3UOGA

Crystal structure of putative alcohol dehydrogenase from sinorhizobium meliloti 1021
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
341
structure length
341
Chain Sequence
MMSKWMQEWSTETVAPHDLKLAERPVPEAGEHDIIVRTLAVSLNYRDKLVLETGMGLDLAFPFVPASDMSGVVEAVGKSVTRFRPGDRVISTFAPGWLDGLRPGTGRTPAYETLGGAHPGVLSEYVVLPEGWFVAAPKSLDAAEASTLPCAGLTAWFALVEKGHLRAGDRVVVQGTGGVALFGLQIAKATGAEVIVTSSSREKLDRAFALGADHGINRLEEDWVERVYALTGDRGADHILEIAGGAGLGQSLKAVAPDGRISVIGVLEGFEVSGPVGPLLLKSPVVQGISVGHRRALEDLVGAVDRLGLKPVIDMRYKFTEVPEALAHLDRGPFGKVVIEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Alcohol dehydrogenase
publication title Crystal structure of putative Alcohol dehydrogenase from Sinorhizobium meliloti 1021
rcsb
source organism Sinorhizobium meliloti 1021
total genus 94
structure length 341
sequence length 341
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3uogA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3uogA01
1N1EA 4NJMB 5KVQA 3ETEA 2WM3A 2JD2A 3ASVA 4QO7A 1YB5A 5DBIA 3D4NA 3FSRA 4G2NA 4CLEA 4IDCA 5TIIA 2GGSA 3DWFA 4NBUA 2IXAA 2YQ5A 4Q3AA 4DLAA 2Q45A 3DFUA 1JVSA 3O9ZA 2QQ5A 2ZB3A 1NQTA 1ZIDA 1B3BA 3ST7A 3FNFA 1PZEA 2V6GA 3IAHA 4E31A 5F1PA 4BNUA 5KIAA 4UULA 1SB9A 3CXRA 4Z3DA 2V6MA 2PH3A 3JQFC 2NVUA 2JJYA 3D7LA 4GGPA 2DT5A 4MIEA 4WGGA 2VNSA 2B0JA 5CP8A 3PQEA 3W6ZA 2FY8A 1H6CA 2PD3A 1MFZA 1YH3A 2ZB7A 4CJXA 4Z0HO 2HMWA 4AJKA 3PRJA 1CETA 1YL7A 2V6FA 4OJNA 4XKJA 2IEBA 3WGGA 3D5TA 1RJWA 4IM7A 2CUKA 1BG6A 1GCUA 1K3TA 2Y1DA 3BMOA 4PLPA 3P2YA 2H5LA 1NVMB 3DXFA 4ZU3A 4EUEA 3CINA 1YL6A 4MP8A 3RC1A 3U0BA 4ONEA 1Q0HA 4KUHA 2VRBA 5L40A 2J5QA 5TC4A 3HDQA 3PDJA 3OF2A 4GX5A 2OUIA 3P2OA 4LCEA 2Q1TA 3L0DA 4UVGA 1R4NB 3ETGA 4WLUA 2O3TA 1JAYA 2E49A 2H1SA 1EE2A 2NNLD 2Q2QA 2HUNA 1I01A 1HDGO 3DB2A 4L8VA 3NRCA 4YRAA 3D3WB 1F14A 2R6JA 5B1YA 5IDWA 2P2SA 4E6PA 2CD9A 1NVGA 2Y99A 1C0LA 2OL4A 3K30A 5U4QA 4G81A 4UVDA 1VRWA 1E3LA 4F45A 5B4VA 2G82A 1I32A 4FFOA 4D41A 3NX4A 1ISJA 2R00A 1I0ZA 2HCTA 2Q1SA 4R9SA 1LLQA 4B79A 4PFJA 2CY0A 3E8XA 1C1DB 5ILGA 2XAAA 2PGJA 3LC7O 2RH8A 1P0FA 5AXCA 2PD4A 3ITKA 2CF6A 4L74A 1U8FO 2ET6A 4N5LA 4GKBA 3A1NA 4XB2A 1CYDA 1H93A 3AOEC 1JDJA 2NWQA 3Q11A 3Q0EA 4LRSB 3JQAB 3U4HA 5G2OA 3WTCA 3C24A 1W73A 4NBRA 5AQ1A 1B15A 1YE3A 2HRBA 3CPSA 1YQGA 4HNHA 2EWMA 4IMRA 3TOZA 5L4SA 4IBOA 1DAPA 3BMNB 2AQKA 2C7GA 1IZ9A 1H9BA 4PG5A 3H2ZA 5KWEA 3FPCA 2VRCA 5CG1A 2CVOA 2OP0A 1UXGA 3H5RA 2JCYA 4J43A 1LLCA 2UYYA 4LVUA 3VHRA 3JQCA 1GV1A 2GN6A 3KYDB 5TT0A 3C1OA 1O8CA 2W8ZA 3S8MA 3ZWVA 2QZ9A 4DTIA 1Q1NA 2Y1EA 3NJ8A 3FNGA 1UR5A 5L53A 2VYVD 4DVJA 4IINA 2BMAA 2VTEA 1PWZA 1P1FA 4EI2A 3VAZA 4OOFA 3RQSA 3IKTA 3ICPA 3WWZA 3PDUA 4MVJP 3W8DA 1AHHA 3FRJA 3PJGA 2GSDA 4CMJA 2B4RO 4E5PA 1GZ6A 4ZRNA 1LJ8A 5COBA 4IIUA 5K6AA 1Y5MA 2BD0A 3E9NA 2CDAA 1MUUA 1LRKA 5JC8A 1CWUA 4CV2A 5BSEA 2CVQA 2VT2A 4K1LA 4WJZA 2ZTMA 2IYOA 1XDWA 4RPGA 3SJ7A 4IJVA 1O9BA 1NTOA 4BL5A 1UUFA 1U2GA 2G17A 4GWKA 3NUGA 1H94A 3RUFA 4GX0A 1VLLA 2CNBA 4YYZA 3DBVO 2DPGA 4S3MA 5L9AA 4N7RA 5JDCA 1LU9A 3OHSX 4OXKA 4NU6A 1KIFA 2O4CA 4Y9DA 5BQFA 1P1RA 1ISFA 3JQ9C 3WNVA 5GZ6A 3ZWYA 4EEZA 5GZ3A 1KVTA 3C7AA 5IN5A 2AW5A 1GQ2A 4JQCA 5EJ2A 3I9MA 1Q7BA 1ZEMA 1I3LA 3U09A 1X0VA 1XQ6A 2I3AA 2AHRA 3FNEA 1WXDA 2FSSA 4J1QA 2Y05A 4EBFA 1EFLA 2NQ8A 1ZO8A 1HDOA 3JYQA 3HUDA 3WBFA 5J23A 3LU1A 3TPCA 4BO2A 1NFFA 3AJRA 2A9FA 1P44A 4WPGA 4C7JA 1KC1A 5IXSA 3LF1A 1Y8RA 2P4QA 5HWSA 1O89A 1Y9EA 3AOGA 1LRLA 1DFIA 4YT5A 4XGKA 2FMUA 3OJOA 4RQTA 4J16A 3I52A 2Y1OA 1XLTA 2YJZA 5ES3A 1W0CA 3KOUA 4CMIB 4DBZA 1IY8A 4OKIA 2DKNA 4MVJE 3ORFA 1XHLA 3BHIA 2NADA 2NU9A 3F5SA 5DP1A 1BW9A 3VZSA 1YBAA 3MWDB 3WXBA 1BRMA 5MGBA 1DHTA 3H9EO 1T25A 2UUPA 4OQZA 3ROKA 4RV9A 3UVEA 4HNGA 3JQ7B 4PIVA 2I66A 1GCOA 2NUAA 3B1KA 5DZSA 3H5NA 5KKCA 1B16A 5JLAA 1Q0LA 2J3JA 4UVHA 5G0TA 3L77A 4IY1A 3F4LA 4E32A 4W6ZA 1H6AA 3DHYA 4W9NC 4JJGA 4BUCA 4BV8A 4D79A 1E3IA 5DF1A 1MC4A 3WNQA 2BFPA 3H4VA 4RVGA 1D1SA 3RC2A 2JCVA 2G76A 1PJBA 3DBHB 3JQ6A 4ID9A 2OP1A 4RVDA 1T1RA 3VH3A 3A28A 3JQGB 1YXMA 1HYGA 4H16A 1MA0A 4OIMA 1LSUA 4B8ZA 4TWRA 1PJLA 2VWGA 1HE3A 3TZCA 4B4OA 4DC0A 1DSSG 4M86A 2E48A 1FDUA 3WSVA 4DYDA 5ITWA 3SXPA 3V8BA 1ENYA 1V0JA 2QYSA 1X14A 4TSKA 3IL2A 1TB4A 4YJHA 1PGNA 2VTDA 4IPTA 3CTMA 3NT2A 1N1GA 4PLWA 1ONPA 4URFA 1IE3A 2A4KA 2BGLA 4CM3A 1M6HA 2NACA 1GZ3A 2FSVA 2PK3A 3EGOA 1J0XO 1GU7A 2WJPA 4WEQA 1Q7GA 3WG9A 3DZIA 3EMKA 4CL3A 3LQFA 4ZRMA 3GG2A 1EQUA 1QORA 3OJFA 4CQMA 4E0BA 1K6XA 1RYDA 2X0JA 3K2BA 4BS9A 2AG8A 5JCJD 4RF4A 2PKQP 2FP4A 2GCGA 1C3VA 1HLDA 2GN4A 2J6IA 2E82A 4GX2A 1CF2O 4JX8A 4OMUA 1R0KA 3D1LA 3HHPA 3DOOA 3VPGA 3RVDA 3JCZA 3RC9A 4EJ0A 3HSKA 2HK7A 1HL3A 4XDZA 2J8ZA 4KWIA 2HK9A 1A4UA 4HXYA 1LSJA 4JGBA 5L4NA 4IJKA 1YDEA 1LNQA 4AICA 2NV6A 4WOKA 1QXSA 1YRLA 4ZN6A 3LDHA 3LT1A 1MLDA 3WLEA 4NK4A 4BKOA 4YTEA 4RCVA 3COSA 5JAQA 5BR7A 2YHIA 4WKGA 5CHEA 3NKLA 3S55A 1RM3A 1YL5A 2J3HA 5TSDA 5HA5A 3JYLA 4L4SA 4MP6A 5AXBA 3TSCA 4D46A 5EPOA 4YQYA 4CUZA 2WEKA 3DHEA 1HE4A 1X7GA 3BHJA 1MXHA 1RKXA 2ZIZA 1IB6A 3C1AA 1SO8A 1Z7BA 1SOVA 2FOIA 2IE0A 2HLPA 4M54A 4N54A 3PWZA 4BNWA 3WGQA 1BHSA 4Z3KA 1EK5A 4EEXA 4TZTA 5CEJA 1UXHA 4ZQEA 1IOLA 4HP8A 4PRLA 3ZWBA 1A9ZA 3QLJA 1F06A 2A92A 3OQBA 2NU8A 4BMVA 2JHFA 3WICA 1JQBA 1A27A 1YKFA 2W2KB 4RPKA 2AMFA 1SEVA 4M1QA 4CQLB 1ZVMA 4MKRA 1F17A 3Q1LA 4TVOA 4ALNA 1SEPA 3I9LA 2Q3EA 3U4IA 2GLXA 3I3OA 2Y0DA 4TZKA 2H9IA 5DCWA 1H5QA 1V9LA 3UH1A 5B4TA 4M49A 4HFRA 1EEHA 3DONA 4OM8A 4A03A 4KDFA 1V6AA 2JFGA 1NVTA 1N9GA 3VC7A 1VC2A 2FZEA 2HKIA 3DZGA 3ZWPA 3D5QA 3ZWMA 3ZWCA 3INRA 1QV6A 4L75A 1AXEA 4Q3NA 4YAGA 4IGFA 4HV4A 4CLOB 3TOXA 1JVBA 1SPXA 1GL3A 5H83A 3TZQA 3FNHA 1ULSA 3Q2KA 1E77A 4DPKA 5L51A 2O50A 1JTVA 1OFGA 3KXDA 3ZWNA 1E3WA 4UUOA 4EW6A 2C59A 3VZPA 3O8QB 2VYVA 4PZCA 1ADFA 1A7KA 4NJOA 1C0IA 4WECA 4ZQFA 4RJTA 5T67A 3E82A 4GLOA 2GO1A 4C4OA 3DZKA 3DAPA 3K8ZA 2AE2A 3QV1A 3F46A 4I5EA 3VPXA 1AUPA 3CUKA 4PVDA 1PZFA 4JCOA 4GPD1 5AXAA 1K0UA 4CV1A 9LDBA 4NBTA 4PZDA 4IDEA 4Y6RA 5LDGA 1KOLA 5LCXA 4OOEA 4C7KA 1U9JA 1UDCA 3GC6A 3OETA 3ENKA 5IDYA 2O3QA 1WWKA 3KO8A 5A9TA 5C7OO 3JQBC 3RBXA 1HZZA 4XR9A 4LRTB 2P4HX 1O6ZA 2NM0A 3UAGA 1UXIA 5KJ6A 1HT0A 4A5OA 4B4VA 3KZVA 4QFDA 2WE7A 2TMGA 1MX3A 2Z5LA 1T2FA 1R12A 2VZ0A 3VPSA 3ZWAA 3RU7A 2HMVA 2B36A 1A71A 5B12A 4G5HA 1P1JA 3GZNB 3HFGA 4CM4A 4RVHA 3I9JA 1QMGA 4BIIA 1XG5A 4DUPA 2BFAA 2ZATA 3AUUA 1R15A 2D2IA 2Z1NA 4RF5A 8LDHA 4DXHA 4PLZA 3MJSA 4B3HA 4RZHA 4I5GA 4FFNA 2ZCUA 4B7CA 3WGOA 4BNIA 1I3KA 4A2CA 2O4UX 4U7WA 4F3YA 2YFQA 4AVYA 1ORRA 5AYVA 4J1TA 3GVXA 1I2ZA 5HS4A 2EG9A 1AGNA 2JAHA 4PLYA 3PJDA 2OZPA 5CEFA 5G0UA 1VL6A 1QR6A 5I7VA 5T6BA 3PIIA 1EFKA 3JQ8A 5DOVA 3RAJA 1VI2A 1DC3A 1ML3A 5T5QA 2HDHA 3CEAA 1UZLA 4R4JA 1FJHA 1ZZEA 3U4DA 5A9SA 4R54A 4HFNA 3C7DB 5A3VA 4UUMA 2VHYA 3BIOA 3QJ5A 4UREA 2FPPA 3NAQA 1F12A 3VDQA 1TT5B 3GQVA 3N7UA 4XQCA 2I99A 3ZHBA 5ICMA 1OMOA 1XEAA 1HETA 3FN4A 3QP9A 9LDTA 2HO5A 1ISGA 3HB4X 1LQUA 2E4AA 4NBVA 4YJGA 3EK2A 2G5CA 2AG5A 3VZRA 3N74A 1QYDA 1C0PA 1T4DA 1ISHA 4JN6B 2BRUA 2P5UA 3CE6A 2Z95A 3CZRA 5L95A 3DAFA 1OZAA 5KKAA 3JQ9A 1H2HA 1Z75A 4WLEA 4NFYA 5JAZA 2P9CA 2RH4A 5I8WA 1H2BA 4DBVO 3IP3A 3RBVA 4K26A 2G0TA 4YRDA 2O23A 1PTJA 2GERA 3GEMA 2DBQA 3WFJA 5C3MA 1UP4A 5FEUA 4GGOA 1E5QA 4YBZA 4CM7A 3H9QA 1QRRA 3DFZA 4ZHSA 3L07A 2W2LA 1BXGA 4XEHA 1Y8QA 1I5RA 1PQWA 2LDBA 4FOOA 4Q3DA 3INGA 4YRBA 3KBOA 2HU2A 3UKOA 5AXDA 3RKRA 2EXXA 3A14A 5CDGA 1U7HA 1UP7A 2X0NA 2HJRA 2IODA 1ZMOA 4NNJA 1E7RA 1HF3A 2E37A 2JFHA 2X22A 1L7DA 1GQQA 4XQEA 2DTXA 2ZTLA 3QY9A 5H81A 1YS4A 4IMPA 4Y98A 1E1LA 4CMBA 3CMMA 2X9VA 3DDNA 4FFMA 5JMWA 1WDMA 4YJFA 2RAFA 1T2CA 2VZ9A 3PI7A 3V1TC 3F9IA 2Y68A 1EVJA 1OAAA 4TROA 3WMWA 2WD7B 4PLCA 2IEDA 4XDYA 1C1XA 2DU8A 3FF4A 3DBLA 5JCJA 2BGMA 1CJCA 5JDIA 3IDSA 4LK3A 4O1MA 2DLDA 2IZZA 3ABIA 3X2FA 2DM6A 3LLSA 4L4RA 4W82A 3SC4A 4AJIA 2NTJA 2B5VA 1ZJYA 3DBRB 1HDRA 2VZ8A 1LSOA 4I5FA 1ZK3A 5TQVA 4UEOA 3IUSA 4B7UA 5BNTA 3WQQA 1LTHR 4W9NA 1YJ8A 3M1LA 3WQSB 3RJ5A 2X9NA 4NQZA 2GUGA 3NDRA 4Z9XA 4PN3A 1ENZA 3PHHA 1EMDA 1FDTA 4CM9D 3OJ0A 2VWQA 3EUWA 4I08A 4Y67A 3O38A 5ADHA 1A7AA 4DREA 1Y81A 3RU9A 3ADOA 5C37A 5KJCA 2O2SA 3E5MA 1L1FA 3T4XA 4D3DA 2EEZA 3PJFA 1EVZA 4JP2A 3AI3A 4YXFA 4S1VA 4J9VA 2HMUA 3PGXA 3RKUA 1PZGA 3IIEA 1ADGA 1ZKMA 1E6UA 3JV7A 1J49A 4CQMD 5KTKA 3CKYA 4OL9A 1WLYA 3BMCA 4DPLA 4CMHA 3LZ6A 1ID1A 4JBGA 1UXJA 2EJVA 4U5QA 5DP2A 4KP7A 4DQUA 1GTMA 2IRWA 5IJZA 4NFSA 5IZCC 3INTA 4GAEA 4DIFA 1Y6JA 4MIYA 1RPNA 1EDZA 1T2AA 3R6DA 5TRTA 4CM8B 1JN0A 4EYEA 3BA1A 4R69A 4XQGA 5ENVA 1DRUA 3E18A 2VQ3A 2ZQYA 5THQA 3GFBA 5LC1A 3U9LA 1E1MA 2NVWA 5A5EA 1PJ2A 1KYQA 1M75A 3BTSA 4QO8A 2EJWA 4J7XA 1YDWA 4B3JA 5HRUA 2B69A 4GSLA 2VNAA 3DL2A 5TX7A 1WDLA 3RUDA 4BOYA 4Q3CA 3GGPA 1GDHA 2I6TA 1JAXA 3PPIA 1E92A 4AJPA 4CMKA 1LQTA 2BLLA 2X5KO 3OJLA 1NQ5A 4I5DA 4WCFA 4DMLA 4IJUA 2W4QA 1VJ1A 1MG0A 4PGFA 3BZUA 4P22A 1NWHA 4XJSA 1UP6A 4JJFA 4XIYA 4GKVA 4L76A 3SVTA 2D1YA 2RHRA 1G0OA 1MGOA 2HMSA 1I8TA 4FCCA 1DLJA 4FPXA 4IDAA 3BTVA 4BQPA 1GEEA 1NM5A 4CMAA 4CM5A 4YPOA 4NFHA 5TGDA 1UDAA 3UXYA 2J3KA 1R66A 2JL1A 3ZU4A 3GN2A 4AFNA 2O7QA 5EL0A 1LDGA 3GPDG 3QVOA 2IZ1A 4KTVE 1D7OA 3MOGA 3PHGA 1DIRA 4O59O 1BSVA 1PZHA 3G1TA 5DN9A 5FYDA 3TDKA 2B37A 5JPIA 4Q9NA 1P9LA 4BO9A 3OA0A 4E2XA 1PGJA 2BELA 2Y1CA 3T7EA 4G65A 4CLRB 4R1UA 4OXNA 2PTGA 2ZYAA 4BMSA 4AJ1A 5L45A 4EJMA 2XPCA 1E7YA 1WZIA 1IHYA 2B4QA 4HWKA 5I7SA 3BTOA 4NJMA 1K89A 3FI9A 2FRDA 5IFLA 2QYTA 1XGKA 2YZ7A 3KLMX 4AJ2A 3GDGA 3F47A 3RFVA 3RJ9A 2Q46A 1F8GA 3UHAA 5F1KA 2FR8A 3V2HA 2R2GA 1GPJA 4KQXA 3ZWWA 4R5MA 4CLHA 4XYEA 4QUKA 3KETA 4FFPA 4IQGA 4INAA 2PKQO 2POQX 3ZHZA 1DC4A 5GMOA 2O48X 4ZA2A 3G3EA 2FZWA 4W4TA 1WP4A 1WPQA 1K2WA 1R6DA 5IF3A 2O3RA 2NSDA 5JCXA 3E9MA 4Y8VA 3I4FA 2EKPA 4BO8A 1ZSYA 2BFOA 3AUTA 1ADBA 4XB1A 1ZFNA 2PD6A 2YDYA 4NH4A 4DWVA 3TL2A 4UVEA 4ZJUA 3LT4A 1F8FA 1NPTO 2C20A 5L7TA 4D45A 1ENPA 3RROA 5AVOA 3KSUA 4I8XA 4MVJF 4P38A 3GN1A 2D5AA 4BNJA 1BDMA 3PJEA 4IUYA 1HDXA 2B35A 3STHA 5DCYA 3V1UA 1GY8A 1LA2A 3ZHXA 4BGEA 3L6OO 2PZJA 3FWZA 1FDSA 4Y6PA 3NGXA 4J1NA 4OQYA 1B7GO 2RIRA 1LUAA 2IDZA 4WNCA 3NGLA 2YY7A 3RSHA 4E5KA 1R4NA 2GASA 5L7YA 1X1EA 1DFGA 2YW9A 4IGEA 2PA3A 2AQIA 4Y6SA 5A05A 3VTFA 3VKVA 4DIBA 4BKRA 2AEJA 1KETA 4BO6A 1EBFA 2W90A 3WSWA 3KRTA 4LW8A 2X1HA 5T64A 2PZMA 3QVWA 5JY6A 3I1JA 3JQBA 3ZNNA 3OECA 4I1IA 3ZW9A 3OBBA 1OI7A 4BNHA 5JAMA 4CM1A 3VH1A 4XYBA 3ENNA 4HY3A 1B8VA 4RQUA 3TF5A 4ZQHA 3RUAA 2C2XA 1JWAB 2AQ8A 4J2HA 2VN8A 5FI5A 4D42A 3TZHA 3OIDA 3GFGA 4JNKA 5IDQA 1LBEA 2VWPA 1C1DA 3F1LA 1DC5A 4A0SA 5C7LO 3OA2A 2EKQA 1CDOA 2UUOA 4EJ6A 5JO9A 4NHEA 3O26A 4FBGA 2HAEA 1VKOA 3KYCB 4N18A 4UEKA 1UZMA 3JQAA 3WS7A 1PS8A 1HE5A 3QWFA 1I30A 3DMTC 3K92A 4BQRA 3HADA 4IQ0A 1VJTA 4NPCA 3WFIA 3UFXA 4N5MA 2CZCA 3BMNA 1GUZA 3WR5A 3V2GA 4P4NA 2ZTUA 3HZZA 3AI2A 1UAYA 1BVRA 3GMDA 3KYDA 3ZU2A 4CR6A 1HTBA 2PY6A 2Y1FA 3X2EA 1LI4A 3WGYA 6LDHA 4QT0A 1PGPA 3EVNA 1TXGA 3WBBA 2ZYGA 3ANMA 2EW2A 3WYCA 1K6JA 5G4KB 1P0CA 4ND3A 3BMQB 2D5CA 2CF5A 4YDRA 4CR7A 1BVUA 5KOIA 4PLGA 3RUIA 1DXYA 2NTNA 2PNFA 3HQ4O 1K5HA 1NR1A 2ZB8A 4CV0A 4MINA 1PQPA 3H3JA 4W99A 4CMIA 5ICSA 3HB5X 3PQFA 5C5IA 3E48A 3KM0A 1CERA 4PVCA 4XRRA 5A9RA 2QRLA 4ZVVA 3GEGA 1CQIA 1GAEO 1KVSA 4KUEA 4L9RA 4RF2A 4TMFA 4CMGA 4EUFA 4XQ9A 1F0YA 4CMEA 3I9OA 4BNYA 1T24A 2DTEA 5A04A 3S2EA 2W2LD 4GQAA 1NQAO 4IXTA 1BXKA 3ZZNA 1Y7TA 4DLLA 1EQ2A 3OIFA 4ZQGA 3WYBA 4YT8A 4QFCA 1IULA 3QE3A 4BNLA 4GVXA 2YV2A 3IS3A 3K31A 4CM9A 4IZIA 4YCAA 3VH4A 1CRWG 2C0CA 4J1SA 5T8KC 3JD0A 1HZJA 5ER9A 1V3VA 1CQJA 2BGKA 3TWOA 1IZ0A 1NPYA 2EW8A 2RBEA 4ITUA 2P9EA 1SOWA 4NK5A 3ZV5A 1PGOA 3HN7A 3UN1A 3PYLA 4LMRA 3LT2A 3WJ7A 3I6IA 1LDNA 1Z82A 3AU9A 4LGVA 4DA9A 1C0KA 3K2EA 2W98A 2EHDA 4E12A 2ZJ0A 3N58A 3V2UA 1S7CA 3DZBA 3IP1A 3PP8A 2DFVA 4L4XA 3W1VA 3AW9A 4LSMA 1KERA 1UXKA 4WK6A 1KY5A 1YGYA 2JD0A 2BKAA 2G1UA 3L9WA 3BYZA 1UAGA 5DOZA 3LLVA 1H6BA 2JCXA 1MC5A 1T2EA 3BXXA 1KBZA 4QECA 1OOEA 4GX1A 3VH2A 1E3SA 4BHTA 3HJAA 4RPHA 3GUYA 4QQRA 1N8KA 1Z7EA 3WIDA 3PHJA 1VJ0A 2VOEA 1FMCA 5EQFA 2GDZA 3FCOA 5FFFA 2AXQA 3GRPA 3IQDB 3ZCXA 4XYGA 4CUJA 3ZWXA 2O3JA 3KV3O 1LX6A 3ZV6A 1QG6A 1QLJA 2OMEA 1JLLA 2QX7A 2RCYA 1SBYA 3GVCA 4II3A 3HWRA 1ONNA 4NG5A 5A4DA 3S1LA 4DRYA 1AN9A 3JQ7A 3SX2A 2ZCVA 3RUHA 4OKNA 1HE2A 1LRJA 1E7QA 2WYWA 1BDBA 3ADPA 1U3TA 4CR8A 3NYWA 2X8LA 3IUPA 1EBUA 4YA6A 1SCUA 3QWAA 1T4BA 1PJSA 5BNFA 2FR0A 1GYQA 3JQFA 2PH5A 3DAGA 4U8GA 1I24A 5A5FA 2J5RA 4H15A 3AM5A 2ZK7A 3DBHA 3WJAA 4TVBA 1MFPA 2PKRA 3JQGA 1U3UA 1B14A 4B7XA 3QRWA 1YOVB 3AWDA 2D8AA 4M55A 2GZ2A 2UDPA 2R00C 3VTZA 1R4MB 3RBZA 3ZU3A 1NNUA 3ZHYA 1N92A 1X13A 3KTDA 1XA0A 1Z45A 4NR0A 4MKXA 2ILTA 1DLIA 3UF0A 3NV9A 3LYLA 5GZ1A 3PYXA 1DRVA 4R3WA 1HDCA 4K6FA 3TFOA 1SNYA 2H6EA 5FI3A 1IUKA 3S2IA 1DB3A 3TL3A 3F3SA 3QW2A 4WLNA 1E1NA 4BO3A 3PWKA 2CDCA 3K96A 4BNMA 1MP0A 3AI1A 1KEPA 1DIGA 1HEUA 4XGNA 1NX6A 3AFMA 2EGGA 3GHYA 3TNLA 3QVTA 3TZ6A 4BNKA 5A02A 3QQPA 3HDJA 3E9QA 4YAIA 1IL0A 2QHXA 1JA9A 3GG9A 2PGDA 4XD2A 4FC7A 1B0AA 2QG4A 4HX5A 2QIOA 4BV9A 3GMSA 5F3RA 4BB5A 5KNLA 1I3MA 3GH3A 1U5CA 4U0JA 1DIBA 4UEJA 3UICA 4F6LA 1R16A 4FD3A 2B5WA 4K9DA 1P1HA 2I76A 4FGSA 5DT9A 1DRWA 3G49A 3AFNA 3AOEA 3MEQA 2A94A 1JU9A 4YVFA 4I9HA 1TLTA 3NTQA 4ND1A 4FR5A 3GNTA 1H6DA 2D59A 1Z6ZA 2Q1UA 5K6AC 1GFSA 3TJRA 1T1SA 3WDSA 3QA9A 4PG8A 4ALLA 3WGIA 5KVCA 3EYWA 1NQOA 3ZN2A 3EHEA 5TF4A 3EDMA 1VPDA 2C2YA 4II2A 3QHAA 4JIGA 4TRNA 3M2PA 1IHXA 4E2ZA 1X7DA 4WCDA 1WMAA 3H5AA 3NT4A 2AEFA 5JYDA 3PQDA 4PG7A 5JDCC 3TN7A 4CMCA 2I67A 4R68A 2W2KA 1DPGA 1Y9AA 4BO1A 4CQLA 4PLFA 1DDOA 2VUUA 1SB8A 4DL9A 1VE9A 1NPDA 3GVPA 4NBWA 2GR9A 4E30A 2DC1A 3PHLA 2OGUA 1NHWA 3L4SO 2V7PA 4GLLA 4MP3A 4GMFA 1ZXLA 1GZ4A 3EVTA 4KMSA 4KTTE 4AL4A 1OC4A 4QTZA 3PZRA 5FF9A 4WEOA 3B6ZA 3I83A 3DZFA 3KYBA 3VZQA 5EINA 3MJ4A 3E1KA 1QLHA 1EVYA 3VOSA 3UOGA 4WNIA 3QVXA 4TRRA 1IPEA 3D64A 3PFWO 1I33A 1RWBA 1HXHA 1OC2A 4MO2A 4OYRA 4DQXA 3OMLA 3W6UA 2VCYA 4R01A 4YEDA 1VKNA 3GDOA 2I5PO 2VHZA 4CLXA 1E6EA 3PXXA 1N2SA 3O8QA 2NU6A 4AJLA 5U1PA 1HYEA 2CDBA 4GMGA 3VKUA 1H9AA 3VVBA 4E33A 1B3RA 3DC2A 3GAZA 1P3DA 4DC1A 4E2WA 2UV8A 3HE3A 1A4IA 3JQEA 3JQAD 4ZICA 3RD5A 1WDKA 3CMCO 1MG5A 4E5MA 1M76A 4FN4A 2EP5A 2BH9A 5JY1A 2ZB4A 4NI5A 3JYOA 3BMCB 5JYEA 3OH8A 2JD1A 2PZKA 8ADHA 2HJSA 1H0KA 3UGKA 4KQWA 3DMTA 3TZKA 2P9GA 3MCVA 3D4PA 4RDHA 3EW7A 5I7EA 2NVUB 4PCVA 1L7EA 2VUTA 4NMHA 4ND4A 4BGIA 4O63O 1RYEA 1T26A 4YT2A 1I2BA 2F1KA 3GNQA 1GYPA 2BI7A 2Q4EA 2JKVA 2EGHA 3FHLA 3OSUA 5KCZA 1WNTA 3K9QO 4P4LA 5I8ZA 4AG3A 3PZBA 5TLSA 4XYLA 3U49A 1U2DA 3GF4A 3W4IA 3BMOB 4FGWA 4NU5A 4ALIA 4RVUA 2JAPA 3DMYA 3OFSA 3H9JA 4H3VA 3DO5A 4ND5A 4JLWA 4OO3A 1PL6A 3TFQA 4RZIA 4BO4A 2D4AA 3ROQA 4IS3A 3ITDA 1U4OA 4YQZA 1GQYA 3ZNOA 2D3TA 2EP7A 5F21A 3D0OA 2HRZA 3ZU5A 2CMDA 3DOCA 5K0ZA 3ZH2A 4CODB 4W7IA 2FR1A 1UH5A 2Y66A 1U7TA 2HQ1A 1XQ1A 2WYVA 4J4TA 4MVJI 5BSFA 3NT5A 4J2OA 2ZQZA 3JD1A 4TRJA 1QYXA 2OFPA 1HDYA 4BNVA 2OXIA 5DULA 5IXYA 4O0LA 7ADHA 2GNAA 2VYNA 5CPBA 3FBGA 4HFJA 4Q39A 4FFLA 1LEHA 3BTUA 4XGIA 1TT5A 3C8MA 4JK3A 1A72A 4A73A 3I9NA 2JFFA 5TJ9A 4D44A 4UUNA 3SLGA 1EZ4A 3RI3A 4BKPA 3GA0A 3NJ4A 1GR0A 1JKIA 4BVAA 1ZXBA 4BKQA 1ZW1A 2I3GA 1D3AA 2IYPA 1PU2A 5CEEA 1HLPA 5KJFA 4R5HA 3MWEB 4B4WA 4XRGA 3GLQA 3GVHA 1ZK1A 3PLRA 4J91A 1D4FA 2OO5A 1W6UA 1Z73A 3Q3CA 2X86A 4XYMA 4J0EA 5CDTA 4ALMA 1U8XX 3WGTA 4W7HA 3KHUA 3Q2IA 5L3ZA 4RDIA 2RHCA 4IQ8A 3W8FA 1PS9A 6ADHA 4UAGA 1FDVA 2ZJ1A 4GVLA 4RO0A 5CG2A 4NZ9A 5EMHA 1XWFA 1K6IA 4BNGA 3K6JA 4EDFA 3NDJA 1DHRA 3KEOA 2WE8A 4NIMA 3AUAA 1ZK2A 2DAPA 3GOHA 1TT7A 3H65A 4P8RA 4ZQBA 3LF2A 2DUUA 1DO8A 5ILOA 2C5AA 5BSGA 5KJ1A 2HSDA 4E5NA 4FJ1A 3NEPX 2BF7A 3NDIA 4FC6A 4J0FA 1VSUA 4WLOA 2C54A 1DJNA 3P5SA 1UDBA 3DZHA 4A27A 1U5AA 1A5ZA 1P1IA 2FWMX 4M87A 4ILKA 4O5OA 2WD7A 3PHIA 5JXWA 1GD1O 4BKUA 1P74A 3R1IA 2FN7A 5JO0A 2EF1A 2BHLA 4OHUA 5G0VA 4ND2A 4FQ8A 1NAIA 2ZKLA 4E13A 1ZUD1 3QIVA 5IN4A 1D8AA 2LDXA 4DLBA 4F6CA 3F6YA 3I5MA 3DBRA 4TKMA 4LMPA 3IOYA 4HBGA 3RIHA 3IJRA 2Q2WA 4X54A 4K6CA 3GDFA 4AJ4A 2WSBA 4J4BA 4CL8A 5U9CA 4RLHA 1FF9A 1U3WA 3HNPA 1B8PA 1FXSA 2DBRA 4Q3EA 2AA3A 4B4UA 3A06A 3C1TA 3R3JA 1B8UA 4WLFA 3DOJA 4RPJA 4XCVA 4Z0TA 3RUEA 3CIFA 2XXJA 2WYUA 2BI8A 3VPHA 3AM4A 3NTOA 1YVEI 3H9UA 3GGGA 1N7GA 2GRAA 4FOSA 4U6QA 1AHIA 3GPIA 4FIZA 1XYGA 2P5YA 5ITVA 4KOAA 1DOHA 3DQPA 3Q9NA 4RVSA 1YO6A 4E21A 2H63A 4FW8A 3OM9A 2X5JO 5I9MA 4HKTA 5DDIP 5G0WA 3ZNQA 4DQVA 5HTOA 4PZEA 1XU7A 2F00A 3L4BC 1YB1A 5IAAA 3QVSA 3M2TA 1R37A 3OIGA 1SZJG 4CM8A 1MXFA 5BT9A 4GH5A 4RL6A 3U62A 1QSGA 1HSZA 1I36A 1IPFA 2EERA 3GAFA 1NXQA 5IG2A 4IDFA 3IMFA 2B4TO 4U0KA 1PJ4A 3WGHA 3LK7A 2P91A 5DNAA 1NR7A 3B1JA 5F1OA 1X7HA 1XKQA 1Y8RB 3A4VA 1AXGA 5MDHA 3JD4A 4LSWA 3G0OA 1U1IA 4IXWA 3W4KA 1Q7CA 1LLUA 2IXBA 1HRDA 1NFQA 2PGLA 2NVBA 4IDBA 1ZK0A 2AE1A 3WYEA 2WMDA 2YDXA 4WASA 1YB4A 3EY4A 1E5LA 4YACA 1BW9B 1PIWA 4ZD6A 4AJOA 3RCBA 3ROPA 1HSOA 1LLDA 3FTPA 5FWNA 3D3WA 4IDGA 2J3IA 3ZV4A 1LDBA 4LCJA 5H82A 4AJEA 4DIOA 1DIAA 2FHSA 2GPTA 2Q4BA 2OHXA 4YB8A 5IDXA 3OEWA 5KVSA 4EITA 2WWRA 3FD8A 1ARZA 5L7WA 1UZNA 1ZSVA 4XIJA 4D3SA 4CV3A 3TRIA 3C3XA 2PFGA 1KEVA 3LT0A 4YAEA 4J6FA 3W4JA 4TQGA 3V1YA 1EVIA 3RFXA 3PEFA 3SBOA 2Y0EA 4CLRA 2CSUA 1EUDA 4KZPA 3ICCA 3SLKA 3VVCA 3KEQA 5L4LA 4DGSA 4J9UE 4RLSA 1NASA 1M2WA 1EK6A 2QW8A 5B37A 4AJHA 3GZ4A 1LXCA 1R0LA 2GYYA 1YJQA 3ONEA 4JROA 4YJHB 1VL8A 2O3UA 3I4CA 4MVJA 3OQ1A 5COAA 3L6EA 5AOVA 4F46A 2PLAA 4J3FA 2A35A 3FWNA 2Q99A 1KEUA 1U28A 2X0IA 3KSZO 4XWYA 3WB9A 2QZZA 4L0QA 5JS6A 3C85A 3DHNA 5HS6A 4CQMB 1TEHA 3SC6A 5JNLA 2E6UX 2DBVO 3PK0A 4M8SA 3JTMA 2J5KA 4FJ2A 3MJTA 1E6WA 1RM0A 3ASUA 3DTTA 3I9KA 3WLFA 2B83A 2Y67A 3JD3A 1W4ZA 3OICA 1AE1A 3U4CA 3NTRA 1TI7A 1KC3A 4DPMA 5JMPA 1DJQA 1P33A 2PZLA 5ER6A 3WOHA 1SAYA 1NHGA 3B70A 2X5OA 3FR8A 4J49A 5I9NA 4J7CA 4YAJA 4ESOA 1QKIA 2Q2VA 2GZ3A 5GY7A 1UJMA 3PTZA 3PWSA 4FFRA 5EQDA 4Z9FA 1E7WA 4BNTA 2YHIB 4QX6A 1O5IA 2VUSA 4B3IA 1D1TA 4UVIA 1P1KA 3P7MA 1GUFA 3ZWOA 2FPIA 5JDIC 3JSAA 2QRKA 4BB6A 1EUCA 5ENDA 1WVGA 2CVZA 1U4SA 1JWBB 4RORA 4D43A 4PRKA 4M89A 4XJTA 1EE9A 2X9GA 4BNNA 4BNZA 5A3JA 3H8VA 1M67A 4MVJH 1PL7A 1SMKA 2DVMA 3F5QA 1ULUA 5BNIA 1DEHA 2Y0CA 3K5PA 1XU9A 4JBHA 3G17A 3RFTA 2PWZA 1WAMA 1ZBQA 4BGUA 1PS0A 2OOSA 4BGVA 3T7CA 1I3NA 4BO0A 4A10A 3O03A 2XF8A 4Z0PA 2Q1WA 3H2SA 2DTDA 4JP3A 4WLVA 4BO7A 1PJCA 1QYVA 1ZMTA 1GYRA 1PQUA 4TKLA 1HKUA 4OH1A 1E7SA 2C29D 1XSEA 5KJEA 4FSHA 1VL0A 3KYCA 3ON5A 4IZHA 3LC2O 4R1NA 1XR3A 1E1KA 3WWYA 1QP8A 3B20A 1EDOA 1N9GB 1ZSNA 4R51A 5CFZA 2QRJA 3QWIA 1PJQA 1E0DA 1B2LA 1DIHA 2EKLA 4OSOA 1J5PA 2VYND 5K9ZA 1ADCA 2V6BA 3WQRA 2OBNA 4DMMA 2Q50A 1V3TA 4B8WA 2NTVA 3GEDA 3JD2A 4XA8A 3RASA 4WOJA 3C7CB 1NWCA 4YR9A 1PL8A 4U6SA 3L6DA 1O0SA 2I9PA 5A1TA 1ONOA 2IZ0A 1VM6A 3ZI0A 1WW8A 1E3WB 1KY4A 3PYMA 1NBOA 2X4GA 1YWGO 2GN8A 3WGZA 1U3VA 5G4KA 4QXMA 3BMQA 5HBRA 4R41A 1PWXA 4MDHA 2ZTVA 1RM5A 2XOXA 3EZYA 4WCFC 5EN4A 1P45A 3B1FA 1P31A 3AU8A 1V3UA 3ONDA 3LSYA 3A9WA 4PLTA 4XZ3A 3SJUA 5JSFA 1DFHA 2UVDA 3UW3A 2GF2A 3CH6A 5JFOA 1X1TA 3CZMA 5JAIA 1BWSA 2DPHA 3ROMA 1I10A 2BFMA 2HMTA 3RC7A 3U3XA 5CDSA 5IZCA 5I9LA 3ULKA 1OBFO 1GADO 2WDZA 2HK8A 3P19A 3QSGA 4P4GA 1QV7A 3EZLA 2YQ4A 3PVZA 1DC6A 2WTBA 3R3SA 5TNXA 3V5NA 4E5YA 3FR7A 2WD8A 3FPLA 4H7PA 4UUPA 4MPDA 4A7PA 2CFCA 3UUWA 3S2GA 2YFHA 1XIVA 4CM4B 5DBFA 1N5DA 1LDYA 1Y5RA 2C5EA 2DBZA 1JW9B 1P77A 1X0XA 3KVOA 3H7AA 4R3NA 2VHWA 1YQDA 1RM4A 3K73O 4HFMA 4R1SA 2D0IA 4E2YA 2DUWA 4D0SA 5BSHA 1TA4A 3ANLA 5JW6A 1KVRA 1PJ3A 4XR4A 1BGVA 3PLNA 3L9XA 3QWHA 3MZ0A 2YUTA 3TQHA 4Z6KA 4D0RA 3MJVA 2GD1O 2PR2A 4A26A 3JYNA 4YT4A 3G1UA 4XX0A 5KVVA 1CEQA 2VWHA 4MIOA 4L73A 3ZW8A 2VOJA 1Q0QA 1GUYA 1O94A 3DEYX 3JQ8B 1W8DA 2X58A 5C7IO 1KVQA 5A9SB 1B26A 3IKVA 2VT3A 1YONA 3ZV3A 2GZ1A 3VPFA 4KWHA 1E7MA 1GPDG 1XCBA 3OQ6A 3OEYA 1ZCJA 4LISA 1XELA 3R0IA 4E4YA 3D3EA 1LDEA 4FDAA 3Q6IA 1VSVA 2TMDA 3ZNPA 3ANNA 5JBIA 1NP3A 1PR3A 3E03A 5HM8A 3E6AA 4YJGB 1NAHA 1IYZA 4DYVA 1DBVO 3OP4A 4RPLA 4LN1A 1Z74A 2O3SA 1PJTA 4N5NA 3MOIA 3IJPA 2NU7A 3KUXA 1GEGA 3GR6A 3FTNA 3ZGYA 4ALJA 3BHMA 3EAGA 4D7AA 3MJEA 4HADA 5K1SA 3D4OA 3GNSA 4R9RA 4AJJA 4RF3A 1ISIA 4R16A 3FBTA 5A06A 3Q9UA 3GY0A 4JJIA 3PGJA 3UCFA 2Y93A 2V65A 1ENOA 1ZJZA 3AY6A 3L4BA 4QSMA 2SCUA 1NFRA 4PLVA 1PSDA 2VHXA 3GUCA 4OXYA 4Q3BA 4YJDA 3AY3A 4BMNA 2Q49A 3GT0A 3UCXA 4J90A 2EV9A 1HWYA 3GVIA 1BXGB 3PIDA 4CPDA 1Y8QB 5I7FA 1G0NA 3MTGA 1QYCA 2VRCD 3MJCA 4FJ0A 1YBVA 3GK3A 3HG7A 1JKJA 1PX0A 1YOVA 1E3EA 1PEDA 1R4MA 3AK4A 2OORA 3F1KA 3H9GA 1LDMA 4J7UA 3GHHA 1LSSA 4GBJA 4HUJA 4QEDA 5DCUA 2Z1MA 5IZ4A 4YJFB 1J4AA 3CSDA 2P68A 4ROSA 4EZBA 1JKFA 5CAEA 5F5LA 1G6KA 5T57A 1KEWA 2NQTA 1C1XB 3RUCA 3BAZA 3U5TA 1S6YA 3DBLB 5EIOA 5TJHA 4TRMA 2O2YA 3DR3A 1M66A 2PV7A 2YV1A 3JQDA 1KS9A 1PGQA 4CLOA 1NYTA 5COQA 3M1AA 4WE3A 2X0RA 2Y1GA 4BNXA 3WMXA 3H6KA 3AM3A 1ZH8A 4R1TA 3UCEA 4ALKA 5TS3A 3OJEA 3F4BA 7MDHA 1MB4A 3E5RA 5DBGA 4CM6A 3WTBA 3AUSA 2ZYDA 5LDHA 4GWGA 4K28A 1QYWA 1EUZA 1TVEA 3KLPX 1BXZA 2X23A 3GGOA 4PLHA 1J6UA 3KSDO 4CLDA 2O7SA 3LVFO 4RVFA 4MVJD 4FB5A 4MKZA 2C07A 1ZK4A 3DZJA 4PG6A 4KDEA 4YAKA 4WUVA 4YWJA 4BNFA 1E3JA 4IJWA 4MJLA 4MVJG 4OAQA 4I9UA 5TT1A 1M6WA 1FDWA 1DAOA 3IC5A 2VHVA 2XXBA 5A03A 5G4LA 2JHGA 2X7HA 2YHUA 2DFDA 1T2DA 2EIHA 1N7HA 3QWBA 4LVCA 4BO5A 4OGWA 5CDYA 4CMEC 3HFSA 3SEFA 1ISMA 5JC1A 1G1AA 2YV3A 1O95A 4FS3A 3PFFA 3HDHA 1A9YA 1KVUA 5EERA 3AY7A 3GZNA 3LC1O 4GI2A 4IDDA 3I6QA 1YQXA 1Y1PA 4JBIA 3O4RA 4PG4A 3WIEA 1CIVA 2I65A 3H3FA 1C14A 5THKA 3MTJA 2GN9A 4IIVA 4NDNE 3KB6A 5G0SA 3ZDFA 5EESA 4ZGWA 4IS2A 5CDUA 4JXKA 4MVJM 3GRKA 1LC3A 4I9NA 1WZEA 4WCFB 1V35A 1YBMA 3RWBA 3S2FA 3G79A 5JE8A 2UAGA 3DTYA 1BMDA 5B4UA 1PR9A 1MV8A 5CPFA 2AEMA 4MOWA 1LC0A 3I23A 3M6IA 4OSPA 3HDYA 1Q2XA 4GSKA 2DQ4A 2NLOA 1R0SA 2C82A 3JYPA 2X6TA 4Z9YA 4KUGA 1ZNQO 2C7VA 1HDZA 2YYYA 1WMBA 3ONFA 4GL4A 4D3FA 2FPGA 1X15A 4EUHA 2AQHA 4EGFA 5F5NA 4O6VA 3HN2A 1FK8A 4RGBA 1GV0A 3EC7A 3WX0A 5T8KA 3W8EA 4CUKA 1ZEJA 1SC6A 3VDRA 3ETDA 4E3ZA 4J4HA 1I2CA 1V8BA 1BTOA 4AJNA 1HYHA 2OBYA 3T4EA
chains in the Genus database with same CATH superfamily
2FQQA 1N1EA 2GN0A 4JITA 2O0LA 1WPXA 3V00A 4GICA 1Z6YA 5LZ7A 4ND7A 1JGTA 3I8OA 3FSRA 5BURA 4CLEA 4EF4A 1DBRA 3T7TA 3DWFA 4NBUA 5B58T 2A9PA 1TU4A 1YD7A 3TQFA 1BH2A 1H4VB 2P79A 2CW5A 2QNRA 1XMXA 1QIKA 2ZUVA 4QL3A 4IV0A 4TKVA 2FZVA 4Y2YA 3VR0A 1NQTA 1XZCA 1XB2A 3JXEA 5DIZA 3FNFA 1CZLA 1SVMA 4JOSA 2N1MA 1DWQA 1PFGA 1H8HD 5IAEA 2PLNA 2A78A 2W6JD 4E09A 1FUUA 4E31A 5LXTB 4X66B 3OZFA 1CKEA 5JAUA 4OREX 1OXBB 2JFUA 2R4TA 1Z8NA 3AHHA 1F1BA 4OLJA 1MR3F 2J9XB 3ZWDA 1V95A 2KWIA 2ERYA 2XTZA 2JJYA 3D7LA 3H6HA 4MIEA 4JI8B 4HEJA 4LHEA 5BSMA 5EZYF 3A1TA 4CU2A 4DDTA 2FY8A 3T95A 4DE5A 4BUJA 2IV3A 4AMBA 2IOFK 2ZB7A 4Z0HO 2HMWA 2ATCA 3KUKA 4BJHB 1SURA 4YUAA 3FFWA 3E9CA 2V6FA 1QR2A 1ZGCA 2C3UA 2HB6A 3C43A 3D5TA 4LKRA 4OJQA 3RIYA 3WGGA 5AT1A 1BG6A 1GCUA 1K3TA 3CY6A 1HC7A 5FO1A 1XWIA 2UZ4A 2X13A 4PLPA 3H2KA 5HPYB 2H0AA 2LR0A 1QO9A 3KFXA 4M37A 4RE5A 5JVDB 4JJKA 4KSBA 1NNLA 3K2IA 3QX9A 5BSUA 3U0BA 3EEFA 1Q0HA 1RYMA 3WP1B 4AD8A 5B7PA 5L40A 4FXPA 3WGJA 3O8LA 5C8YB 5I8PA 4FLFA 4GX5A 4YDHB 4E88A 2V7TA 5G1OA 4ENQA 4EARA 1NA5A 4IMJB 4J0IA 4MS3B 2R6R1 4LCEA 1TVMA 1DAHA 4X84A 1HR0B 1UCFA 4D6YA 2VDWA 1G17A 3PGA1 3GLTA 2Z6UA 4YR7A 1HDGO 3JASB 4I50A 4TQAA 4L8VA 1ZC3A 3EZNA 4R83A 3D3WB 4DW8A 2P2SA 4BLQA 3V55A 5FNVF 3V4PB 1AS2A 2Y99A 4HOYA 1V7CA 2J6BA 3RIGA 5JQGB 5KOJA 4FWTA 5ALIA 5CM2Z 4D8TA 4FI3F 1RCFA 2I1LA 3HUFA 3K30A 4PZPA 4QDOA 4G81A 1FX1A 4UVDA 1E3LA 3A7DA 4F45A 1X7XB 1VCNA 1NJ6A 2EZ9A 1V7PC 2QJTA 3IAS6 4AMUA 5LJLA 2G82A 1RWNA 4DQLA 4E1BA 2PHZA 4QOJA 1U9ZA 3G2MA 4KBGA 4BVLA 4YROA 4EA6A 2Q1SA 2Z2KA 1FFAA 4O2RA 4XFJA 1EQAA 2CNWD 3QEJA 4XLLA 2CY0A 1C1DB 3FSGD 4MROA 4EA7A 2PGJA 3QU2A 5IYZF 4BB0A 4PYNA 1A9XB 4NZNA 3KTAA 4WN3A 1P0FA 4E7PA 2Q6IA 3O94A 1E1DA 1IUPA 4DDKA 1VG9B 3WBJA 1FUYB 1RAHA 2H1CA 1BVYF 1GAXA 1A3CA 5JANA 3N75A 4L74A 2GAJA 3OLYA 4N5LA 4GKBA 2WF5A 3HSSA 1CYDA 4XB2A 4DMCA 4UFNA 1JHZA 3Q0EA 4LRSB 2DQSA 2C9OA 1GTG1 4MV8A 3JQAB 3ZR4B 5LP6B 1IM8A 4Q7MB 2YIMA 3IRUA 4NBRA 1SD2A 2HRBA 5AI9A 3VNVA 1AHNA 1YQGA 2RAUA 4KE8A 3S1AA 2FKNA 2NO1A 3DT6A 2XW6A 3CC8A 3DM9B 2XGSA 2BF4A 2OK7A 4IBOA 2L2QA 4O2AF 5H1YA 4AN1A 4UM9B 4QFBA 4RS4A 1O97D 1P61B 2YZ2A 3H2ZA 4PG5A 4CEJB 1KQNA 2P6OA 3EGWA 2VRCA 1BFKA 3BL8A 4C4XA 4CIYA 2CVOA 5ICCA 2GFIA 2FZ5A 4WKCA 1L9KA 1FJXA 1PR4A 3C3MA 4J43A 3T1TA 3ZE2B 4EB0A 2OD9A 1LPAB 2O0HA 3KYDB 1QGUB 2WPNA 2FEWB 1A9TA 4CHTA 2ZAYA 1N78A 1E6CA 2HJVA 1T9HA 3BL6A 3AVUA 3LX8A 1Q1NA 1I2MA 2Y1EA 3FNGA 3ESZA 2WG2A 2QT9A 4DABA 5LP1A 2IYQA 5L53A 1C8LA 1U0LA 2C5FA 2WB4A 2HREA 4DVJA 1XOIA 3H2GA 4DJ5X 1P9WA 4BJ3A 4W8HA 2NPOA 2XNJA 4L02A 2OCAA 1GIAA 1PWZA 2IHVA 3D6TB 3GAAA 1N25A 3D6VA 3LYUA 1H0SA 1KZ1A 2VJMA 1J00A 3WL4A 3ENZA 3PDUA 5TQ2B 1JPVA 1TTHA 1I5OA 1YQUA 4MVJP 3VR4D 1KZ4A 5DVZA 1TW2A 3PJGA 3UMFA 3PCXA 2COEA 1GZ6A 4ZRNA 1N0UA 2MSNA 3B6IA 2QMUA 4IL5A 4IIUA 1H5UA 1N9KA 4IDHA 3JWEA 3NGMA 2JBAB 2CDAA 1UODA 4OHPA 1GA6A 2HT1A 4MDFA 2Y2VA 4EYQA 5AVVA 2KPOA 4F2DA 1NMQA 2CVQA 5J59A 4K1LA 4I7EA 3JSXA 4DLWA 3I76A 2GBGA 4RPGA 4NCXA 3DBIA 2R5NA 5BOVA 4O4IB 1WO8A 4Z4FA 3RG8A 3PICA 1K98A 4GWKA 3DYBA 3NUGA 5LFAA 1NW9B 1VI5A 4GX0A 5AMXA 4IHAA 4BDTA 4OPMA 1TKBA 2AN4A 2PZBA 4PYOA 4RW0A 2TMKA 2GAOA 4B34A 1VE6A 3TD6A 8GPBA 4N7RA 3W05A 2C5LA 4GZ6A 1AQLA 1JDSA 1XMVA 2RGBA 4LV5B 1QZUA 3OZSA 1RQGA 4FWIB 5HBGA 1Q1GA 2O4CA 3B7PA 3U31A 5LQKA 1JA1A 4UHCA 3CONA 4DIDA 4U7TB 3WNVA 3UK7A 1N3BA 3CNQS 4AMGA 3QBDA 5JIBA 3CO5A 5BR4A 4R7TA 2SICE 1ZGJA 2OAQ1 3A27A 4YHBA 3RT1A 5H9WA 2I2CA 4AZ3B 3N8IA 4MMYB 4MHOA 5I4KA 4BZWA 2Z4RA 2J9RA 1TE2A 4JVNA 4F4CA 2GYWA 1OV4A 1II8A 2WQ7A 2VF4X 1I1QB 1WXDA 2Z2YA 2FSSA 3A3OA 4N8DA 2ZXUA 2NQ8A 1G9TA 3I8SA 1AZLA 3AEYA 1AQ6A 1HDOA 1XL1A 3HN6A 3JYQA 5DRYA 1BNCA 5IJ0A 1FFYA 3ZKAA 1UBMS 3PJRA 5JZVA 3KWFA 2MJLA 1JSXA 4K9QA 4NEHB 1DQNA 2A0XA 4NYIR 2XLCA 3E4CA 4WPGA 2PRSA 5B1IA 1TJ3A 2P4QA 5HWSA 3R7BA 1U65A 3DD5A 3DEKA 5LD2C 1D2GA 1O89A 1Y9EA 4G5RA 1DFIA 3VVLA 3K71B 1KJNA 1VQ1A 1XP5A 3CM0A 4J16A 3WO0A 5IPFA 1E2LA 1PNTA 3I52A 4FEGA 4HB3A 2VPTA 3VX4A 4DT1B 1XEFA 3QE9Y 3D8SA 2QL6A 4DN6A 4CMIB 4M46A 1U99A 4YMLA 5C18A 5CXXA 3BHIA 3DMPA 3R4CA 2X14A 3VZSA 4RCZA 4P7FA 4QVGA 4ZZ0A 1X3SA 4V1CI 1BRMA 1GZUA 2A84A 3SS8A 3LRPA 1T25A 3RTAA 3THSA 1KBOA 2UUPA 1AXRA 3ROKA 3ZI7A 3UVEA 1JBKA 1LW6E 4ZVQA 3SQDA 3K0AA 4HRYA 5AWFC 1V3QE 1SRQA 4JU9A 5M2QA 3ONWA 3OE5A 4WY2A 5LZ5A 2JA1A 3THXA 4MR8A 3F4LA 5EE5B 4RBNA 1U1DA 1UBHS 3LXMA 4OVKA 4EHKA 3EIFA 5JJIA 1PHRA 3GJZA 3MRSA 4ZVLA 1Y7IA 1SBQA 4D79A 4LFCB 2W6ZA 3X43A 1PR1A 1R8JA 2HN9A 3THRA 1MC4A 4QM6A 2CC2A 2DFKB 3SK0A 5C34B 4RVGA 3H4VA 1Y4DE 1NZFA 2M32A 4D9BA 4UE6A 4JR0A 1PJBA 2NZYA 2NP6A 4FYIA 2OP1A 2YS6A 5MFZA 1T1RA 1RQXA 2DHCA 1V5EA 4HAXA 1O5OA 1OBVA 2G71A 1BE1A 2C8VA 2PZ8A 3AJDA 3FDIA 4G5SA 2YICA 4OIMA 1YZHA 2DKOA 2H08A 1FRNA 1QFXA 2VWGA 2FEKA 4M9SA 4TWRA 1TQHA 4X7MA 4OXIA 4XOUA 3TZCA 1Q3HA 1DSSG 4V0NA 1NBEA 1UM9B 2I78A 2OQIA 1ZVKA 1O9HA 2QMZA 2QRGA 1ENYA 2ZSFA 2JGEA 4JJ7A 2IU4A 4OBWA 2H16A 3DL0A 3K0EA 4Q66C 2IU6A 4X95A 5HE8A 3T4UA 2HYIC 4M99A 3CTMA 2JF0A 3FA2A 3LLCA 1ONPA 3ELBA 1IE3A 4URFA 4V03A 4CM3A 4HYQA 4OA5A 4PRYA 1GZ3A 3KSRA 3G2OA 2ZYTX 3EGOA 4WEQA 1NVAA 3EMKA 3P4UA 4KN9S 5CVCA 3RRBA 2AN1A 4LOAA 4OHBA 2GM9A 1L4GA 3KEGA 1K6XA 2EL9A 3K2BA 2VH1A 3Q3JB 3PR3A 1VMAA 3HA2A 5EHGA 5LOVA 4NCJA 1Q83A 2E87A 4UMFA 1PNQA 1HLDA 3AEUA 4NZZA 4LI3X 4RANA 3GJ6A 1EJ2A 2GJKA 2J6IA 1CF2O 2X3FA 2ZB2A 4IHJF 4YJ2A 2ONZA 2JHPA 3DOOA 4Q3KA 4CG3A 1EAMA 5CLJA 3QEMB 5DJ5A 4EJ0A 3KAQA 1RYFA 1WCXA 1CHNA 2POCA 1Z22A 1BD3A 4Y2RA 4TXJA 4ZEMA 4P86A 3DP9A 3I09A 4JOCA 3JYHA 2CE2X 4EJFA 5KOHB 4OQEA 1K5PA 1YDEA 1JEYA 2Z6QA 1EFHA 4KQMA 4G1FA 1X87A 2NNWB 2YVQA 3GBSA 1Z35A 4G0ZA 1PT9A 2BBOA 1QZXA 2BBTA 1UKBA 3VYSB 2PBZA 1P18A 2NOAA 5KYUB 3GGSA 4YP1A 5BOSB 3L8CA 4RCVA 2VLIA 3COSA 5JAQA 3PR2B 3EVGA 4NSNA 5BQXA 4N7BA 2VH2A 4LRYA 3LVRE 4EMBA 4LOIA 4DKJA 2Q4TA 1PFYA 3NC0C 4AG6A 3H3XA 3T3GA 4NZPA 4AN0A 4RMJA 2VAMA 4RHCA 3C8HA 3KZKA 3ZZMA 3GZJA 1P2SA 5AXBA 4EHJA 4D46A 3IIMA 3LHFA 3V7NA 2O2HA 2JG3A 3LGAA 2FWIA 3M9WA 3BHJA 1Y63A 1KTVA 3CRNA 4MQFA 3Q6NA 4XIFA 4Y30A 3C1AA 1SO8A 4F21A 3ABSB 4IVQA 2JIZA 1XMJA 1G63A 2ZROA 4L8YA 4CF6A 2ZIXB 1KYXA 3IRVA 3ES9A 3VFDA 4BNWA 1WG8A 2AX3A 3KLBA 1F4PA 1Y9JA 3Q6MA 4LE2A 3EZ7A 4YAUA 4KX5A 2CMGA 4Y7DA 2BKLA 1URPA 2JPDA 3L7KA 4HVAA 4TZTA 2X0FA 1DG3A 1GN9A 1ZM9A 1CU1A 2OV1A 2QTVA 3BRCA 1L5VA 3IX7A 4QDXA 4ZQEA 2JDIA 2IWHA 1IOLA 2IYNA 1U9YA 1QV9A 3LLMA 4PRLA 4PC7A 3A04A 1Y37A 2CFOA 3FNQA 3I4LA 4UU7A 4YX9A 4GD3Q 2NU8A 3N0VA 4CFZA 3BOSA 1THGA 3CB2A 4UE3S 1KJJA 5FB3A 5LYYA 2DHEA 1JQBA 3DC7A 1YKFA 4C6RA 3KQHA 1SUAA 3KP1A 5REQB 3ZVKA 4CQLB 1ZVMA 1E89A 3K3PA 3KAKA 2DYKA 4RCYA 3B8EA 3RIEA 1W5SA 3IEMA 2Q3EA 3A70A 3FZYA 3I3OA 3A6JA 2VPPA 1QNLA 1Z7WA 4C7MA 2FSFA 3K9NA 4DV1B 5AKZA 2V7XA 1EEHA 3COYA 1TGVA 4A03A 1XLUA 3AL2A 1M1ZA 4X93A 3KB2A 4TLAA 3ZWPA 2JANA 4MNTA 1F6WA 3D5QA 3TLYA 1C9KA 3INRA 1QV6A 4KN6A 3AB3A 1W25A 4QYSA 3SM9A 4UQPA 4DXAA 1KP3A 3NBMA 4B32A 2I29A 3O4JA 5K2OA 1TD1A 4G09A 2B21A 2HV8A 5EUQB 3ED1A 1JVBA 5CFMA 3D8NA 3B78A 2IYRA 3L4JA 5IP5A 2AC7A 5FUYA 4C4SA 5JRZA 1NMZA 3UK2A 4DPKA 5A4FS 4AMVA 4UAVA 5L51A 2H92A 3OQIA 4M38A 1EIWA 2JGIA 3WMRA 2J87A 3U44B 3W9YA 4HJXA 3X1KA 2C4TA 1ADFA 3MTDA 4WECA 4XWTA 2RGRA 4KR2A 3E82A 3LBYA 3L82B 3KE9A 3K8ZA 3QV1A 5I9BA 2HBQA 3BWDD 2XUKA 4L5BA 4C0SA 4M7PA 4PVDA 4JCOA 4GPD1 1R0RE 2ERCA 2VEDA 2OCIA 4HEA6 9LDBA 1UBOS 4R1LA 2J07A 2WZCA 4FD2A 5FOQA 4IDEA 4M2LA 1OH7A 2B8TA 4NXNB 3V42A 4MA5A 2B4YA 2G5TA 3ENKA 3MC1A 3QLVC 3DTVB 2IJGX 2VJDA 5A9TA 4I55B 4OP3A 4ACAA 3BBPA 1ZUHA 4MQ6A 2SECE 3ONVA 3FZNA 5I47A 1O6ZA 2YN0A 5EHQA 5KO2A 3VNQA 2NM0A 3VU9B 4D9EA 1USVA 2OFXA 5ICGA 1ICIA 1U0GA 2E5FA 1ZNZA 3KZVA 5KAMA 2BFDB 4ZI2A 5CGZA 4LJYA 1JLRA 4X5OA 4X62B 1WUYA 1K1EA 2HMVA 4QLAA 4XVHA 2XUPA 5B12A 4G5HA 1VHDA 1M2JA 1XVVA 2QD1A 4G5OA 1AX9A 3SI7A 1XG5A 1QH9A 1WHTB 1RXSA 2X2OA 3NRBA 4MGIR 2E85A 4X0EA 2C9YA 3O74A 3OJWA 4EH1A 5JNWA 4K6OA 3TO5A 3V8NA 5E8RA 1R15A 3CH7A 4KB5A 4DARA 4Q9JA 3RS5A 1W36D 4TXMA 2IBSA 4LG1A 1EDEA 3QG5A 4PLZA 2C4UA 4AMZA 1GGMA 1U8TA 2YWFA 3BWVA 3WGOA 2OCGA 1I3KA 3GGCA 3P9IA 4BNIA 4F3YA 2AF3C 1JMKC 1P7PA 1ORRA 4GOJA 1QO7A 2ZOSA 3GVXA 1I2ZA 4IDOA 5HS4A 5GIOE 1I1OA 4BZZA 4L9WA 1NRXA 3TNFA 2WG1A 3CT4A 4KHZA 4Q48A 3UT5A 4DA4A 5F76A 5BYAA 2VP2A 4JB3A 1OKKD 2Y4NA 3HXPA 4IIJA 4NU8X 4GF5A 2XWBF 3PIIA 5JSQA 3Q5DA 3TLAA 3GUUA 1MJGA 2J3EA 5EZ5A 2HDHA 3CEAA 3HWX1 4IWNA 3NCTA 5BV7A 3AILA 3OESA 5BN3A 1U3GA 5A3VA 4UUMA 1JG4A 2QN8A 3BIOA 1CY4A 5FA6A 1OROA 2QQ0A 4FLMA 1ZUWA 1J7JA 3OE7A 1JR3D 4P3KA 4UAUA 4RK6A 1RKQA 1F12A 1SCIA 5FP0A 3VDQA 5D1NA 4MLDA 1YRBA 3GQVA 3OX4A 4NYMR 1AHPA 1ETHA 1A8HA 1Q3TA 2Q3JA 2ACEA 2HO5A 2XDQA 3TPFA 2VAXA 3W3AH 4NBVA 3EK2A 4FR2A 1BH6A 4ISBA 4BP1A 4FYPA 1ESDA 4HPJB 3QPCA 3BWMA 1GPLA 4WL0A 3SJZA 5LSAA 4L22A 4PN7A 1CUBA 1T4DA 4L16A 4X45A 2BEWB 4JN6B 1R0WA 2GILA 3TIVA 4Y9UA 3UC9A 2XV1A 3V4FA 1K7FB 4EX7A 2J0UB 5CB4F 3DAFA 3CJTA 2FDRA 4FZRA 4WNAB 1QQAA 2CL5A 3A3NA 2VHEA 5E6UB 2Q6LA 1H2BA 4DBVO 3VKWA 2V5AA 4Q01A 2O2XA 3STVA 4RMGA 4CG2A 5ALGA 4Y2QA 2G0TA 1JWLA 4YRDA 1NQWA 2VSOA 2GERA 3T0IA 1UP4A 1UC4B 2FJPA 3QXHA 4ZT3A 5BT8A 1TO1E 1L5GB 1E5QA 4B0OA 2ZJ5A 3MINA 2MSLA 3F74A 3QYFA 2HA5A 3D2LA 4FOOA 2G5GX 2PGOA 4ACBA 1SQ6A 4YRBA 2IPAB 3U48A 3Q0TA 2QLBA 3RKRA 3A14A 1VSTA 5FD8A 5FIUA 1R9GA 2GCOB 2Q6KA 4EPYA 1QZ3A 1IN5A 1UP7A 2V5VA 2XT6A 2X0NA 2HJRA 2IODA 1BOFA 1ZMOA 1E7RA 1G3IA 2BKXA 2JGKA 2V5UA 3M33A 4NNJA 1JLKA 1L7DA 2CBXA 1DO2A 1GQQA 4GP6A 3ROGA 2ZTLA 3QY9A 4A15A 4GBGA 4BLUA 1G7CA 1I4TD 2C2OA 1JUDA 4Q9KA 1E1LA 1AK1A 4FFMA 4ZC1A 2B92A 3KIPA 4EMUA 3R0VA 4YJFA 3KB1A 2R8OA 4CEHA 5KQRA 5B1HA 2IHJA 2PFKA 2VZ9A 3V1TC 2YY5A 1RR6A 2Y68A 3BDAA 1EVJA 1FQWA 1QB8A 4PAMA 4RK5A 3KALA 4DVGA 2JRCA 3O2JA 2DU8A 2H5EA 3FF4A 4ZPXA 3T3MB 3DE1X 5JDIA 2ZWAA 3IDSA 4LK3A 1L8QA 1V11A 5CLQA 3SFZA 3P52A 2IZZA 4CEIA 4AG5A 3LLSA 4L4RA 1GLGA 3FYDA 3F90A 1KMMA 1E1RD 4EFMA 3STXA 1WF3A 3DBRB 4CIVA 3U4MA 3GROA 1GGJA 1PP4A 4GT1A 4YMIA 3UV3A 3U6BA 4AJ2A 1FEZA 2GHRA 1C3EA 1MPTA 5DHAA 3WQQA 4B17A 1LTHR 1XRRA 2L19A 4W9NA 3M1LA 1XKLA 4XM0A 1RHQA 1VCIA 2YJTD 1AIPA 1J2JA 3OJ0A 1EX7A 2NYUA 4I08A 5ADHA 3JARB 4RVOA 3NWOA 1FSGA 4LYDA 2O2SA 3T9EA 1T10A 2VLBA 3AETA 1C7JA 1RVV1 4D3DA 1TW3A 2A9KA 3MT9A 2A5LA 2WSLA 1UBTS 3AI3A 1FMJA 4JLAA 2C9CA 3PGXA 1F2TB 1PZGA 1ADGA 1ZKMA 2A9OA 3FTDA 1I14A 4RJ2A 1ZD2P 3JV7A 4FYJA 4KE6A 1Y33E 2BFWA 1U02A 2Z43A 3T12A 4D9KA 1M8FA 3L04A 1P9RA 2UYQA 2AD5A 1FP4A 2FEAA 1ID1A 4HDSB 4BFTA 4JBGA 4ER3A 2EJVA 4U5QA 5BSVA 4UNPA 4MR7B 4LDAA 2OV2A 1FYEA 4KMMA 4KP7A 4WZZA 5PGMA 4DQUA 4KR9A 5HFJA 1GTMA 4I50F 3TZLA 4GIBA 2ZIUB 1YF3A 2QUAA 3COZA 3MUEA 2ODEA 5TRTA 1PVVA 4TXLA 4YGYA 4ZOLB 1KSGA 5JWRA 1I94B 1PG2A 1MJHA 4L2IB 1FYDA 4EYEA 1PJ8A 3BILA 4KI7A 4HVLA 5K0FA 3RU2A 4ZYVA 2VQ3A 3K4QA 3TUZC 3I5XA 5LC1A 2NVWA 1B1AA 3DMHA 1BU5A 3NO4A 4EL0A 3UK1A 1G291 1YDWA 2CEKA 4B3JA 2FCRA 1ODCA 3D7NA 1WDLA 1JHXA 5DNWA 4Q3CA 4B87A 5IKXA 2N3ZA 1EGHA 2I6TA 4P08A 2B94A 5E7QA 4CCAA 4OHFA 4XIGS 1JG7A 1GGNA 2X5KO 3OJLA 2HA6A 3R3HA 1NQ5A 2JEZA 2XD4A 4DMLA 1VJ1A 4ND6A 3MTEA 3BZUA 4P22A 4PGFA 5FNZA 1NWHA 5HJ2A 4FCWA 1M6EX 3G5TA 4L76A 1CLEA 1D9ZA 1ELOA 4G8BA 5I48A 1W29A 1DLJA 2C5GA 2ETVA 2PQMA 3BTVA 1NM5A 4FPXA 4CMAA 4RE6A 4CM5A 1O96B 4YPOA 2G8LA 3I73A 4NXMB 5AK5A 3UXYA 5AJXA 1HURA 3RRZA 4BFUA 4FSXA 4AFNA 1KAHA 3C3DA 1O94C 4ZTBA 1U7DA 2WMNB 3QVOA 3W5IA 4BATA 3CX8A 4KTVE 3VC3A 5AOAA 4MMZB 4O59O 3MGCA 3G1TA 4W8OA 2QZPA 1X94A 4RA9B 4EQ6B 5HIKA 1WA5A 4X94A 4YMVA 1PGJA 2BELA 2VRWA 2DWPA 4JSRA 1BS9A 1UWKA 3OC6A 3VR6H 1J97A 1TQ2A 2PTGA 1E2HA 1EUDB 2ZYAA 3AWIA 4RFVA 5AHWA 4AJ1A 1UBNA 3WA7A 2OAGA 5H16A 1IHYA 2CWWA 2WTNA 4RWEA 1NUAA 5DHQA 5HZGA 2ZJYA 1K89A 1MRNA 1Y7PA 1KQ3A 2FMIA 4B3XA 4FDMA 3OCYA 1A5BB 1USKA 3BZBA 1FYFA 1RHJA 2ZYHA 2HIHA 1XRSB 3F47A 3KTOA 2I1QA 3PUIA 1QQ6A 3W78A 5DGTA 2Q46A 1F8GA 3TH5A 1PWYE 2BY4A 3QUSA 3UWOA 2P77A 3AKCA 2YINC 3RF6A 2BMDA 1GPJA 1Z5UA 2G63A 3K94A 2B7LA 4KQXA 4QATA 5E4TA 2NTEA 4XYEA 5EMJA 3ZWWA 3MQ4A 3FGOA 1WDWB 3TTWA 3KK0A 5F98A 5DI9A 3T7RA 4PNEA 1G8YA 4INAA 3UAVA 2XGOA 3ZHZA 1EZ1A 1J5EB 1VOTA 4NY1A 1R3DA 2D5BA 1FRQA 1D0SA 4QDKA 2H51A 5LXTA 4I0WB 2DHQA 2ZRAA 4LIPD 1R6DA 1T3SA 1OGJA 4NE9A 2V0NA 4EJSB 1TQDA 1Y1RA 2QAGB 1XI2A 4MV7A 2WJWA 4V3BA 5JCXA 4JY7A 1N8SA 3BCRA 5CYPA 3IODA 4C3OB 3R44A 2IP4A 2MDTA 4BO8A 4YMHA 3A05A 2EFCB 4IX1A 4NH4A 3TKAA 3KQKA 2XODA 5ICFA 4ZJUA 4WVFA 1F8FA 4DA0A 5ITSA 1JQ3A 2JCSA 5AVOA 3HCRA 1MN6A 1LPOA 4MVJF 4D43A 4CT5A 2D5AA 3V8EA 1J8DA 4BNJA 1BDMA 1ZG3A 3V1UA 1HDXA 1XMPA 4BGEA 3KQLA 1DJOA 2LKDA 5JVDA 3ZHXA 2NO5A 4A23A 3FWZA 6AT1A 2WJVA 4KMRA 2PX4A 4ZXPA 1Y6QA 5C8YA 5JS2A 1ZJWA 4JV5B 4OQYA 1B7GO 4PICA 3WJ2A 2RIRA 1XZPA 5KSYA 2Q3DA 1Q92A 4WNCA 2FAXA 5C5DA 3H1EA 3CVXA 1RZRD 3G9ZA 2PA3A 2CYCA 2J48A 4Q5IA 3K6KA 4IOKA 4M60A 5A05A 3JASA 1XBTA 1SK9A 1UC9A 4DIBA 3N6VA 1U1GA 1E1CB 1XNGA 2EFJA 5FBKA 5JQGA 4UM5A 2W90A 4A82A 2X1HA 4IIYA 3RTCA 2YC2C 3QVWA 1VMIA 2AV6A 1D7AA 1ZN9A 2IYSA 1YS7A 5JY6A 3JQBA 1ZM7A 5IDVA 4K9SA 3ZW9A 4P5DA 1OI7A 1PQYA 1Y3DE 1C3OB 3HFJA 5JAMA 1X7XA 3IB3A 3BJMA 4HY3A 4ZYZA 1EFRD 4UCXA 5BUCA 1N8TA 4RQUA 2ZJ6A 4XB6B 2C42A 2C2XA 4W5OA 2CLIB 4J2HA 5HM6A 4YRKA 3P9ZA 5FI5A 3OIDA 3GFGA 5M5BA 1NURA 4OYLA 2OGSA 2VBCA 1N6OA 5JARA 4AAYA 1LBEA 1MO2A 3CR7A 1C1DA 3CEJA 5T41A 3RUPA 3OTHA 3W8NA 4EGQA 1D6SA 2PT6A 1AKQA 2ZIEA 4KAXA 2XB8A 4A0SA 1XNRB 3TNJA 1KPHA 4TTSA 2F3SA 4KPEC 3CRQA 4NHEA 3D4LA 4CFYA 3PQ2A 3C98A 5FBWB 2IX3A 1PD0A 3VMFA 2H00A 3DLPX 3N2GB 3L84A 4Q3LA 4RKQA 3O95A 4UEKA 3TTTA 3JQAA 5LP6A 4K88A 1Y42X 1W46A 2P1RA 3B5EA 3OP1A 3DMTC 3NHSA 4I81A 4M53A 4RTMA 3I6BA 4BQRA 1ZRSA 2YVUA 4IQ0A 4OEHA 1HDIA 4RNCA 4C0WA 1J1UA 1GVHA 3G23A 3R5SA 4EF5A 1ML4A 1Q1QA 5DRTA 4MV9A 4CKWB 2CZCA 5EPUA 1GUZA 2OAP1 4ZT5A 4BMYA 4P35A 3T1HB 4M0UA 4CEJA 4QXOA 2R48A 2C5HA 2RHBA 3BK1A 1UAYA 4AP9A 4P0QB 4CKYA 1GTJ1 3TDNA 1MTOA 2C2MA 3GMDA 3ESRA 4AMYA 3KYDA 1QGUA 4IEFB 4IOLA 3U3DA 4CR6A 3HYCA 1ZUNB 3EZ9A 4INOA 3E2MA 1LI4A 3RKSA 2C9DA 1FDIA 1BMTA 2LBPA 4ENPA 3ZDDA 3M5WA 2ZT7A 3KQWA 2WWVD 5AW8A 2PUVA 2EW2A 4D0GA 5CD9A 1K6JA 3L4EA 3MQFA 4ND3A 2NYAA 1T36B 2QRHA 4AKHA 3ZLJA 4RV5A 4TMZA 1BVUA 5G1PA 4P0TA 1XRNA 4PLGA 4BLSA 5KOIA 1DXYA 2LW7A 3HQ4O 1NR1A 2ZB8A 4PYMA 1QE0A 3WDKA 1QIJA 4FYXA 1O9GA 2H1IA 4W99A 5ICSA 1L7QA 3HB5X 4R7ZA 4MAFA 5T3YA 3E48A 4RX1A 5EWMB 5TQ2A 5C5IA 2VTVA 2FYTA 3A9SA 5A9RA 8AT1A 3LCUA 4RSGA 1TU3A 2HHJA 2YUIA 3DG9A 4Y2XA 4EA9A 3M5DA 2F1IA 1COWD 2G40A 4EUFA 5DTEA 1XMQB 3Q5EA 5BQ5A 5T4BA 5HQ3B 2PZAA 2VRNA 3V33A 4BNYA 1NUUA 4YO7A 3UPUA 2R8EA 3L7IA 2W2LD 1NQAO 2JBAA 4HS9A 2R7LA 4DLLA 1OAOA 1MJGM 5I9TA 2XCIA 4BP8A 4YJ2F 2O2EA 3HY6A 1V1MB 4KX3A 2GZMA 3IT2A 4GVXA 4O4HB 1EWYA 1WE2A 3RYTC 3SYLA 4CM9A 2WHPB 4O4IA 1EBBA 1HZJA 4DMUB 3N2LA 3HBJA 2BGKA 1RWVA 1KAQA 1QF9A 1V3VA 1IZ0A 2C1ZA 2A5DA 2GF9A 5IVKA 1OX6A 4B7AA 1SOWA 4NK5A 4U7DA 2YCLA 1JR6A 3HN7A 4ZKDA 4NDZA 1DKPA 3FSEA 4BP9A 3LT2A 4MHSA 3RNLA 2GHIA 5K0GA 1LDNA 2AMJA 4LGVA 4MW6A 1IFXA 5BWBA 1JJVA 2ZJ4A 1UPBA 3FMPB 1C0KA 3KFVA 4QARA 2GAAA 4RHFA 4B3RB 3K32A 5HE9A 4E12A 5GONB 1Q12A 2VBIA 3MERA 2AFHB 1IHUA 1ZXXA 3JRNA 3R3VA 2WSSA 3IP1A 3PP8A 1LI5A 4R1PA 3M6XA 4AYTA 4DUGA 1AD2A 4LSMA 4PS0A 4LZNA 2PUFA 4EG3A 4WK6A 4ZO8A 1FSPA 1ZMRA 1ZM4A 1MKYA 1P5JA 2W7TA 4NHOA 3Q7TA 2G1UA 1VL2A 5FA5A 4AZ3A 2Z04A 1WV0A 3AJ8A 3LBFA 1JFLA 1B93A 2HQOA 1UAGA 1OR8A 3PFNA 5F73A 5G3ZA 4CDNA 1TZCA 3LKBA 2Q3BA 5THXA 1JZSA 4C20A 2LD4A 1H6BA 2JCXA 5JLJA 1UMCA 4C78A 5CBPA 4OXXA 4X71A 3Q7IA 1E3SA 1OXKB 4PPQA 3DCNA 1FXUA 3PCTA 3FPKA 3HJAA 4C0KA 1OXTA 3SKVA 3GUYA 2ZLBA 4QQRA 1W59A 3BD8A 3WIDA 1E69A 3OIUA 1F2UA 2J46A 3DVQX 2R5WA 1T1JA 2QXYA 2IHYA 1I1NA 3G7SA 3IP7A 4DT1A 3SJBA 1LV7A 3GO4A 4M7OA 5JCZA 3L41A 1M6VB 4JT9A 4CUJA 2WTUA 1HMYA 3DKKA 2O3JA 4B2IA 3I5YA 3ZV6A 4CMIA 2OMEA 1OFUX 1KO4A 4NG5A 4B6EA 2XMDA 5B7QA 5BRNA 3WNBA 2H9AA 2CKDA 3NHWA 1EDDA 1TMKA 2HNAA 4MULA 4XI9A 2H06A 3R8CA 1EU1A 1WS6A 5KTTA 1DEKA 4XAQA 1CY2A 3D7RA 3SX2A 4C05A 1MEEA 4XDGA 1HE2A 1LRJA 1C4OA 5HTKA 1CBUA 1Z2CA 4F2GA 2WYWA 1TGYA 4XPZA 2ZI3A 2Q3MA 3UH0A 1U3TA 1T5LA 4EJ6A 3NYWA 2OYRA 3IUPA 1YR2A 1XCMA 5EYPB 1DUIA 1T4BA 5BNFA 4YRZA 3SBDA 1G3RA 2HA7A 4ZJYA 4RDCA 1SWWA 4HNUA 2XQIA 3DAGA 1I24A 2EOAA 1E18A 2J5RA 2GXUA 2OYCA 4BBJA 2ZK7A 2HLHA 4XJXA 4DR5B 1NVUQ 2SKEA 4ECAA 5JU6A 5HJ5A 4TVBA 1EWQA 3FWPA 2WAXA 1F9EA 1P19A 1U3UA 3JALB 3QRWA 1SIUA 5F2KA 3AWDA 2FFRA 1B74A 4M55A 1IZYA 2GZ2A 4RD4A 1FSFA 1QDUA 2R00C 3A6KA 4HWPA 1CS0B 4OYYA 3RBZA 3TXYA 1Q14A 5IBPA 1UM9A 3TIXB 4H0FA 3RG2A 2NAPA 4G1VA 4YP5A 1U11A 4F1WA 1NBIA 3L5OA 4I19A 1QHFA 4NR0A 4URYR 5DE3A 4ZAFA 4MKXA 2ILTA 2C7QA 3H05A 5FKJA 1NVVQ 3UG6A 4IICA 4M8LA 2FN3A 4QTTB 1ZM2A 4R3WA 4TKUB 3AEQB 2DSNA 1P4RA 3BD6A 5A5VA 1F6BA 2H6EA 4Q02A 2J30A 2OFFA 1IUKA 3EUAA 1VMEA 4QNRA 3S2IA 1JSCA 1KH2A 1DB3A 2O6LA 5J5AA 2HBYA 5BW6B 5ABPA 1K2VN 3ISJA 3F3SA 1U5BB 5AR1A 1IK6A 4OLHA 3GFOA 2WU1A 1JIJA 2XOKD 3KXLA 3P26A 4QULA 2GNPA 3DFMA 4BO3A 3PWKA 4QASA 5M3BA 4A8HA 3KJFA 3LUKA 1QE3A 1YZTA 4QEZA 2JFPA 1N5MA 3LRTA 3QEMA 2JW5A 4ZV7A 4DY6A 1W6RA 2RGDA 1LKZA 1DIGA 2GCEA 4PTLA 1EAYA 1NX6A 2OLKA 1ZVQA 3T15A 1EDBA 3AFMA 2O5CA 1YI8A 3UYLA 3UENA 4ZODA 4HAYA 1G41A 3GWGA 1Z2NX 4NQRA 3QQPA 3E9QA 5KOHA 4S0XA 3NHPA 1YZYA 1IL0A 4MGKR 3R9KA 3DOEA 1J9EA 2PGDA 4FC7A 4TYNA 2KB0A 1MVLA 2QIOA 4DCMA 3HJGA 5KYUA 3UAOA 2J3QA 4BB5A 5ED4A 1BE6A 1KYVA 3GH3A 1SUCA 3SHWA 1GPKA 3B6MA 5BOSA 3FUVA 4UEQA 4F6LA 1O87A 1R16A 2B5WA 3BORA 4K9DA 4C29A 1P1HA 3NIGB 1LPPA 3A9TA 1DRWA 3E0XA 1VYHA 3AFNA 1KDOA 3AOEA 3AIIA 2A94A 4YVFA 4KFTA 1PEKE 5EAIA 3H8WA 4JI1B 1R6TA 3GNTA 4KIJA 3O4IA 3CNEA 1YQEA 1H6DA 1Z6ZA 5BUZA 2UYOA 3R5KA 4DTCA 2X3UA 1IONA 2ZM5A 4PG8A 1CUFA 4ALLA 2ZIXA 5AOBA 2Z2IA 5KVCA 3UK6A 4BEVA 3DMFA 3EHEA 1XZBA 3ZBPA 3WYAA 2P69A 3EDMA 4BMZA 1GZSA 3NHMA 1Z0JA 1TIBA 4JL8A 1YIOA 1FP6A 4U63A 1Z5OA 3E35A 1U2GC 4TRNA 3AVYA 5AVWA 2A6PA 2N9UA 1UOPA 2JC3A 2PWYA 4WCDA 2FXIA 1Z88A 3P32A 4FGJA 1X8LA 3OD1A 4MICA 5JYDA 5MFPA 5DWDA 3V1LA 3OY2A 1Z33A 4PG7A 2CK3D 5JDCC 1R0YA 3TN7A 1G7SA 4CXMA 3U7GA 2AR7A 3CS3A 3QFHA 2REQA 5REQA 3IYLW 4CQLA 1NATA 1Q74A 4DSAA 1IQ0A 2W6MA 4A0HA 1P75A 1NPDA 3FAZA 3QBVA 4RDXA 1V5GA 4WJKB 1Z2OX 1J9ZA 4IO0A 3O6VA 5HCUA 2XNHA 3L4SO 2FZLA 1ES9A 3W0LB 1ZXLA 1GZ4A 3E84A 5DB4A 2FB9A 1N33B 1BDJA 4OB6A 3N0TA 2PX3A 3REQB 3EVFA 3BEOA 3KYBA 2XYHA 3VZQA 3EZXA 4OP2A 4UNNA 1S2LA 4QJ3A 3E1KA 5JG7A 1A9RA 1N0VC 3QK7A 2I87A 3OCZA 3NC4A 4WNIA 3UHJA 4B74A 1BVHA 5BN1A 5IJWA 4Q9LA 3T7AA 3K0KA 4TL7A 1FFDA 2QG6A 1OC2A 4MO2A 4OYRA 5BORA 3T3DA 1NQVA 4M6WB 2VCYA 1OB2A 2IYLD 3ESDA 3V80A 2I5PO 3FFAA 3BD9A 1V8OA 1E6EA 3PXXA 5CH5A 4ZEXA 3U44A 2GHTA 3BQNB 2ZBDA 3R7NA 2VTKA 3SIXA 3BVPA 5U1PA 1XDZA 1C9EA 1HYEA 2CDBA 2Q5JA 4NENB 4OMDA 5DYNA 3P4XA 3TMKA 2AUTA 1AGRA 2ZBGA 2XUOA 4HDKB 5I45A 1Y82A 1WV1A 1Z8FA 3M1IA 4ZMRA 1IDOA 2O8CB 1CVRA 2V96A 3REOA 3W5JA 4DC1A 4E2WA 2UV8A 4ZICA 4QQFA 3QJGA 3CMCO 1MG5A 4DY4A 2ZAGA 5AP9A 3LD9A 3DDCA 3HCFA 5JY1A 4EG4A 4YCLA 4ZZ1A 4AWAA 3JYOA 4X7RA 5JYEA 2JD1A 3AP1A 3DTVA 3BRSA 4MWEA 3DH0A 4I55A 4HQFA 4HDAA 2JBHA 4PANA 3C4VA 4QOSA 4UDOA 3QXSA 2JGRA 1U31A 3R0XA 3EPLA 1R64A 2P9GA 1RT9A 4Q37A 3TOVA 3EW7A 3VU9A 1V4BA 2OVFA 4RHTA 4B84A 1C2TA 1K63A 3QA3E 1L7EA 2XNDA 3UJ8A 2BFDA 1GRQA 1MABB 1ST3A 3CNLA 1RYEA 2ODWA 3GT4A 4LJ8A 2F1KA 2APJA 2HPHA 1GYPA 2Q4EA 3CF4A 1DE0A 3FHLA 4RM2A 4W1QA 1M74A 2HWWA 1OXMA 3EH2A