4YBZA 4WPGA 5G4KA 3GMDA 5LC1A 1I3MA 3OBBA 5A9TA 3WYCA 5JCJD 1PGJA 4E2XA 2B5WA 1LI4A 3HSKA 1KVQA 5JDCA 3LF1A 1S6YA 3MOIA 5FI5A 4EJ0A 1U8XX 4IQ8A 4OM8A 1Z73A 3ZHBA 1HKUA 1EQ2A 4DWVA 1Q7GA 1XEAA 2VRCD 2PGLA 1C1DA 1F06A 1DC5A 5K6AA 4BMVA 5DNAA 2G5CA 1M76A 1BXZA 1K2WA 4NMHA 4FJ1A 3WMXA 1P1HA 1LDMA 3F6YA 3ONEA 1ENZA 4II2A 1JN0A 1DHTA 4I5EA 2YYYA 4R69A 2ZCVA 3I4FA 1MGOA 4EJMA 2WM3A 1UDCA 4QEDA 1CWUA 4BVAA 1Y1PA 3AY7A 2ZYAA 3QRWA 4XYLA 1N92A 2A9FA 2Q1SA 4N18A 3JD3A 4QTZA 1PR9A 1PL7A 4IPTA 4OGWA 3ANLA 3SEFA 2XOXA 2P4QA 4O5OA 4OKNA 2D3TA 2OFPA 2Z5LA 4PG6A 4BNKA 2FR8A 2CZCA 4DYDA 2R00A 1UAGA 3NTOA 1IHYA 1T4BA 1Y81A 1I01A 3C7CB 2O2YA 4I8XA 3WGQA 1U5AA 4LRTB 1LU9A 1ONOA 2GO1A 4P4NA 5HTOA 1CERA 1ZMOA 2UVDA 4AICA 4FFPA 4RF4A 2YDYA 5L9AA 4KUHA 1I30A 4HADA 3UF0A 1DAOA 4L75A 4NZ9A 5T64A 2AQHA 3EK2A 4RVGA 4UUMA 3F5SA 1NPTO 1MC5A 4R4JA 3KVOA 5DCUA 1I2CA 1ISMA 1XYGA 3GRKA 3ENKA 3R6DA 3U3XA 1JWAB 3U5TA 1ZW1A 2PZJA 4IIVA 2VWGA 4B7UA 2YHIB 1CIVA 3IDSA 3Q2IA 1PJ3A 3RUAA 5TT0A 3JCZA 1H6BA 3RUCA 4C7KA 1VJ1A 3F3SA 1E7MA 3MJTA 2NSDA 5IDWA 1OMOA 5JXWA 1T4DA 1CF2O 3FHLA 3TZCA 4E5NA 3OJFA 4BHTA 1AE1A 1MX3A 3AW9A 3PLNA 2DPHA 3OECA 1ULUA 3MEQA 4MKXA 2PZKA 3PZRA 3QA9A 4XIYA 1L7DA 5KIAA 3WMWA 4IJKA 3UHAA 1QRRA 4J9UE 1I32A 2GNAA 3LF2A 1GYPA 1LLDA 1GL3A 4HFJA 4AJ2A 3FN4A 3AJRA 3ZW8A 1NWCA 1D4FA 1PS9A 2YY7A 2ZTVA 5DN9A 3VKVA 4HNHA 4BB6A 4XR9A 2CSUA 5THKA 1N2SA 3O9ZA 1DLJA 3MOGA 3W8DA 1A5ZA 4R5HA 3LT1A 4K1LA 4CPDA 1B8VA 4EDFA 2ET6A 2G0TA 3COSA 4J1NA 5A04A 4Z3KA 4Q3AA 3ZGYA 1Y8QA 3LZ6A 4I9NA 5L7YA 5FI3A 3GNTA 4DQXA 2Z95A 1YBVA 2W90A 4ID9A 3JD0A 1X1EA 1IE3A 2QYTA 3ASUA 3U4DA 5CG1A 1DXYA 1M2WA 1VJTA 3IP3A 3ZV3A 4J4HA 1PJQA 1AN9A 2AW5A 1DPGA 4UVHA 1T2AA 2IE0A 1IUKA 3RUDA 3UUWA 4CMBA 4NNJA 3IL2A 4MP6A 3VPGA 4BOYA 1ZMTA 3ZN2A 3WFJA 1ISJA 2I76A 3WWZA 3LT2A 3HN2A 5BSHA 3QHAA 4WCDA 4FFRA 1ENPA 1QLHA 3SBOA 4J16A 2QRKA 2X0IA 4X54A 1QP8A 1GR0A 3NDIA 3L4BC 5AQ1A 2V6GA 3AI1A 4FJ0A 2DVMA 3ROMA 3BA1A 4MJLA 3WGIA 2V65A 7MDHA 3ZI0A 1BW9B 1HE2A 3KYCA 5ILOA 4DXHA 2EJWA 5JAZA 3GFBA 4KQXA 4L4RA 1QXSA 4JP3A 3M1LA 2V7PA 3UCXA 4WKGA 4J4BA 2NUAA 1K6XA 2Y1DA 1DFIA 4L4XA 4CQMA 1B7GO 4HY3A 1PGQA 1U4SA 1GPDG 4AJKA 2G1UA 5F1OA 1GU7A 1GFSA 1EFKA 3KRTA 4IDBA 4BKUA 2Y1OA 2GZ3A 2WMDA 4R68A 3TOXA 2CVZA 2X5JO 3A4VA 1SZJG 2PD4A 4GKBA 1KVTA 5H82A 1YXMA 4AFNA 4CM1A 2VHXA 4FS3A 4GMFA 1LSSA 3GGGA 3L0DA 1AXGA 3RSHA 4EZBA 1CQIA 3F47A 4KUEA 3O38A 3S2GA 5C5IA 2D8AA 3ZCXA 3RFVA 3EY4A 5F1KA 2PGDA 3CIFA 3RASA 1NXQA 1BRMA 4M54A 2IZ0A 1SPXA 2PZMA 4R41A 3TJRA 4BGUA 4E2WA 1F0YA 2EERA 4I5DA 3DO5A 5T5QA 2AG5A 3VKUA 4BO7A 4YYZA 4I5FA 1U2GA 4NQZA 1ADFA 4BMNA 1PS8A 5B4TA 1KBZA 5FYDA 1A9ZA 2V6FA 3DBLA 4BNJA 1QG6A 4XJSA 2DBZA 4PZEA 1B3BA 4W82A 3GZNB 3WQSB 2BF7A 5JE8A 3NX4A 1GEEA 3QWAA 2NM0A 3ZV5A 1H6CA 4PN3A 2J3KA 4B4UA 2YFQA 3VZQA 3WSVA 2GZ1A 1C0PA 3VH2A 3M6IA 4YPOA 5A9RA 1E1NA 2VWHA 1E0DA 1C0KA 4J1QA 4OIMA 1H2BA 3O8QB 3WNVA 2VOEA 1ZK2A 1HDXA 1UP7A 2G82A 4NJMB 5G4KB 5JYEA 2FPPA 1FDTA 2PKQP 2YW9A 1N7GA 2ZB7A 4HFRA 5ENDA 5F21A 3VTZA 3NT4A 3SLKA 1PZGA 2JAPA 1XIVA 3UCFA 5L4LA 2FSSA 1U3WA 3S2EA 4QSMA 4L8VA 4L0QA 3HG7A 5HS6A 1W4ZA 2W2LD 5F5NA 2X0RA 4CLEA 4NJOA 4BO0A 2H5LA 4D79A 5FWNA 3PHJA 3P5SA 3MJEA 4J2HA 1PJSA 1LC3A 4W9NC 3TZHA 1A71A 4ALJA 4D43A 1VL6A 4G65A 4CMEC 2D59A 2JD0A 1SO8A 4GKVA 4MP8A 2E6UX 3CEAA 3GG2A 1GUZA 2C29D 1F8FA 2I99A 3Q0EA 6ADHA 4J0FA 4ESOA 3U4HA 4CM4B 3FWZA 3LC7O 3U62A 5JC1A 3PYMA 1PTJA 1LTHR 1V8BA 4GBJA 2EGHA 1PZFA 1YS4A 3GK3A 2W4QA 5F5LA 1JU9A 2Q4BA 3IP1A 3JYOA 3PJDA 3NAQA 2VNSA 1G1AA 2ZB3A 4CMJA 3F4BA 4CMAA 4MVJF 4TVBA 3ZWCA 4WLNA 3BMNB 2J3IA 5F3RA 5JC8A 2C07A 3INTA 2H1SA 2QIOA 3PTZA 4YAEA 1UH5A 3L9XA 3QVWA 2HK8A 4WCFB 4AJJA 3S1LA 3DWFA 3KHUA 4BO4A 4FFLA 1FDVA 2I3GA 2R6JA 1WZIA 3HZZA 4R5MA 1JDJA 3DEYX 3W6ZA 4O59O 1AUPA 1FDUA 1ZKMA 4DC1A 3FRJA 4CLDA 2F1KA 1OAAA 1WDLA 3GDFA 3OHSX 3S2IA 2GR9A 2NNLD 2WDZA 4I1IA 2AA3A 4RLSA 3AFMA 4DBZA 5BSGA 4I08A 1RM4A 3MJCA 2E48A 2PTGA 2FOIA 3FNGA 1C3VA 3G1UA 4BMSA 2VRBA 4EW6A 3ZNNA 2CVOA 3GPIA 1XG5A 3PDUA 5U1PA 3EZYA 4A5OA 2E49A 3GDGA 3ONDA 4XQCA 4HUJA 3L6OO 3LLVA 5BNTA 3DOOA 1SCUA 4RZIA 2DUWA 4BO8A 2LDXA 4GL4A 2X5KO 4DUPA 2IEBA 2JCYA 1EE9A 1YBAA 3ENNA 4MVJG 1KVSA 1JA9A 5C7IO 3DQPA 1FMCA 3U4CA 2ZB4A 4NU6A 1DIAA 2UUOA 4YACA 5K0ZA 2AQIA 3TDKA 3ETEA 1YOVB 1Q7BA 3PDJA 3HADA 3K31A 3CTMA 3HDQA 4M87A 1PQUA 3L07A 3ETGA 4I9HA 3ANMA 4IGFA 2DUUA 2RH4A 4DL9A 4P22A 2E37A 4XDZA 4CR8A 2VT3A 1ZXLA 3H6KA 4BV8A 4RF3A 3N74A 1HRDA 2I9PA 3DONA 4GQAA 9LDTA 1WZEA 3OJOA 3D64A 3DMYA 3G49A 1DC6A 1YO6A 3W1VA 4QUKA 5GZ6A 2GZ2A 4OAQA 2QQ5A 4FGWA 4DPKA 2NQ8A 3VAZA 2HO5A 3Q9UA 4CM8B 1E3EA 1JKJA 1Z6ZA 1Z82A 3PIDA 2EW8A 4PG8A 4C7JA 1VKOA 3O4RA 1XCBA 1GPJA 5COAA 4PZDA 4WK6A 3QJ5A 2HAEA 2YHIA 1CRWG 3KYBA 2ZTMA 1JAXA 2I5PO 8ADHA 2P2SA 4EEXA 3UVEA 5DZSA 4GLOA 2Q49A 5I7EA 3DOCA 3C3XA 3ZWAA 3GR6A 3ABIA 2P68A 2E82A 5JCJA 5DP1A 3CZMA 1MA0A 2Y67A 4DMLA 2Y68A 3F46A 3DZBA 1ZZEA 3SJUA 2A92A 2Q2WA 3H5AA 4Q3DA 2ZB8A 3SLGA 2CVQA 3HB4X 5CP8A 3OIDA 1VJ0A 2X7HA 2GASA 4BKPA 3V1TC 3ZWPA 3AWDA 2BMAA 1EUZA 4KWIA 4ZJUA 3R3JA 1R6DA 3D3WA 2BFAA 4AJHA 2C20A 3KSUA 1E3LA 5AVOA 5L7TA 3GEMA 4N5MA 2GN4A 4Z9YA 3L77A 1U9JA 2BGLA 1EE2A 1V0JA 2X0JA 3LT4A 3OETA 4RL6A 3VDRA 5ES3A 4INAA 3AM5A 3I5MA 4M1QA 4N7RA 1NR1A 2VYVD 1WMAA 5JFOA 6LDHA 4Z0TA 2X4GA 2OUIA 3RROA 1NFFA 3LYLA 3GH3A 1C1XB 2WD7B 4D7AA 2ZIZA 4N54A 4E32A 2OO5A 3PWZA 1Q1NA 4A7PA 1DO8A 4LVCA 1NPYA 5IN4A 2V6MA 1GYQA 2E4AA 1YBMA 1VE9A 2QW8A 1Y9AA 3PWKA 4DC0A 3QY9A 3ULKA 1ZXBA 2HKIA 3HJAA 2FN7A 1SBYA 1ADCA 4Q3BA 5IZCC 2NU6A 1AGNA 3BTUA 5COBA 1HXHA 2C7GA 3DXFA 3JQ8B 3OSUA 1R12A 3TRIA 1I3LA 5EN4A 3BTVA 1RM3A 1EVJA 1VC2A 3EMKA 4JBGA 3TF5A 2UV8A 1GTMA 3TN7A 4CM7A 5EJ2A 2HCTA 2OOSA 1HSOA 2Y0CA 2PH5A 1T2FA 3C1AA 5FEUA 1P3DA 2HMVA 2NU7A 1NQTA 1HDCA 5KJEA 3H9EO 2UUPA 5L53A 3FR8A 3QV1A 1P9LA 4NHEA 1PGNA 3BMCB 5TSDA 4DPMA 2EF1A 3HE3A 4UEJA 1D1SA 1TI7A 2W2KB 3JQAD 3NT5A 1BW9A 3WWYA 1F8GA 5HA5A 5GZ3A 4NG5A 4GX2A 4TZKA 2JHGA 3E18A 4W6ZA 4RVUA 4PG7A 3GGPA 2O7SA 2O2SA 3FD8A 4MO2A 5JDIC 1ULSA 4JNKA 4QXMA 1E6WA 2A94A 3ROQA 1A4UA 4BNZA 4IDEA 1E3IA 2EEZA 2D0IA 3FI9A 3RUEA 1DBVO 1U3UA 4Z0PA 2HRZA 3VDQA 5MGBA 3WBBA 4IDDA 5IZ4A 4NI5A 4A27A 4ALKA 1J0XO 4AJNA 1EK6A 4BNMA 5EIOA 1QSGA 2Q50A 1PL6A 1HT0A 3BTOA 3GUCA 3JQ9C 1HE3A 1ZSNA 4B3HA 5HWSA 2H63A 2HJRA 1EK5A 3JD2A 4L9RA 1OBFO 2EW2A 3F1LA 5COQA 1ZH8A 3WGHA 4E2ZA 4L76A 4YAGA 4XRGA 2WEKA 3H2SA 3QVTA 3QQPA 4RDIA 2FR0A 4J90A 4XGNA 2AG8A 2Y1GA 2X22A 3WGZA 2IZZA 3DMTC 4Q39A 4Z0HO 1N5DA 1A72A 4EEZA 2D5AA 4GPD1 4BS9A 3I3OA 4U8GA 2ZJ0A 3NV9A 5C7OO 1A9YA 1OOEA 3H9GA 3I9OA 3OJ0A 4II3A 4B4OA 3I9NA 1I3KA 4J1TA 2O3SA 2VTDA 2JCVA 3GZNA 3BHMA 4B7XA 4CUJA 4RPHA 4D3DA 5G0WA 5CEEA 5JMWA 3WTBA 1ZCJA 1ZK3A 2B4RO 5JCXA 1U8FO 1E92A 2IDZA 2YV2A 3ZWWA 3DZGA 1W8DA 4U5QA 3QP9A 1NTOA 3LC1O 4CV0A 4YT4A 4Y6SA 1R16A 3CH6A 2YZ7A 3H4VA 4PLCA 4R9SA 1N1GA 3W8EA 1EQUA 3O8QA 3W8FA 4NJMA 4E21A 2RHCA 1Q7CA 2EWMA 3DZKA 1P31A 5A1TA 1KVUA 1PEDA 1DRUA 4R3WA 4HKTA 4N5LA 2O3JA 4M8SA 4IQGA 3WQRA 3G79A 4XZ3A 4H15A 4FQ8A 3WOHA 1TEHA 4CM6A 3IAHA 1UDBA 3QE3A 4EUHA 2NU9A 4DIOA 1AHHA 3BMOB 4CMKA 2CFCA 2QYSA 4RPLA 4EBFA 2GN9A 3KB6A 4XYMA 1UDAA 1E7QA 5K1SA 3ORFA 1I8TA 3T4XA 1MG5A 2YV3A 1KY4A 4WOKA 4BNXA 1GZ3A 1B15A 5KJ1A 4ITUA 5IDYA 4H16A 1PJBA 1LLCA 4G2NA 4EITA 4OYRA 5KNLA 4I9UA 3CPSA 3GNQA 4TKLA 4CM4A 4TRMA 3CKYA 1WP4A 1UXIA 4NBWA 5BR7A 5KJCA 1SAYA 3X2EA 3DBRB 3DHEA 5JY6A 4OOFA 3FF4A 4E12A 4LMRA 3GUYA 4AJPA 1WWKA 1J4AA 3GDOA 3INGA 3PWSA 3OQ6A 2F00A 3PFWO 4FR5A 4A03A 2FPGA 4OXKA 3OFSA 4JJGA 1N8KA 3RFXA 5IXSA 2CDBA 1R0SA 1O94A 1UP4A 4YQYA 3H3FA 5L51A 3CMCO 2PWZA 4HBGA 3WGOA 3BMNA 3DTTA 3WIDA 4QO8A 5A5FA 1R0LA 4MIEA 4WCFA 3WTCA 1PIWA 3D4NA 5FF9A 3IIEA 1ID1A 1MXFA 1Z74A 1E3JA 4P4GA 5KVCA 1U2DA 3EHEA 3SJ7A 4DQVA 2NTJA 4K6CA 4IJUA 4WEOA 1Y9EA 3GOHA 4YJFB 4U6SA 5LCXA 5THQA 2Q3EA 8LDHA 2VZ0A 1ARZA 1YL7A 2VUUA 3AOEC 4NIMA 2DTDA 3JYNA 3KTDA 4H3VA 3JYLA 2CF6A 2ZK7A 3DFZA 1YKFA 4UUPA 1GY8A 4TWRA 1HWYA 1R4NB 1VRWA 1X0XA 3A14A 3PJGA 4MINA 1TLTA 4KDFA 4LRSB 4Y67A 4PLVA 1BGVA 1P33A 3BHIA 5L95A 2QG4A 2V6BA 3P19A 1XR3A 1AXEA 3KSDO 2ZYDA 4CLRB 1GQQA 3M2TA 4RV9A 5TJ9A 4ALIA 4DTIA 1YOVA 4OQZA 3QLJA 1R37A 1LX6A 3FNHA 4MVJH 3UXYA 3V8BA 3D3WB 4HFNA 2YV1A 2AEMA 5MDHA 4NDNE 3STHA 2VCYA 5JBIA 3NUGA 4IDFA 7ADHA 4EUFA 2TMDA 4CMGA 1DIGA 3LC2O 4ZRMA 4NR0A 1PQWA 5AXAA 4AJOA 1T1RA 3NKLA 5AYVA 2B69A 2BGKA 1X0VA 5ITVA 4BNUA 3JQBA 1ZNQO 2JAHA 4RPJA 4Y98A 4YT5A 5KOIA 4YTEA 2JD1A 4BNTA 4GGPA 1LQTA 4TZTA 2VHYA 5U4QA 5BQFA 3AOGA 3IJRA 4TRRA 1K0UA 1F14A 3R3SA 2PA3A 3P2OA 1GDHA 1BVUA 3MTGA 5DCWA 3W4IA 2Y99A 4JCOA 4PG4A 2XF8A 4BO3A 2B36A 4L74A 1WMBA 5IAAA 4JROA 3OA2A 3PLRA 3M2PA 4CM8A 1HE4A 5I7FA 1G6KA 4XQ9A 4FDAA 4TQGA 1V3VA 3C1OA 3G3EA 4RZHA 1F17A 1HDZA 1MB4A 4J3FA 5TF4A 1GD1O 3I9JA 4RF2A 4TMFA 1B3RA 5T8KC 3A28A 4RVHA 2J5QA 2Y1EA 4OSOA 1HYHA 3RC1A 4JBIA 5JDCC 5CDSA 3A06A 3DHNA 3AY6A 1NM5A 2NVBA 4R1SA 2Q45A 3ICPA 3FTPA 4E5YA 2AEFA 2ZYGA 3ZU4A 1JW9B 5JO9A 1ZSYA 4FB5A 3Q3CA 5ADHA 1LEHA 4MKZA 3OIFA 5K6AC 4ZQHA 4LCJA 4AJ4A 2EGGA 3NDRA 4OQYA 4QO7A 4Z9XA 4D45A 3AU9A 3BAZA 2BFMA 1CDOA 1PX0A 3UW3A 3K5PA 4ZVVA 3K92A 1D3AA 4CM5A 3Q9NA 1WVGA 4U7WA 3TWOA 1E3SA 1M6HA 2JFGA 1O5IA 4K9DA 4PFJA 5EQDA 2P91A 3D4PA 3W4JA 2BLLA 3JQ6A 3IJPA 4EYEA 5JO0A 4JLWA 4LW8A 2SCUA 4IBOA 1W73A 2R00C 3RBXA 3TOZA 1C1XA 2WD7A 3AUAA 3ZWOA 2QX7A 1BTOA 4AJLA 2A4KA 4B4VA 1PJLA 3RU7A 1O8CA 4CV1A 4FOOA 1YJQA 4XYEA 3EZLA 2OXIA 4CUKA 1LRKA 2W8ZA 4KMSA 1NWHA 1I5RA 3MJ4A 3JQ7B 3I9KA 1LDEA 1ISFA 1BG6A 3K96A 4CV2A 3PP8A 3JQ8A 3AI2A 2HQ1A 3L9WA 2Z1MA 2RBEA 3T7CA 1PSDA 1NHWA 3ZWNA 3VOSA 3Q6IA 3KOUA 2GDZA 4KZPA 3RD5A 3PXXA 4CJXA 5B1YA 3ETDA 4NFSA 4DVJA 4HV4A 2BI7A 4RQUA 3VH1A 1C0LA 3GN1A 4WLOA 1JKFA 3RI3A 1QKIA 1QLJA 2FHSA 2NQTA 4HP8A 3BMCA 1ZK4A 1MV8A 3ZW9A 5L45A 4R01A 2W2KA 3UFXA 1HSZA 1PWZA 4A10A 4BKQA 3TFOA 1QORA 1ZUD1 4HWKA 4CR6A 5G4LA 1EVYA 3DBHB 4BB5A 5JAMA 1TXGA 4XA8A 4LN1A 4YDRA 1YB5A 4AVYA 2PH3A 1KEWA 2YDXA 1KS9A 4BKOA 2QHXA 1K5HA 5JSFA 1UP6A 2HMWA 3CE6A 2FZWA 1I36A 3NJ4A 5J23A 1P0FA 2PR2A 4FFOA 3F1KA 3KYDB 4E30A 5B37A 1TB4A 2B0JA 4J2OA 2DU8A 4N5NA 3QWBA 1YL5A 5DT9A 3UGKA 5TIIA 1UXJA 3V1UA 1BHSA 2OHXA 4Q3EA 2XXJA 4DYVA 3EW7A 3KM0A 1B2LA 3UICA 2VHVA 4FC6A 2B4QA 3ZWYA 5L7WA 1R4MB 1KYQA 1LSOA 3LQFA 4RDHA 4XKJA 1ZFNA 3LDHA 4WOJA 3VTFA 1B0AA 3WIEA 4NBVA 4GSLA 1FXSA 1MP0A 2UAGA 3B1FA 2TMGA 3WSWA 4E0BA 1L7EA 4E5MA 2GD1O 1WLYA 1ZSVA 3OJLA 3MJVA 1K6IA 1P1FA 1Z7BA 3AUUA 5I9MA 1IZ0A 4YCAA 1EMDA 4M49A 4K6FA 3H9JA 1P45A 3HUDA 3A9WA 1ZEJA 5JYDA 3ON5A 4ZD6A 1PWXA 2VUTA 2JL1A 4R54A 4RVFA 4RORA 4G81A 4GSKA 4YRAA 2DT5A 4GLLA 4XYBA 4YRDA 5JAQA 1XU9A 3RUIA 1H6AA 3W6UA 4IMPA 1VSUA 3PZBA 2LDBA 2Q1TA 2GPTA 5CHEA 1DRVA 2HMUA 2VUSA 5DCYA 1V9LA 3I1JA 4J0EA 1YQDA 2H6EA 3B1JA 3RWBA 1TT7A 3PPIA 3GFGA 2I67A 4NH4A 4ZRNA 1YJ8A 3E5MA 1WNTA 3RUHA 4CMIB 5CFZA 2AQKA 4XWYA 3JQAA 3TZQA 1A27A 3DZHA 3V2UA 3BMOA 4GVLA 3E9QA 4DRYA 1QYDA 4CM3A 2Y1FA 1XSEA 1JTVA 1V3UA 1O9BA 4OJNA 4Q9NA 5CDTA 3GGOA 3S2FA 2YJZA 3LK7A 5ICSA 3LLSA 1NX6A 1SEVA 5GZ1A 2GERA 4BQPA 3DHYA 3F9IA 3LVFO 5KTKA 1QYVA 2AQ8A 3HN7A 5BSFA 3KZVA 4B4WA 3E48A 2X86A 3H3JA 3TZKA 4A2CA 1E1KA 4XQGA 3JQEA 3K6JA 3QW2A 4CMHA 5C37A 2OMEA 3I9MA 3FWNA 1CETA 3ASVA 4YJHB 5B4UA 1U1IA 2A35A 1FDWA 1JQBA 3DAPA 3DBRA 1DJQA 5TRTA 3V2HA 3IMFA 3PK0A 4IDCA 3FR7A 4CQMD 3O26A 3IUPA 5JMPA 1HLDA 5BSEA 1UZMA 1FDSA 2C7VA 4IZIA 5KVQA 3TNLA 4PLWA 4MVJA 3VZRA 4BO5A 3WBFA 1LUAA 3CXRA 3FTNA 1XELA 4CR7A 2VYNA 2ZKLA 4W99A 3AI3A 3KEQA 1WAMA 3C7DB 1V3TA 3IQDB 3IS3A 3BIOA 3PRJA 2RIRA 1E1LA 3K8ZA 3EVNA 2X0NA 3PQDA 5I7SA 3ZV6A 4XB1A 3JD4A 1FJHA 4B3JA 3DFUA 3RUFA 3QWIA 3IUSA 1EUDA 3UOGA 4HFMA 1XU7A 4TRNA 4WNCA 2BFPA 3JQFA 4YJFA 3PQFA 3ZZNA 1IY8A 2IRWA 2X9GA 4D3FA 2Q2QA 3RVDA 3U09A 2QZ9A 1R4NA 1IB6A 1KVRA 2I65A 3N58A 4FJ2A 3JD1A 1QV6A 2Q2VA 5A05A 1H2HA 4J7XA 2O4CA 1GV0A 1Q0LA 3VVBA 3TL3A 3DZFA 1U28A 3HFSA 1BXGB 2P9CA 5U9CA 1MXHA 1N1EA 4XCVA 3HNPA 5F1PA 1NPDA 3WGTA 4D46A 5A06A 5C7LO 2ZTUA 2EKPA 2VRCA 1LSUA 4O1MA 4CLRA 1ZVMA 1VPDA 4LCEA 3B6ZA 4ND3A 4E13A 3GRPA 5CG2A 2C0CA 2GUGA 2PFGA 1O6ZA 2YFHA 1KC3A 2I66A 4MIYA 4UUOA 1RM5A 3MTJA 3TFQA 4PVDA 5HRUA 3GHYA 4QFDA 4XRRA 4YEDA 5TGDA 1DJNA 3ZWMA 1GADO 1I0ZA 2Q99A 2Y0DA 3TPCA 2B35A 3ANNA 4XIJA 4ZN6A 1MFZA 1E7WA 2OP0A 3NJ8A 4KUGA 3U49A 3O03A 1Q2XA 3TSCA 1M67A 1EFLA 3ADPA 2IEDA 3IOYA 4UVDA 2Q1WA 3I9LA 5I9LA 4NPCA 3JQDA 1P1KA 1B8PA 2C5AA 2CF5A 3FPCA 4FGSA 4KP7A 3LU1A 1VL8A 4MPDA 4FBGA 4M89A 4ROSA 1HYGA 3H9QA 1NNUA 2VTEA 1RYDA 1NBOA 4JIGA 3PHGA 5DF1A 2D5CA 2PKRA 1LSJA 1Y7TA 4IQ0A 3KUXA 4J7CA 5ENVA 3NTRA 4CLOB 2QRLA 2NTVA 2X5OA 3AK4A 2P5YA 4WLVA 5KKAA 2FMUA 4J49A 2CY0A 2IYPA 4DLLA 1H9BA 3TZ6A 1VL0A 2GN6A 1E5QA 2FRDA 1B16A 4NBTA 4FIZA 1A4IA 4CUZA 4E2YA 3MJSA 2Q46A 3GT0A 3W4KA 4NK5A 3EDMA 4OO3A 2X6TA 1DRWA 4BIIA 4YJGA 4BO9A 3JSAA 1MFPA 4GI2A 3Q1LA 3C8MA 2ZQYA 2D4AA 3H7AA 4BL5A 4RVSA 2OP1A 3UN1A 4S3MA 2Q1UA 4PRLA 1BDBA 2GYYA 3RBZA 1SMKA 1H9AA 2YQ5A 4Z9FA 1HDRA 4J6FA 3NTQA 2FR1A 1N9GB 3K2EA 2DQ4A 3WGGA 4UUNA 1OI7A 3ZNOA 2VWPA 1IYZA 1RYEA 2J6IA 5TS3A 4F6LA 1HDOA 3GVHA 4YAIA 2Y05A 2EHDA 2J5KA 4RPGA 3MCVA 4PLGA 2DLDA 3IC5A 3K9QO 2P5UA 3VZPA 1KEPA 1E6UA 3L4SO 5G0TA 4XR4A 2J5RA 3WG9A 3UH1A 4J9VA 3RIHA 2ZCUA 4CL8A 5T67A 3PHHA 4OSPA 2BI8A 4NK4A 2VT2A 3JQGB 3JQ7A 3NRCA 4RO0A 2JD2A 1BDMA 4FSHA 1E3WB 5AXDA 5H83A 1V6AA 3OMLA 3BXXA 1GZ6A 4GH5A 4ND2A 4Z3DA 4CL3A 5JNLA 1K89A 5AXCA 1NVTA 2FZEA 4IUYA 1R15A 1EBFA 1VM6A 4BNLA 1E7SA 4LISA 4BGVA 2VHZA 3GMSA 4GX5A 4BGIA 4CM9D 4PLTA 3DZIA 3Q2KA 1ZJZA 1ZIDA 4E33A 3OP4A 1JKIA 1XQ6A 4JX8A 4JQCA 1DIBA 2GN8A 3BMQB 1YE3A 2DM6A 4WEQA 1PJTA 4YR9A 5T57A 3GVXA 3NT2A 4U0KA 4EJ6A 1Q0HA 2C2XA 1DLIA 3WJ7A 1GAEO 4XB2A 1Y8RB 4Q3CA 3OEYA 2H9IA 2NVUB 2WSBA 2GF2A 4D44A 1ADGA 5IJZA 2BRUA 3DBHA 4ZQFA 2C59A 3QVXA 3K30A 3F4LA 4W4TA 2C54A 1QV7A 3E8XA 3QWFA 3ZWVA 2OL4A 2EP5A 2UYYA 2AEJA 4ND5A 3JYPA 5A3VA 4QX6A 1U7HA 3JQAB 1PGOA 4FW8A 4U6QA 1E1MA 3INRA 1EDOA 1YB1A 2Y1CA 5L4SA 2C5EA 2CDAA 3KYDA 1NFQA 3R1IA 2WYWA 3UKOA 4YXFA 5CEJA 3WFIA 3PIIA 3WNQA 3QVSA 3WJAA 1XWFA 3ADOA 1LNQA 4JBHA 4R51A 4UAGA 1UZNA 3AM3A 3E1KA 4FD3A 3T7EA 1D8AA 1M6WA 3L4BA 4YAJA 3H5NA 2VNAA 5CDGA 1EBUA 1ISHA 3AM4A 1R4MA 4BUCA 3V1YA 1X7HA 1RJWA 2O4UX 1SNYA 4WE3A 5I7VA 2R2GA 1T2CA 3KO8A 4IS2A 1GUFA 2G76A 1HETA 4NFYA 3WB9A 2NTNA 3NEPX 4AG3A 3DR3A 3ZWBA 3ZHXA 4B8WA 3SC6A 4BNWA 5JW6A 5C3MA 1DDOA 5LDHA 3WYEA 2DAPA 2PY6A 1G0NA 4AJ1A 3HWRA 2ILTA 5JPIA 4Q3NA 2BKAA 1SB9A 2QZZA 3DAFA 1SEPA 3WR5A 4OXNA 3U4IA 2Z1NA 1H6DA 4BO2A 2UDPA 2AHRA 2POQX 1ISGA 3K73O 3DB2A 1DIRA 3OICA 3GN2A 4KWHA 3OH8A 1H93A 3SVTA 1WXDA 3JYQA 3D3EA 4WJZA 1KOLA 3WDSA 3E82A 1T25A 5CEFA 3SC4A 4BKRA 4KTTE 4P38A 4OKIA 4CMIA 3UCEA 3PJFA 4H7PA 3QWHA 1CQJA 1P77A 1RM0A 3GVIA 4S1VA 1U5CA 1IOLA 1BWSA 4XGIA 5EESA 3RAJA 5L40A 4OXYA 4DBVO 4FC7A 4R1NA 3QIVA 1TA4A 1UAYA 3FPLA 3EVTA 5H81A 4CLXA 4BNFA 1X7GA 4L4SA 3I6IA 1K3TA 2X9NA 4BNNA 4GWKA 1I33A 2W2LA 1UR5A 4PG5A 3E9MA 3ZWXA 2O50A 4AJIA 3ZU2A 5ICMA 2J8ZA 4YAKA 4Y6RA 3RQSA 2BD0A 2DFVA 4FCCA 3VC7A 3VPHA 4YJHA 4IXTA 4PCVA 1GQYA 1R0KA 3LT0A 2PLAA 5BT9A 4E6PA 3UAGA 1GCUA 1LC0A 1UZLA 1ZK0A 3ITKA 3D5TA 4R1UA 1T26A 3PFFA 1NHGA 1QR6A 2O3UA 4C4OA 5EPOA 3ZU5A 2EKLA 3M1AA 1NFRA 4FFMA 3OIGA 2PNFA 1L1FA 4WECA 5L4NA 1IULA 4KDEA 4GX0A 2O7QA 4W9NA 3E6AA 1KIFA 3HDYA 1NQAO 3RJ5A 3C85A 3GC6A 1ONPA 1J5PA 3MZ0A 4JN6B 4CMEA 1JLLA 4UULA 3ICCA 2AXQA 4PVCA 4D41A 1ZJYA 2YUTA 5DBGA 4FN4A 1HZZA 4TKMA 3VHRA 1MUUA 4G5HA 1AHIA 3B1KA 3KSZO 4MVJP 3RC2A 2Y93A 3ZDFA 4MOWA 3DC2A 3KLMX 3VVCA 3NGXA 2NVWA 2XPCA 1T1SA 4MVJI 4RLHA 1NAHA 2ZATA 3R0IA 1P44A 2PKQO 1NVGA 4GX1A 1D1TA 1NVMB 3GG9A 1EUCA 3N7UA 4KOAA 2B37A 4HNGA 4PLHA 1FK8A 1O89A 3HDJA 2WTBA 3KBOA 1BXGA 1SOVA 1X15A 1H5QA 2BGMA 4YJGB 3H5RA 1Y5MA 4Y9DA 4DMMA 1LBEA 2G17A 3H65A 5CPFA 3DDNA 3HDHA 4IDAA 2DPGA 3PVZA 4O0LA 1A7AA 1QMGA 1LJ8A 5I9NA 4YA6A 5L3ZA 3RBVA 1NR7A 4NBRA 4A26A 3EYWA 4WNIA 3Q11A 4OHUA 4BNVA 1P1JA 3GPDG 1GCOA 5A4DA 5G0UA 4ZA2A 5KKCA 2HLPA 1XDWA 2J3JA 3IKTA 4BQRA 3MWEB 3WGYA 2C82A 4LGVA 5JY1A 1MLDA 1H0KA 2HRBA 2EKQA 3WS7A 1DIHA 4RVDA 1PR3A 2O23A 1A7KA 4M86A 3DAGA 2HMSA 3OM9A 2CDCA 3OJEA 3ZNPA 1IHXA 4YT8A 5HS4A 1Y6JA 2RAFA 4IJWA 4CQLB 2FP4A 3HHPA 2Y0EA 1X1TA 3L6EA 5IG2A 2WD8A 4EUEA 3GVPA 3CINA 1E5LA 3GF4A 1ENYA 1B8UA 4PLPA 5B12A 1HEUA 1T2EA 2GGSA 4RPKA 4AJEA 3F5QA 4WCFC 3NYWA 3KXDA 4A73A 3JTMA 3EUWA 2VZ9A 5A9SB 3PQEA 4GWGA 5KJ6A 4XX0A 3RFTA 5JS6A 3ONFA 4M55A 1WPQA 3VPFA 1U3VA 4CLOA 5DOVA 2OORA 4BGEA 4QFCA 1GYRA 2JCXA 3KEOA 3QVOA 4JGBA 2WJPA 2HSDA 2EP7A 4J7UA 3EGOA 2VZ8A 1DAPA 5ER6A 1TT5B 3VPSA 5A03A 3RU9A 4RGBA 3ITDA 1DFGA 1UJMA 3ZH2A 4XDYA 1EDZA 2HU2A 3OA0A 4IDGA 4URFA 3NDJA 3PGJA 3GA0A 4JXKA 3D4OA 4RCVA 1YQXA 1GUYA 4PIVA 3PHLA 4F3YA 1D7OA 3BTSA 1ZK1A 2JFHA 4E31A 2O3QA 5EQFA 5B4VA 1N9GA 3I23A 2BHLA 4CODB 2CD9A 2OBNA 4FOSA 5I8WA 3GHHA 4IXWA 3ROPA 3SX2A 2RHRA 1HYEA 2O3TA 2WYUA 3PI7A 1M75A 3C7AA 3BHJA 5CDYA 5G2OA 1IL0A 4F46A 4MVJE 4DLAA 3C24A 5KVSA 5JLAA 1B26A 4CV3A 1EVZA 3B20A 4YRBA 3JQBC 1C1DB 1KERA 2VOJA 3OEWA 4KQWA 2NLOA 3JQGA 3VZSA 2VYVA 2VN8A 3FSRA 4ZQEA 1YDEA 4ONEA 4IJVA 1YRLA 4QQRA 4ZQBA 2DTEA 4WUVA 3WXBA 1E3WA 1EZ4A 5T6BA 2NV6A 5JAIA 5EINA 1MC4A 4TSKA 1HZJA
chains in the Genus database with same CATH superfamily
5T7BA 1KJ9A 5TLSA 4I5IA 3KOXA 4PPQA 1QANA 2FCRA 1V39A 3ABRB 3GJ3A 1W0CA 1CZOA 4LVUA 4BNIA 4G5YA 1ZG3A 1N2IA 1Q7RA 4KRXA 4B3DA 5EXXA 3TM5A 1ORRA 3HP1A 1J56A 3FOFC 3U4MA 3GA7A 4DSAA 4Y1GA 5ED4A 4BP9A 1QYCA 2FWNA 4KDRA 4AKEA 4PTZA 2F1RA 3CCFA 2C7BA 2O1XA 4RKQA 1OFVA 2PYZA 1M6YA 2FU5C 1TAQA 3BJRA 5BV1A 2ARKA 2HADA 4LSMA 1FYFA 2OV8A 2WZDA 4R9VA 2H16A 2QRJA 2XODA 1EXNA 2HM7A 2UZ0A 3QENA 1LK0A 1PZNA 2PGXA 4W5QA 3B70A 3FMVA 4G5QA 2MSWA 1U1DA 4UC0A 3L5OA 3R7WB 3SZOA 5DWQA 5EJAA 5IZCA 4Q7EA 1LQ2A 4PZLA 4UHDA 4CDNA 4OOEA 4R8RA 1IBLB 2P1DA 4NMMA 3IAXA 4UEKA 1RQGA 1XDUA 2CC2A 4ZV4A 2X23A 4HZUB 2X0EA 4G0WA 3WE7A 1CQPA 1HEIA 5TMDA 3RVSA 3IQXA 4HEA1 4UVEA 5TX7A 4CLHA 2GBPA 1N7HA 3TXAA 1WCXA 3OOWA 4ND1A 1DC4A 3STUA 3LCCA 3D3QA 4LXIA 4LFAB 1KOJA 4LK3A 2IY7A 2JHFA 4MQ5A 5IYZB 4CGYA 4ZAFA 3GLHE 3W1WA 4RVCA 2C9OA 2OSVA 1KYIA 2V98A 2JHCA 2P4HX 1IN4A 2WP8J 1U31A 3CMMA 1DQPA 2GAAA 2PGIA 1JHRA 4UNPA 3UTCA 3VI3B 2V3CC 2ZBFA 3AG6A 4NFHA 5DTEA 3FTFA 4PRKA 1J9ZA 1K4YA 5FNZA 4Q19A 2OFXA 4HN9A 4C14A 1QRUA 1OGJA 2G83A 2HDHA 4BX0A 1LDYA 4KGVA 4UBJA 2YVAA 3LQ4A 3D3JA 3IDFA 3HR8A 4LBYA 2IS1A 1S3FA 3AMVA 3VU3A 4U0JA 4UBIA 5KPJA 1I3NA 1RAIA 3EE6A 4UTNA 3R40A 4I19A 2F43A 1FOEB 1JG3A 1OF1A 1P1BA 2WP0A 4OGLA 5JDIA 1VRCA 2P27A 2P9EA 3EW9A 4FK8A 3V2GA 1M7GA 2V7QD 4B0OA 2Q9BA 1WLSA 5B7PA 4M4SA 1RXVA 1GPKA 1C9EA 1UUFA 2HQRA 1TJNA 3HQ4O 3TW8A 1JPNA 4M0UA 5ALIA 4MI1A 5C5CA 3M6WA 4HAXA 1MO3A 4KQHA 5A3QA 1GUBA 3GMTA 1NP3A 4I2NA 4DIFA 1P6XA 4QTTB 1KU0A 1O1YA 4PW0A 2WJ6A 3U9LA 3JQ9A 3V3KA 2CDNA 2XT9A 3I83A 3CLRC 1DTEA 1CZNA 2LP4Y 3MM4A 4PQFA 5E2IA 2R1UA 4GNRA 3UJ7A 1C14A 3ACCA 4FBMA 2JZNA 2PT6A 4HX9A 3WX0A 4A0SA 4TLLB 5TQVA 4CIDA 1FSPA 3HRIA 5FTKA 2VAWA 1HDGO 2QN3A 2CSXA 4IG9A 1Z0KA 2X8LA 4EJSB 2XCUA 1TDJA 2WV7A 2O2JA 3WLHA 5ALMA 1VYHA 2OXFA 4TL6A 3DNFA 1DEHA 4P8RA 3L49A 5L3RA 4ZVLA 5FPTA 4EY7A 2GLXA 5I7HA 4DR2B 1ZW6A 3AFOA 2F8TA 2ZXUA 3FVVA 4YDQA 1Z75A 1WQ4A 4PGFA 2H51A 2DWOA 1Y8QB 4ZT5A 2CNBA 1V1RB 4Y8VA 3EVGA 3NIFB 1Y8ZA 3P2JA 1GRCA 2D1YA 4ZVNA 4ALMA 4Q16A 2ZAOA 3FHOA 3FIJA 3V5NA 4RE5A 3Q8KA 2LR0A 4AKSA 4URYR 4JC5A 5KTTA 4N0MA 2R62A 1XXHB 4DABA 2RE8A 4JT4A 4G86A 2NT4A 3GZ4A 3F3YA 3RKRA 1KMHA 2C2GA 4FE3A 4YQZA 2ZM5A 2IYOA 1M2FA 4JS0A 2YMPA 4IV0A 4PCUA 4Q7LA 1JR4A 5K3OA 2ZZKA 3TQHA 3DM5A 4DDKA 1N78A 2REQA 4BNDA 4K9RA 4QKQA 3G5AA 4IXDA 1NN3A 1ZD9A 2HUNA 3GJTA 3PQ4A 4LV6A 2ZXEA 1FE8A 4BCDA 2FB9A 1DJMA 1WIWA 4RA6B 3S8YA 1K8QA 3QSGA 1R88A 4IKEA 4TRJA 2IBTA 2V97A 2VXYA 4Z1OA 2GESA 4DIBA 4EP1A 1E7RA 1T24A 1VQ1A 2E4ZA 2EIXA 3AHGA 5JH7B 3KKOA 5D3QA 1UOOA 3UFBA 3MS4A 3W5CA 5D1NA 4EO4A 1MN6A 3AERB 1ZCBA 3PL1A 1R9MA 3B9PA 3JVEA 2DFTA 3KTOA 3OQMA 2QGZA 3IIJA 2NXJA 2Y66A 5GMOA 4EYSA 4U7JA 2CNOA 3HKCB 2C7QA 3ST7A 1DX9A 4EG1A 4ZU1X 3THXA 4L5CA 4QFMA 4E5KA 4D0SA 4C7OB 3IPAA 1PQPA 3CSDA 1NW5A 4KQ2A 3T7TA 4HPXB 4LNAA 2HQOA 5IF3A 3GY0A 2RHWA 5DDIP 5A5EA 4OLJA 4DLXA 3G2QA 3MB5A 4BJ6A 4ABTA 2O3RA 1EJBA 2WMOB 3TD9A 1T2DA 4AECA 2AYZA 1RSZA 1KP3A 1U11A 4YB8A 5EE0A 4E70A 3ZDAA 1TYEB 2RG1A 2WU1A 4BAUA 4KFUA 1C30A 5IVIA 3RKUA 2Q5FA 1K7FB 1E0JA 1KQOA 1MDFA 1MNAA 2OVBA 2J0VA 1WDKA 1E6MA 2GN2A 2HK7A 2OCAA 3PNSA 1P1RA 1UK6A 2R8RA 4Y2JA 4YJDA 4A91A 1XRQA 5AOVA 4G63A 4H18A 1JVBA 3B8HA 1J2UA 4KV7A 2FY8A 5J3JA 5IXYA 3LW8A 3V42A 4IIDA 4XJTA 2JJ1D 2Q3CA 4K9PA 4D57A 1BXKA 4G84A 1M0EA 4L9WA 5TQ0B 5FR1A 3X44A 1R0XA 1QWOA 3E35A 2YN4A 3FOBA 3TJMA 3ZUPA 4DIEA 5JOQA 3DDHA 4PY2A 3ZV4A 5SZJA 1M2VA 4N3NA 4UD2A 1Y89A 4CEHA 3GFSA 1QP7A 3QG5A 2WJWA 1V8DA 4NBSA 4X7MA 1NYTA 2WIAA 5CPBA 1SOWA 4BZQA 1ZHOA 3KLPX 1BS9A 1RQXA 2C2OA 2Q7OE 1E77A 3AUTA 4MO9A 1CR4A 4DNOA 3MWEA 4W7HA 3GLGB 5J4HA 3LM8A 4Q82A 2QMEA 2VJPA 4IIBA 2Y2VA 2XBUA 3H2IA 2DKNA 4MQUA 3ZBTA 4RTRA 2B61A 1EHYA 2WJ4A 3KETA 1PRYA 4LF8B 4JNCA 1QKKA 3IHWA 4K26A 3OZCA 1CUIA 1IBSA 2FSPA 3RU2A 3A32A 3U61B 1TAGA 1Z9BA 2IFTA 3D5QA 3SHVA 4B6EA 1LPNA 4DGSA 3C98A 5TT1A 4CQLA 4IWNA 3E2PA 1NGSA 1ZRHA 1TKCA 2CXSA 1R50A 1JUDA 1CUHA 1JQJC 1YVEI 2BFOA 3FYTA 1IK4A 1NURA 5B64A 4WESA 3A6EA 1G2QA 1I2MA 1T6XA 3JAWA 4KQIA 2REXB 3G2IA 5EIEA 4NEGA 1K6MA 3G23A 4PLFA 1OWPA 2COKA 4A6PA 1JHMA 2D2IA 2XUJA 1F51E 4YS6A 5AJYA 1KWGA 3VYVA 3NBKA 1DB3A 1VSVA 3VO1A 1BHO1 1W5FA 4FX2A 3ED5A 3C5EA 3E3OA 4ON9A 1K8ZB 5IVHA 3H11A 5JNTA 2ATIA 4O4JA 1UBHS 1VOTA 1ZEMA 1QHIA 2V7EA 2O57A 1KPHA 1R66A 1XD2B 1D7AA 2BH9A 2WQZA 2XZTA 4JY7A 5DULA 1O5OA 4ZCIA 2PHZA 1QGOA 4NOMA 1THMA 3R44A 3O8RA 2WA2A 2B4TO 4I1YA 1A4RA 1P5HA 1F8YA 3FUTA 2FFBA 3KFXA 4G01B 4KU4A 3TK1A 4CIBA 4EF5A 3JZDA 3IPLA 3O8OA 3DGEC 3NBFA 2DULA 2RKBA 1HTBA 5H0IA 4LFBB 3MRXA 4LI0A 1E2BA 4TL9A 1L3CA 2N3ZA 5EHGA 4GAEA 4BQQA 4CFSA 2HY7A 3M6AA 2DBRA 2H18A 4E07A 1OB5A 2QD3A 4J75A 5KDDA 1A76A 1I2BA 4Z49A 2RGRA 1G16A 5EE5B 5KYUA 3MHTA 1Y5IA 3Q88A 5TJHA 4CG0A 2R6R1 3O1HB 4EMUA 3JQCA 4XTCS 4F56A 1DOHA 1Z56C 3V4ZA 2HRDA 2HGZA 1H5NA 2AHOA 4RD6A 4UVGA 1LXCA 1ZGGA 2G80A 1XRPA 4J43A 1HM5A 4UUQA 2WY2D 1FS5A 2RI1A 1MQ9A 1TVCA 2YZNA 4ZALA 2ZTLA 3RTAA 4YXWA 4ALNA 4YJ3B 1HL3A 3A2LA 2B5VA 3OZTA 4RDXA 1O95A 1NIJA 2RCYA 1NQOA 2XCTB 4FXPA 1RPNA 2H4YA 2P9GA 4NENA 1RYBA 2XUZA 1W4RA 5GV8A 2TMKA 3VJMA 5T8KA 2XMBA 4YBZA 3FWHA 5G4KA 5LC1A 5AUNB 2QB5A 4DJFC 2GBIA 1JBKA 2QQ0A 1EHIA 2B5WA 3A37A 3HSKA 1K68A 1KVQA 4MAFA 2D2XA 4OYYA 2I87A 2HZBA 3MOIA 2XWBF 2OCDA 1FDIA 3B2EA 1TUBA 3DYIA 4RKEA 4MUNA 1Z73A 4OM8A 3IKLA 5JNWA 1DRJA 1LVGA 4BAZA 3ZHBA 1VPVA 3U4GA 1R6XA 2VRCD 2C99A 2C88A 3Q12A 1H42A 4WL0A 5EXPA 3EEIA 4CG1A 1V6CA 3DV9A 1IOVA 4AO8A 1QHYA 2H29A 4FMPA 3SMQA 4BMVA 1N57A 5CH8A 1SCUB 3QU2A 4QTXA 4QARA 4JAVC 3WDMA 1BXZA 4LC0A 3HJFA 3UHJA 4ZOLB 1DTSA 4X1YA 4B84A 1Z5VA 3VSBA 2ZZNA 1KGSA 3F7TA 3KVNA 2QVLA 2D0DA 3FKQA 4I5EA 1CG6A 4RHYA 4KPYA 1DGQA 1GGNA 2ZCVA 4Y2YA 2MSCB 1N6OA 1JVNA 2JAXA 4R1OA 5DW0A 4EJMA 1B23P 4XM0A 1QIKA 5IRCD 1WU8A 1UDCA 1ZM4A 1CWUA 2OFOA 1Y3HA 1Y1PA 2Q2NA 2AMVA 3UAYA 3WB1A 3OESA 3OCZA 2AR0A 2X8JB 3JD3A 5K3EA 4B6RA 5AHRA 3P4XA 1PR9A 1QPGA 3V33A 3ZWKA 3P0HA 4Z4GA 3ZDBA 4IPTA 2XVZA 5ALEA 3ANLA 5FPSA 4O5OA 4PG6A 3TPFA 2D3TA 2FF7A 4JYAB 3T3OA 1F5NA 1Z34A 4BNKA 2FR8A 4DYDA 5JRDS 1U0OC 1XCLA 2QZPA 4ZYZA 3LYUA 1T4MA 3NTOA 4B2YA 4B6SA 5CD9A 4JUDX 3W9YA 3LBFA 5JQGA 1RZRA 3REFA 1W36B 1IHYA 1T4BA 4Z4CA 3UC9A 2IA5A 3B3QA 1I01A 3C7CB 1RT9A 1U5AA 1LU9A 1ONOA 1U6KA 1YZGA 2C4VA 4UE3S 4P4NA 2CLSA 1Z4JA 1ZMOA 3PFHA 4FE4A 5FHRA 3FPSA 1UADA 4X6UA 2NMVA 1OJLA 5HZMA 4LX8A 1RRMA 4AICA 1BCRA 2XQVA 1XD9A 2XIJA 4FFPA 4CTJA 4KUHA 1I30A 1NKSA 4HADA 5EP1A 1AQJA 1IXZA 5T64A 4DSZA 3LTNC 4UUMA 2FFAA 1I3CA 1NUQA 4KPGA 5F2EA 1YJBA 3T5MA 1D6NA 1MC5A 1S89A 5EWMA 3LBNA 4X7PA 4BWVA 1R10A 3IDOA 5K0GA 1JMKC 1P9WA 4RIEA 3ENKA 2ESRA 3R6DA 3WLTA 1GLVA 4I6GA 2F3UA 1QVRA 1JWAB 1YS2X 1SQGA 3EVCA 3LKDA 4G97A 3K20A 2PZJA 4OUDB 4IIVA 1M7HA 1IJKA 2J08A 3GJXC 3IKMB 3DOEA 1KMHB 2FPUA 3IDSA 1HOTA 3RUAA 2JIDA 1H6BA 2I2CA 4G0MA 4KQGA 4BMOB 1L4KA 2NZYA 3RSCA 3M5WA 3CW8X 3WYAA 2ODBA 2ICAA 3E3AA 5IDWA 1IHDA 1OMOA 1T13A 3LNTA 2JBAB 1ML4A 4GDFA 3HWX1 1T4DA 2EFHB 1KMNA 4CE6A 3W0LB 1OXXK 2PGAA 3I04M 4LZOA 3FYUA 1T4GA 2IK8A 3NHJA 3PNVA 4J6EA 1G6OA 2I6FA 3TZCA 1O08A 4E5NA 2JLVA 1GA4A 5C37A 2ZUEA 4N5DA 4FILA 2V6IA 4NYMR 721PA 3LX4A 3AW9A 4YNBA 4NFLA 1ULUA 3COZA 1VBNA 1SHUX 2DYKA 3C3WA 2JRLA 4MPTA 1X9GA 1WBJB 3DV0A 1RJ9A 1R6BX 4IIJA 4IJKA 3UHAA 4BECA 1FDRA 4J9UE 2Q62A 1I32A 3WGKA 3K70D 2O14A 1NX9A 4UCXA 4AJ2A 4H7KA 1JHAA 1G2PA 1AF4A 3VI4B 1NT2A 1TQ8A 1D4FA 1UK7A 3E2IA 1J21A 1Z07A 4MR7A 1AV6A 7REQB 4C76A 3EEBA 3GELA 3N5KA 2CSUA 3AF0A 4PX3A 1N2SA 3CURA 3O9ZA 3SQWA 1M2KA 2F6RA 3MOGA 1A5ZA 1M2HA 2F4NA 2OM6A 1BA2A 1ORWA 1X8KA 2EFEB 2HYDA 3FLMA 4ATNA 4DIDA 2XRYA 1JQKA 1YVDA 2ET6A 4CKYA 5FUMA 2PAAA 3B8EA 1ZRMA 2CDRA 4M1SA 3ZTTA 4Q3AA 4TTTS 2HRCA 4I66A 2HWUA 3IP9A 3GNTA 4J0KA 3GRRA 1P9RA 2W90A 4ND6A 5T3UA 5LJIA 1IE3A 4ZAYA 1TQHA 2AJLI 3CEMA 1QGUB 1RZ3A 3RBAA 3KZCA 3GLGE 3IQGX 1Z28A 3JS5A 3NBMA 5FOSA 1T2AA 1HGXA 3N8GA 4RHCA 3BB4A 4TKZA 3KP1A 4NNJA 3P9QA 2REOA 3UUWA 4CMBA 1ESZA 3VPGA 1ZMTA 3LJKA 3ZN2A 5F7ZA 3WFJA 4ARSA 3WWZA 2E18A 1NF8A 1FZTA 3WLOA 1U90A 2JFWA 1XZHA 4EKIA 4IW3B 1P0MA 1B74A 2FX5A 3QHAA 5DIFA 5LA6F 1Y42X 5LSAA 3BRSA 2X0IA 2QY9A 1KH2A 4X54A 3EJ6A 3NVAA 2PKXA 3PCTA 3IA2A 4UATA 3P0RA 4YX9A 4B34A 5CFPA 2V6GA 4FJ0A 3BA1A 4MJLA 2CUZA 5HVNA 3NIWA 3OQIB 3ZI0A 2FN4A 1HE2A 3IR7A 4XARA 1JTEA 2QMUA 5JAZA 3GFBA 5JS8A 1JJ7A 1QXSA 3FYSA 4JP3A 4CG2A 3DFIA 3MT9A 4YLGA 4J4BA 1SURA 5CVEA 1XJCA 4QEZA 1K6XA 1MZVA 4OEHA 3AEUA 3LUGA 3P2KA 2ZUFA 3GCGA 2NTYC 3KJQA 3U56A 3QVVA 3OD1A 1BROA 2NQ2C 3GIWA 4OFBA 5IF9A 2G8NA 1RYHA 4HY3A 1PGQA 4R9NA 1GPDG 4AJKA 2ZU0C 5BUQA 5T4FA 4ZEWA 1GFSA 5BV7A 3UOWA 3PG5A 1NJFA 2XNDD 2OFFA 1AKUA 1CR1A 3BGWA 2XUHA 3CO5A 3GQBB 4HDKB 1FNMA 4PAOA 2PD4A 3ND6A 5J5CA 1SBTA 2MYNA 1SBQA 3QH4A 3ZCQA 4BE9A 3ZJTA 3P1JA 4FS3A 1Q1GA 4Q9AA 1L5RA 2OQRA 2FOXA 1VG8A 3GGGA 3L0DA 1EAMA 1V48A 1CQIA 2R84A 1UJ2A 4KUEA 2W8BB 2HPZA 3F98A 1ZH2A 3RFVA 1K27A 2HYIC 5GVSA 2PGDA 3RASA 3HB1A 1AMOA 2R7AA 1NXQA 1BRMA 3RW9A 1RRKA 3T9CA 2IZ0A 1TM5E 1SCJA 1XVLA 4MQFA 3RVOA 4UOZA 4BGUA 1DZ3A 1ZP6A 4LXUA 4PAQA 4QGBA 2ASVA 1JHYA 1F0YA 2EERA 2H08A 5DW3A 2QTBA 4KE6A 3DNMA 2H92A 4LTDA 2WTEA 3U3DA 3VKUA 5KYUB 4K9MA 4NQZA 1ONSA 1ADFA 1HFWA 2ZIUB 4GPZA 4BMNA 3NHYA 1J2TA 1KBZA 2ECOA 1KI7A 3R3UA 5KAPA 3EQ8A 3K9WA 1W5EA 2G9UA 1JZQA 2WKSA 3AIIA 3Q8WA 4XJSA 2DBZA 1ZKDA 1TGVA 2XJ4A 4PZEA 4XPIA 4A82A 1C9KA 1G8YA 2BF7A 3LE8A 5AMXA 2Z2KA 2NM0A 3ZV5A 3HP4A 3TLXA 4O3MA 3GROA 4CG3A 3ZZUA 1ODIA 4B46A 5M04A 3HVIA 4Q1FA 5BV2P 2OOKA 4OFWA 5KQSA 2OBBA 3KKEA 3JWEA 2OVFA 1L7BA 1V96A 1TM1E 3M6IA 5F12A 1NVVQ 1M74A 2JC3A 2PU7A 4HWSA 4JENA 1ZGCA 1QQ6A 1ZK2A 2ES4A 5G4KB 1VJGA 3RS3A 5ENDA 2DT8A 3CX3A 4RSGA 5DTQA 4LJAA 2IV7A 3MBOA 2A8YA 4MRAA 3ASZA 3QX8A 2NW6A 1PZGA 5TY0A 3F5FA 4S2UA 2IE8A 2OQ2A 1OI2A 3GFFA 5ALTA 2QTNA 5AVKA 2FSSA 3BWYA 3A4NA 4IZOA 5FOWA 4HNUA 1FY2A 4FWIB 4L0QA 5K0FA 1JHVA 2W2LD 1QS0A 1FUKA 4PZPA 3PXEA 1PR2A 4RENA 1T5TA 4DHWA 3WBKA 4CLEA 3RR2A 1RKUA 2NU9B 2H5LA 3CLHA 3W5SA 3WO0A 5FWNA 2O8EB 4U6NA 1XROA 2A58A 3VNAA 2RK6A 3P5SA 2OECA 3MJEA 3W5JA 8AT1A 1PJSA 3WYGA 5C4IA 2WTXA 5CR9A 2EQ5A 2BR3A 1G8JA 4RM2A 3PE6A 2JD0A 2WBLC 4I50B 4JHLA 4Y9SA 2IDKA 3LTEA 3WZ2A 4FM9A 3WA6A 4BB9A 2ZRMA 2E6UX 1VGRA 4QOEA 3GJQA 4LF5B 2BEKA 2C29D 4KQ1A 1MAWA 1Q2UA 3VR5H 3GLIB 4CM4B 2X77A 3WLAA 3ETNA 3FWZA 3PUKA 4UU7A 2IL1A 4L3WA 3PYMA 3M33A 5DE3A 1AT1A 2K7FA 3E23A 1E9AA 3TUJC 1QRSA 1T2UA 3MJHA 2SBTA 3K6RA 3N0VA 1W8IA 2E5WA 3FRHA 1OZ0A 1U1FA 4QBKA 4DB4A 1Y3CE 2EU8A 2AOUA 4FQ5A 2Q4BA 1NT4A 5H59A 3PJDA 2ZT7A 4NAUA 4S04A 5EZ5A 4FHCA 4HAIA 4N0DA 1MAUA 3VDNB 3AL2A 4I81A 1XZLA 3QOFA 3F4BA 2I29A 1EFVB 3R5HA 4RTQA 3AVXA 2O8CA 1ZY2A 5F3RA 3EEQA 2XBLA 1CULC 3EQ9A 3IUJA 4YAEA 2H1SA 2QIOA 1RAHA 4D4IA 4U9HS 2EKBA 2EP8A 4UBMA 2VHCA 3KHUA 3WZMA 1LH0A 4BO4A 1OTYA 1T5IA 4M0CA 4AY2A 5FBKA 1XVUA 2F8LA 5FFMA 4CKWB 1KRXA 3HZZA 1LPBB 4P3PA 4ZZ0A 2F1KA 4O3FA 1WDLA 1L4GA 4POOA 3CSSA 2WDZA 3EVDA 4I1IA 1CF9A 1H2AS 5G3YA 1PV1A 4G0XA 4N3AA 2A78A 5J2TB 4E15A 2R8ZA 1XBTA 2HXSA 4QU5A 2UYHA 3MJCA 2NUPB 2PTGA 2FOIA 3FNGA 3O47A 2WWVD 5DM70 2VRBA 3M4XA 1VLZA 4EB8A 2GK6A 3H42B 4OMDA 1E2JA 2JLBA 3PDUA 3BGOS 4QVKA 5FNVF 4DEXA 1IMOA 1WXEA 4HS9A 3NS7A 1QIGA 1DCKA 1ZD2P 3OP1A 2PUBA 3DOOA 4CT5A 1Q0RA 3H4IA 1WHTB 4IHJB 4ZV7A 1EE9A 2GXQA 2Q3MA 1FFXA 1T4CA 2YOGA 4MVJG 1KVSA 5BR4A 1ZR4A 1FMCA 5IVDA 3HP7A 4LZZA 5FWYA 3FB1A 3UT5A 1Y4ZA 4AF6A 2WWWA 2BEVA 3ENWA 3TDKA 3ETEA 1JHOA 4DOMA 1Q7BA 3HADA 2YFYA 3PUIA 3WMEA 3QVMA 4R0MA 2J6CA 4WMLA 3CTMA 1FXWA 3O4HA 1PQUA 3RSLA 4MVYA 3JAKA 1U63A 4IFIA 4IGFA 2DUUA 4MR7B 2CLMB 1U3GA 3OUUA 4NWIA 4C88A 5LQDA 1ZI9A 2Z3VA 3DE1X 2ZE7A 3G2HA 3ILSA 3ZY3A 4DVGA 1IAQA 3IALA 2XMRA 3I73A 2R60A 1VZ2A 4P22A 2CEAA 3WYDA 4XDZA 1JDNA 4PYOA 3ZYCA 3FDZB 3NLLA 4MPRA 4RF3A 4BV8A 2YW2A 4P33A 3TNFA 1HRDA 2I9KA 1B6SA 3KHSA 1O0BA 1LBIA 2RJ3A 1V26A 1FYDA 9LDTA 5BSUA 3VV3A 1WB5A 1WZEA 1G3UA 3OJOA 5JROA 1C9NA 1J00A 1OLXA 3FPGA 3DMYA 2X1VA 3G49A 3DD5A 2IWHA 5IJ9B 4PZZA 4L5AA 1JQEA 1F6DA 2QX8A 3GPCA 1DAFA 1KP2A 3IGFA 4GBGA 4WZZA 3KQNA 4FGWA 1L7MA 4DPKA 3ZUGA 2JNWA 2FNAA 3SP1A 5LLSA 3G5UA 4C5AA 1CZUA 1X80B 4C0WA 4RH3A 1JKJA 5JPDA 3L8GA 4TV8A 1Z3IX 1VDZA 1ZJJA 3PGLA 4JOSA 3SMVA 4A6EA 4PG8A 2C7RA 2XRZA 1NBAA 2BJWA 2RJNA 2YHIA 1CRWG 3D1VA 3KYBA 2ZTMA 1JAXA 2I5PO 1BFKA 1RVDA 3RU3A 1I1HA 3ZZ1A 2JVJA 3UVEA 1WS6A 2J6HA 2Q49A 4GMXA 4QU0A 4CXMA 2YYAA 5BXQC 1ZM9A 2HLNA 1X8LA 5JCJA 2E82A 1YFZA 2JGAA 3TNYA 1KI6B 2RHBA 3L82B 2XMGA 3DE3X 4B0PA 4KLCA 5J2UB 3UMFA 9ATCA 3CG4A 1XCJA 1EFPB 2XDYA 3F5DA 4D9NA 2XDWA 5JHHB 4CCAA 1QG0A 4WBNB 3LDUA 3HB4X 3VPAA 1O5TA 1RJDA 2X7HA 4M7OA 2Z2IA 1H65A 4XVCA 3VGPA 3U6KA 2ATCA 2CXXA 1CDEA 2BMAA 2WI8A 1X70A 2W7TA 3N7TA 1NTRA 4HG2A 4R40A 3RT9A 2OV1A 4GXTA 4R2XA 3A6JA 1V25A 5FUQA 3LRPA 3THWA 1QR2A 2AOTA 2W6QA 2XNKA 4TS9A 3EGWA 5D2CA 2KQUA 1AZWA 3A6PC 1W30A 3IV9A 1QH0A 2C1ZA 3PQ7A 3UAOA 3R3YA 2J4CA 1V0JA 1E6KA 4IRXA 4RL6A 3VDRA 1XQ9A 1N3LA 4INAA 4A0QA 1NVAA 3EPPA 2P11A 1WMAA 3NKVA 1UFVA 3T1NA 6LDHA 3PR3A 1K3UB 5EUBA 3TEFA 2QUJA 1VSQA 3ZX4A 2OUIA 4L7QA 1TEZA 2EBWA 2SCUB 2OLJA 3EG9A 3LYLA 1C1XB 1U80A 1XLTC 5CJ2A 3TTUA 3VVMA 4ZCMA 3AEYA 1RACA 3T3NA 4V1CA 1V4BA 1RYYA 1DO8A 2FG5A 4LVCA 2J9FA 1YJ5A 1ZESA 4N1AA 1GYQA 2ZREA 4HNAB 3ENVA 1VE9A 3AIOA 4YJKA 3PWKA 4ETWA 3ULKA 1ZXBA 2AUTA 4I46A 5DBHX 5BW4A 5A0TA 2RONA 5KQMA 1AGNA 2NU6A 3BTUA 4LE1A 2DFPA 4PYNA 5KX5F 2C7GA 3QMPA 4M1MA 3KOWA 2C7OA 5CNJA 3V4LA 4DA4A 1E2IA 2IIQA 3BTVA 5EN4A 3C5CA 3CF0A 1TRHA 3I32A 4NZPA 1JI0A 1GTMA 5DLEA 2AI2A 2HCTA 4BX2A 3CZ9A 2Y0CA 2PH5A 1F9AA 1T2FA 1Z47A 3C1AA 3GB9A 1ZH4A 4G3XA 3TTXA 1R7RA 4MWSA 2C2BA 1C41A 2HMVA 3BE4A 3WK8A 1M1NB 2C96A 1QAQA 3BH0A 4LC1A 2FWJA 4ZCPA 1OSNA 5GIPE 1SXGA 1YHNA 5L53A 1TK2A 4G9BA 1TMOA 1U2PA 3NNSA 1O96B 5IJAA 1RHJA 2H4JA 3HE3A 5HIJA 4NRDA 1OROA 2HA3A 4ZVUA 3RYCA 3NT5A 5ICCA 3U5ZB 4F3CA 3PGKA 4O29A 1F8GA 4ACAA 5GZ3A 3C3DA 2JLXA 2QTVA 1AKMA 2P7HA 1H4TA 4GX2A 4TZKA 3P9KA 3QEKA 2JFBA 3RE1A 2H0QA 3KJGA 4G8CA 4Y2TA 4ECAA 4OX9B 2O7SA 3MT8A 1SUSA 2PCLA 3AIMA 1ULSA 2J9RA 1UBUS 4N01A 2QUBA 3VHXA 1Z4KA 3EN0A 4ZMBA 1C5KA 2OB1A 1E3IA 1O87A 4IDEA 4V3BA 4WN9A 5C9ZA 2FDCA 1Q95A 3HBAA 1DBVO 2HO4A 2CKDA 2HRZA 3VDQA 1NXSA 3CVOA 3PICA 1X1QA 3WBBA 5A7FA 4YJ2A 1IN1A 4HD8A 3H1AA 4ZKDA 5C18A 3OEHA 3EZ6A 2BP7B 3GOQA 1EK6A 1QJ4A 1IAVA 2C95A 4BNMA 1YJXA 1E63A 1SU7A 2Q4OA 3DYVA 1HT0A 5EJ6A 4B3HA 2NP6A 2EFJA 2GPJA 2XEDA 2HJRA 3JD2A 3N8KA 3NB0A 3F1LA 4FGLA 3V46A 2Q1YA 4E2ZA 4KH0A 4CCYA 4YAGA 1TKRA 4XRGA 1OPRA 1CTQA 1Z2OX 3K0FB 4NJEA 4TYQA 1SKQA 5FEMA 3QQPA 2H31A 2PUVA 4G8DA 4H08A 1ODSA 2GD6A 2OGSA 1L1RA 2R97A 1JXAA 1TJ3A 2IVZA 2JDID 4HEHA 1GM5A 4EVSA 4Z0HO 1N5DA 1T8YA 1D2NA 2X4LA 5BN3B 1A72A 2X40A 2IZOA 3LQ1A 5FWAA 3ZI4A 4U8GA 4AY5A 1ZH6A 3JWJA 1A9YA 4OI4A 2RMKA 4LQDA 2DHQA 2OENG 4Z7QB 5E9QA 1HKHA 1I3KA 3HJGA 1FSSA 1TOAA 2WZCA 3EVBA 3CF4G 1WNFA 3GZNA 2ZYWX 3BHMA 4P58A 4RPHA 4B7XA 4IH1A 4EHFA 4X90A 4F2WA 4EW2A 3ZR4B 2P9QA 5G0WA 5CEEA 5JMWA 1ZCJA 16PKA 1FTSA 2RHGB 3V97A 5JCXA 3OE5A 4KHZA 3O2JA 3F8TA 1NTOA 1W5SA 3LC1O 1T0IA 4JXJA 5SYNA 1E1RD 3H4VA 4MUXA 2JGEA 3AF4A 2VP9A 4DS3A 5EIHA 2WICA 4NJMA 3W8FA 1PN3A 1Z62A 2JJ2A 3DZKA 4ZAZA 3F73A 1IH8A 4AYWA 1YZHA 4Q3LA 4NIMA 4UOQA 1F2VA 4B4DA 3VR0A 1MENA 4HKTA 4QBHA 1PEAA 3CF4A 1QO9A 3D6VA 2R6CA 2W00A 3AESB 4H15A 1TMYA 1TEHA 3S1SA 3IAHA 3M5DA 1EJ6A 2ALJA 1ZUIA 4QUHA 3K4HA 2C8JA 3I1YA 3PFNA 4PZAA 1YZUA 2IYRA 3BMOB 2IP1A 3SR3A 2X4DA 3GEBA 2O7VA 1RYNA 4ZCTA 2CFCA 1VMIA 2QYSA 3BEDA 2J59A 2Z04A 2GN9A 4RPLA 5AW5A 5JS2A 6ABPA 1YU6A 1E7QA 5IFKA 3CYFA 5K1SA 1I8TA 4C03A 1XK7A 1FFXB 2BTQB 2HWYA 5AJTA 4D4KA 2GK3A 1GZ3A 1TO6A 3R7AA 3WHIA 2QSUA 4ITUA 1RWXA 5IYZF 5K8TA 3RANA 1PJBA 1VECA 1XAHA 3NH6A 4EITA 3O21A 4QQKA 4I9UA 4XVHA 4B83A 4GUAA 5C51B 3OJXA 3L7LA 4LE0A 2VH5R 2R6DA 2R48A 4TYPA 2F1HA 4EB3A 4EZEA 3AR4A 3FXAA 1HFJA 2RHMA 3OQ6A 5HCUA 4QODA 3FVTA 1NVKA 3KUCA 4OXKA 3ZDDA 4MQEB 1ESCA 1G8KA 1P8JA 1FTYA 1SVSA 3SHOA 1O94A 1UP4A 3SYMA 2BV3A 2VP4A 3A4MA 4YQYA 5SICE 4EY5A 1Y3DE 3DMPA 4OX9Y 1BE6A 3RK4A 1MX9A 4C89A 1W4LA 3BM5A 3JW8A 3L92A 4EL0A 2KWIA 2PBLA 1JMVA 1MBZA 2VHJA 3CEJA 4WXRA 1NVBA 1TCBA 1VJCA 2P30A 4D3XA 1JDVA 3LP6A 3QIAA 3NH9A 3WTCA 1NLYA 3C3CA 1CY1A 2FUCA 2QJFA 3D4NA 5FF9A 5WRFA 1LTQA 5D5QA 3G9QA 3GEEA 4PYMA 4QQ8A 3O73A 1L7NA 1MXFA 5F35A 1E3JA 1MX1A 4XTRA 1SBCA 2GF0A 1JFVA 3DPSA 3REOA 4RVOA 3RK0A 3V7FA 5KVCA 1M3SA 5CJPA 5LOVA 4IJUA 3N59A 2GLTA 2Q5CA 2HIGA 2YX1A 5LCXA 4O4LA 3KVRA 4M99A 5CLIA 4UHKA 5DHQA 1KP9A 1ARZA 1R5JA 1ZVVA 1YL7A 2BI4A 2H7XA 2VUUA 2AD1A 1VE1A 2B8NA 3KUUA 4LHZA 1OWLA 4ZVKA 2NX2A 3KTDA 4ED9A 5TPWA 2FOLA 1CUUA 1NI4B 3ZIDA 3SXUA 1QRDA 4BQFA 3MCZA 4RLFA 1Z2NX 4ZHQB 4RIHA 2DSNA 1KZYC 1RPJA 3S2ZA 3WGVA 1JI3A 2H0AA 4Q6WA 4BP1A 1RAAA 1QO7A 2XW6A 4J0IA 3BHIA 2CXOA 3IH5A 2ZBRA 1U7ZA 4NYIQ 3VDXA 2OD2A 4JVLA 3KCQA 4Q0MA 4N9WA 2CXNA 1GKLA 3L8YA 5CDFA 3GEHA 4AU1A 5H1YA 4DTIA 2N0SA 3QLJA 3I1IA 5LWHA 3FNHA 4MVJH 1T1EA 2WD9A 3N2YA 1EBBA 4NDNE 5BRNA 5MDHA 4QXRA 1WL8A 3K94A 3FDXA 2AF3C 2ODAA 3F7OA 2UXBB 3KWMA 3L8FA 3P9YA 3IEUA 4FZJA 4EUFA 7ADHA 1PE0A 2JI8A 4P84A 1M1XB 2ZSUA 2H0RA 3C45A 4LFCB 4NR0A 3T61A 2IYUA 2RAUA 4JSTA 4C78A 1EJ2A 5AXAA 3NKLA 2BGKA 1X0VA 1QVWA 4BNUA 1T5DX 3JQBA 1ZNQO 2JAHA 1QHHB 2I6SA 4MRPA 3L41A 3L6CA 3PNPA 4YTEA 4ZAXA 5JH7F 2VHYA 5U4QA 5BQFA 3IJRA 4TRRA 4HDMB 3Q7PA 3LIPA 5FO1A 3R3SA 2G7MC 3ROZA 3QBVA 3RTCA 1I6LA 2WYIA 1SCAA 1NMEA 1QO0D 2F59A 2ZKIA 1RI3A 3MTGA 3N2KA 4IOMA 2Y99A 3G8DA 4GPEA 1VCMA 1XKTA 3LDFA 3DFKA 2AR7A 2B36A 4RAQA 5IAAA 1M83A 3AZQA 2PUDA 4YRTA 2O19A 4HZGA 1X38A 1FSFA 2NO0A 2GEUA 2GBCA 4LJRA 3O92A 4PX9A 4XQ9A 3BRQA 5G1NA 3C1OA 1JDBC 2B99A 1Z2EA 2QT9A 1UOPA 1MB4A 1K7EB 4FFBB 4OK6A 5TF4A 3W7AA 4Z2YA 2V7VA 4TVSA 5TPZA 2IS2A 1N5OX 3UMGA 3A28A 5BSVA 2IIVA 1SD2A 1XO1A 2LE0A 2NNWB 3MJRA 5DCLA 2JG3A 2Y1EA 3NUZA 3RC1A 3EIWA 1MO5A 3KR0A 4DCCA 1EFCA 5EG5A 3DHNA 1NM5A 3L4EA 4R1SA 1L8LA 1P7ZA 1K88A 1SQFA 2PLRA 2YVUA 4EB0A 2I6QA 3SSMA 6YASA 1I7LA 4FB5A 1MGPA 4E5SA 3OMWA 4DQKA 4FYWA 4IJQA 1C8BA 4MKZA 2ISSD 1RCUA 5EMJA 5K6AC 1YCDA 4AS1A 5SYAA 4AJ4A 2CL6X 3EGCA 3B53X 1YIAA 4D45A 3D4LA 1V5GA 1AKTA 3G5LA 1EGQA 1UPAA 1O77A 1GCGA 4KO1S 1CDOA 5HG0A 1I94B 1K5DA 4DM3A 3K5PA 4ZVVA 1L1QA 2PVPA 5GADl 4HX2A 4WN9B 1GRQA 2D54A 4QWWA 5J9FA 3ZK8A 3DLBA 2HSZA 3EFBA 1DAEA 3UANA 4CM5A 4I14A 2C94A 3GUHA 4KACA 4GE3A 4NOJA 4YJ2B 1V9CA 2MIIA 2QJWA 4HPWA 2JFGA 1O5IA 4K9DA 1GA6A 2CNNA 3IURA 5EQDA 1XKXA 2BLLA 3VM6A 2VG8A 2W42A 3JQ6A 3IJPA 1RRCA 3WWPA 4YY3B 3NNNA 3SQLA 3AF6A 1Z5OA 3QELA 2FQYA 1ATIA 1P17A 1HE8B 2Y2UA 3QYFA 4FDLA 3VJKA 2I2FA 2A4KA 5IPFA 3I42A 2ODWA 1OE0A 2QSZA 1CHDA 1V4VA 2C0PA 5IHPA 5F73A 4N7JA 3QUQA 4FOOA 1HLGA 3EZLA 1TW2A 2OXIA 4CUKA 4ETMA 5BV0A 4V3CA 5HIMA 3T54A 1CUAA 1NWHA 3FETA 3GEIA 1XNGA 2F4VB 1SUAA 3AR2A 1Y4AE 1K08A 3RYHA 1Q11A 2IYNA 2QI9C 1BG6A 1U4NA 2HJGA 2RARA 2Z9BA 4YMLA 1CUFA 4EX7A 4GOJA 1DPFA 5LVAA 5MN5A 3AI2A 3L9WA 4ARBA 1MQSA 1AQNA 1PSDA 2XAUA 5JMOA 1HTWA 3VOSA 1ETHA 4KZPA 2P9FA 1D6SA 1G42A 4L4UA 2HWWA 3ETDA 3QI7A 2QX9A 3A1DA 3C43A 2C2MA 1ZNYA 4ML3A 4NFSA 2P77A 3GN1A 3JYHA 4WLOA 3ZGZA 3L1KA 3T41A 3NXSA 2JH9A 5IW8A 2JGRA 1QKIA 3IQHX 3L1IA 3R3HA 4B2IA 4BLRA 4D4GA 4RULA 4Y0NA 1IBCA 2C3MA 3BMCA 3O8NA 3W3ZB 1Z18A 2QRQA 4NLLA 3Q3GE 4LYGA 5L45A 4R01A 2N1MA 1E59A 4A10A 3DOUA 5KDOA 1C9MA 3O4JA 1ZUD1 3ZE6A 4Y2UA 1G18A 4KITB