3WLEA

Crystal structure of (r)-carbonyl reductase from candida parapsilosis in complex with nad
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
335
structure length
335
Chain Sequence
SIPSSQYGFVFNKQSGLKLRNDLPVHKPKAGQLLLKVDAVGLCHSDLHVIYEGLDCGDNYVMGHEIAGTVAAVGDDVINYKVGDRVACVGPNGCGGCKYCRGAIDNVCKNAFGDWFGLGYDGGYQQYLLVTRPRNLSRIPDNVSADVAAASTDAVLTPYHAIKMAQVSPTSNILLIGAGGLGGNAIQVAKAFGAKVTVLDKKKEARDQAKKLGADAVYETLPESISPGSFSACFDFVSVQATFDVCQKYVEPKGVIMPVGLGAPNLSFNLGDLALREIRILGSFWGTTNDLDDVLKLVSEGKVKPVVRSAKLKELPEYIEKLRNNAYEGRVVFNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords (R)-specific carbonyl reductase
publication title Unconserved substrate-binding sites direct the stereoselectivity of medium-chain alcohol dehydrogenase
pubmed doi rcsb
source organism Candida parapsilosis
total genus 99
structure length 335
sequence length 335
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2013-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wleA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3wleA01
1GR0A 1X0VA 1BGVA 3IC5A 1HSOA 1Z7EA 5AYVA 3P7MA 4L4RA 1R15A 4WCFC 1H0KA 2VZ9A 2D5CA 1W6UA 5HM8A 4CL3A 1GD1O 3PYLA 4Z9FA 4X54A 2O2YA 4ND2A 5LDHA 5C3MA 1SC6A 4CQLB 4RJTA 1ADFA 5IZCA 2CDAA 1QYVA 1NAHA 1XLTA 1PJ4A 1EZ4A 4D3SA 3TNLA 1Y8QB 2DFDA 4RF4A 3LC2O 5IDYA 1PZGA 3ZN2A 4R5MA 3RC2A 3E48A 1KIFA 3RUDA 4RPKA 1SO8A 2OGUA 4K6FA 4DLBA 1HRDA 3WIDA 4BMSA 2PV7A 3K6JA 2W2LD 4A03A 3ENNA 3DBLB 5A9TA 4YAKA 4XYBA 3G17A 3RASA 4BV8A 1EE9A 3BHMA 1E3EA 2VYVA 2FN7A 4DLAA 4QX6A 1OC4A 4I8XA 1KY5A 4UEOA 1U8FO 5L4LA 1TT5A 3ZWYA 3VZRA 4D7AA 4GSKA 1HT0A 3KEQA 1PWXA 3OJ0A 4XYEA 4ND3A 3BZUA 1GZ3A 1R6DA 3JQEA 1K6JA 2YW9A 4J90A 5IXSA 1LDBA 1XKQA 5EESA 3S2FA 2HJSA 2NVBA 4OOEA 3DMTC 4B7XA 3D0OA 3GZNA 4OMUA 5TSDA 2C7VA 2Q2WA 4UUOA 2C20A 4S1VA 3NRCA 1VL6A 1Y9EA 1E3SA 3DR3A 3GG9A 1PR9A 3ZV6A 4BO3A 4URFA 4A7PA 1VE9A 4WNCA 5C7LO 4INAA 4AJJA 1LSUA 2P91A 5T64A 5AQ1A 4J7XA 4R54A 4XQGA 1AHHA 3RFVA 4DBZA 2VHZA 4CM6A 5JDIA 5JC1A 1QKIA 3M1LA 1KC3A 3FN4A 4FD3A 4DC1A 2PTGA 9LDBA 3GUYA 3W1VA 3HJAA 2UYYA 4OL9A 2VWPA 3ITKA 4FJ2A 4WCFB 2HK9A 2BFAA 5EMHA 2FPGA 4XIYA 2DBVO 2FZEA 2HKIA 4EJ6A 3HFSA 4Z9YA 3VH3A 4L74A 1EQ2A 3GY0A 4MVJP 3PDJA 4GL4A 4IQ8A 3LT2A 2NNLD 3OBBA 4D44A 3KYBA 2YHIB 4WOKA 1MG5A 1ZIDA 2FSVA 2ZQYA 2PGDA 5A5EA 4ZJUA 4NBVA 4RQUA 4PG6A 4Q3BA 4RVUA 4HV4A 3BA1A 3KEOA 4I9NA 4PRLA 1J6UA 4JJIA 3OM9A 3PHIA 4FR5A 2ZTVA 3KVOA 4Q3CA 4R16A 4CLHA 3PPIA 4E5PA 5TF4A 1XDWA 4CPDA 3ZV4A 4J4BA 1UUFA 3ASUA 3NTOA 5I7VA 5L95A 4PLWA 2ZB7A 1HXHA 1TA4A 2FPIA 2AXQA 5DCWA 3RFTA 1C0IA 1P1JA 3I4FA 4J1SA 4UUPA 2IYPA 4BO2A 2CUKA 4HFRA 1B16A 4BNMA 1ZUD1 2ZB4A 3DOOA 3KV3O 3F5QA 5DDIP 4UEKA 3TOZA 3SLKA 4CM4B 5L7TA 2HDHA 2PGJA 3K96A 2GN4A 4UREA 4EUFA 3WGQA 4DXHA 1DRVA 1ISJA 5B4UA 4Q3NA 5LDGA 1Q7BA 3NGXA 1CQIA 3GK3A 4CMJA 4FSHA 4QECA 1ONOA 1TVEA 1Y8QA 3DAPA 1DFHA 1UP7A 3SX2A 3SJUA 2VZ0A 3ONDA 2NU7A 4Y6PA 2D0IA 4FFPA 2OP0A 5I9NA 1O6ZA 2B0JA 4WK6A 1J0XO 1SEVA 3JYLA 2PY6A 4NIMA 3AY6A 1LLQA 4JNKA 1C0LA 2OHXA 1HE3A 3R0IA 4IS3A 2DC1A 3TQHA 5I9MA 1I32A 1SBYA 4YBZA 4NMHA 3HN7A 4Q3AA 3EC7A 1O95A 1PZEA 1RYEA 1ULUA 2DBRA 4LSWA 2VWGA 2GGSA 1U3VA 2WYUA 4FS3A 3NX4A 4XB2A 3VZQA 1O89A 1M75A 4CQMB 2P4HX 1H93A 4PLHA 1MG0A 1K3TA 4W9NA 1R4NB 3NGLA 3WGHA 1UZLA 3DZHA 3GGOA 5DULA 3ZWNA 4DYDA 2C82A 3E8XA 5IDXA 5K6AC 3KBOA 1U3TA 5GY7A 4DMLA 3RUAA 1E3LA 4IINA 4AJEA 1VSVA 1VPDA 4ALIA 5CDSA 4HXYA 4Z3DA 2Y0EA 1L7EA 3OJFA 4N7RA 2NLOA 3G1TA 4KQWA 3QJ5A 1UXGA 4BKQA 2ILTA 4YAEA 1CJCA 2HK8A 1RWBA 1KVQA 5DCYA 3GRKA 2AG8A 1A9YA 1R0LA 2R6JA 4BKOA 2W90A 4P4NA 3BIOA 3VPFA 1T2CA 2EEZA 4MVJA 2IRWA 1CYDA 4G81A 3BMOB 3NTQA 2NADA 3RFXA 4WOJA 1I2CA 4CM9A 2OBNA 3ZWMA 4BO1A 2DAPA 4MKRA 4CQMD 1QRRA 1GQYA 1IPFA 1NFRA 4ZRNA 2Y1CA 2PKQP 2EP5A 4XWYA 1IUKA 1MP0A 3NT5A 1BW9B 4ZQHA 5ILOA 2WTBA 3AU8A 4Y67A 5KKAA 2VOJA 4WCFA 4F6CA 1MGOA 3SEFA 1X13A 4GKBA 5A9SB 2FOIA 4YJGB 3QVOA 1NTOA 3GN2A 1LLUA 3JTMA 1ZO8A 5EPOA 4JXKA 3KYDA 1M2WA 1HLPA 2VQ3A 3C3XA 3GFGA 2BFPA 4XCVA 2J3KA 4JN6B 7ADHA 2EW8A 4RZHA 3AI2A 2AQ8A 3LYLA 3QY9A 1Z7BA 4R3NA 4JBGA 1C1DB 1NHWA 3BXXA 4WASA 4AJNA 1YE3A 4PG4A 3PIDA 1PTJA 4JCOA 4B4WA 4YT2A 5EN4A 1JN0A 3RKUA 1DDOA 4CMEA 4AL4A 1JAXA 3ZW9A 1MFZA 1D1SA 3KZVA 1DIRA 2NSDA 1HTBA 1PIWA 1CWUA 2B69A 1GYPA 3QLJA 3NTRA 4PG5A 4OIMA 4M1QA 5DBGA 3EVNA 4CLOB 1E7QA 1XELA 2G1UA 2F00A 3WBFA 4KTTE 1JDJA 1QYXA 4YJFB 3FNGA 1TB4A 1FDUA 4BKPA 3HHPA 1JW9B 5CAEA 1EBUA 4CM4A 1E5QA 1JKJA 4FGWA 1EDOA 3UCFA 3UVEA 1NFQA 3OETA 1NVTA 3BTVA 3K8ZA 4D3DA 2PA3A 3RIHA 5L40A 2E6UX 1GUZA 1XG5A 1O9BA 3H9EO 4B3HA 4N5MA 5T6BA 4E21A 1E1LA 2O4CA 2EKPA 4GPD1 5A03A 1NAIA 5TX7A 1BXGB 3DMTA 2ZYDA 2PWZA 3QVSA 3L6OO 4JJFA 1HETA 1PS8A 2Q1UA 1DXYA 4ALLA 1WXDA 2D8AA 3E18A 3C7DB 3DTYA 4RDHA 4TMFA 4M55A 4WLNA 4YDRA 3NAQA 3VDQA 4S3MA 4JGBA 4ZU3A 4BNLA 4LN1A 3OMLA 1WNTA 2BFMA 3CKYA 1HE5A 3DQPA 4IS2A 1W73A 3OIDA 3B70A 3IMFA 2VRBA 3CE6A 4CQMA 1G6KA 4WLEA 3PEFA 2QG4A 3C8MA 1XU9A 4EEXA 1QG6A 1VLLA 1KETA 3KTDA 3V2GA 3VC7A 2EIHA 3L9XA 5JO0A 1Z6ZA 3MWDB 4NBRA 2QRKA 1QORA 2PH5A 3ZWVA 4AJ1A 1LQUA 5IG2A 3RC7A 4Y9DA 5B4VA 5I7EA 4O63O 4ONEA 4XYMA 1JVSA 3OICA 4FW8A 4YB8A 4BV9A 8LDHA 3GT0A 2BI8A 3EVTA 3LU1A 3K73O 4D0SA 1X1EA 4MIEA 4IY1A 1M6WA 5FEUA 2OUIA 3FF4A 3X2EA 5F21A 1RM3A 3BMOA 2V6GA 1WMBA 2IEBA 2YFQA 2P5UA 1DOHA 2GRAA 1LQTA 5LCXA 1YXMA 4PCVA 5KTKA 1BW9A 5I9LA 4DWVA 1HYGA 2BH9A 1Z75A 5AXCA 4MVJF 3H65A 3PP8A 2CD9A 3WSWA 2QQ5A 5A9SA 4YJGA 3H4VA 4Z3KA 5IZCC 4JK3A 4U5QA 3LVFO 1SEPA 5IN5A 2Q4EA 3AY7A 3FWNA 3X2FA 3G49A 2O48X 3GPDG 2YZ7A 2WM3A 4L4SA 4R5HA 3WGTA 3U3XA 4NBTA 5L4NA 4DPLA 3EK2A 1EFLA 3KETA 3AUTA 4BHTA 2XOXA 3L9WA 3Q6IA 4GI2A 1C1DA 3F9IA 3ZHBA 4LVUA 3S2IA 3ROKA 4XJTA 5ITVA 5GZ1A 5A4DA 5HWSA 3ANLA 1WZEA 4A0SA 1LDMA 1YQXA 4HX5A 1ZKMA 4JJGA 3UICA 4C4OA 3QE3A 5G0TA 4XGKA 1N8KA 3VPXA 3C7CB 3RKRA 1RM4A 1EK5A 5TRTA 4IXTA 2HU2A 4E5KA 4GAEA 3AOEC 1WMAA 3HQ4O 3CINA 4FFRA 5EQDA 3GAZA 1E3JA 3QWIA 5DP1A 4DVJA 3QP9A 1ENZA 1V8BA 4YJFA 2X9GA 4O5OA 3I83A 1NASA 3MJVA 4TRRA 5U1PA 1R4MB 4J91A 3VZPA 1PQWA 4HUJA 2I67A 2ZTUA 3TPCA 5JC8A 1QV7A 3PJEA 3K30A 5TC4A 3JCZA 3F1KA 4JQCA 4RZIA 4UUMA 1YQGA 2E48A 1JWBB 4WJZA 1RPNA 4RF2A 1E77A 5FWNA 4MP6A 4WEOA 4ESOA 1HZZA 5K6AA 4MOWA 4D0RA 1H6CA 1X0XA 1F12A 1ZNQO 1ISMA 3EHEA 1BXGA 1UH5A 4PZCA 1P33A 4WNIA 2ZK7A 1OC2A 3E9MA 3RI3A 5FFFA 1T2DA 2VNSA 3D4PA 5JE8A 4D43A 3PHGA 3AK4A 3VAZA 3AFMA 5HTOA 4N5NA 2ZJ1A 1JA9A 9LDTA 3F46A 4IUYA 3AUUA 4KQXA 1PSDA 5H82A 3DL2A 3FRJA 3PI7A 1NQ5A 4YT5A 4GQAA 3UGKA 5CEJA 3GEMA 2HAEA 4XA8A 3D4NA 1E1MA 3JD3A 3V1TC 1XIVA 3TDKA 1X7DA 4AVYA 4HFJA 4L73A 1EBFA 2IYOA 1YVEI 5F1KA 4D3FA 1PGOA 4YEDA 1OI7A 4PFJA 4PLGA 4WLOA 4RVSA 2X1HA 5I8WA 3ZH2A 2B35A 1HDRA 2SCUA 1WDLA 1H6AA 4FB5A 1ZXLA 2GNAA 3UCEA 1FDSA 2NTJA 2X0NA 3NEPX 3P19A 4IMRA 4EJMA 1GQ2A 4DQVA 3CMMA 3LZ6A 4IJWA 1H94A 3S2GA 3U4CA 3JQDA 3WTBA 2J5KA 4R9SA 1CIVA 5THKA 2UAGA 1HEUA 5CG1A 4LSMA 4MKXA 1AUPA 1ZVMA 4E4YA 1KVRA 1PX0A 3RCBA 2BI7A 1YQDA 3F47A 4BNUA 1M67A 4PLPA 1IPEA 1GV0A 3ZNQA 1MUUA 3AW9A 3VPSA 1GFSA 1PJ3A 3CMCO 4BB5A 5L7YA 4CLEA 4DPMA 4OM8A 5G2OA 4NBUA 3WYEA 5CEEA 4Z0TA 1B8UA 2CDCA 4Z6KA 3IDSA 1PL8A 2GN6A 3TJRA 3MJ4A 5L9AA 3KLMX 2B5WA 5T5QA 4ND4A 2B4TO 4EGFA 1YOVB 1DSSG 2CVOA 3R6DA 4LCJA 2FRDA 2BELA 3JV7A 1WAMA 1E7WA 1Q0QA 1E7YA 2NVUB 3O8QA 2WSBA 1QYDA 4FN4A 1DJNA 3JQ7A 4MIOA 4GGOA 3M2PA 2WD8A 2VT2A 4K6CA 3LSYA 1DBVO 3ONEA 3GMSA 4WLVA 4EEZA 1DLIA 4YAIA 4XKJA 4WUVA 3ZDFA 3ZU4A 2Y0DA 1AE1A 1SPXA 3SLGA 3VVCA 3PLNA 1KYQA 4O0LA 3TL2A 1T2EA 1JAYA 3PJFA 3HWRA 4ALKA 1H2HA 4D45A 4NZ9A 1JLLA 3DEYX 1D8AA 3DOJA 1YBMA 2IEDA 4FDAA 1Y6JA 3T4XA 3O03A 2ZB8A 1RM5A 3QWBA 2VZ8A 3QA9A 3ZV5A 3WG9A 4D42A 4KWIA 2V6MA 4Q39A 2VCYA 1EE2A 1FDTA 2Z1NA 1LJ8A 1GCOA 2ET6A 1BWSA 1PL7A 2VN8A 4NU6A 4D46A 3LC7O 4D79A 3D7LA 3ZWOA 1GAEO 2O2SA 2J6IA 4TVBA 2VUTA 1I24A 3GVCA 4E2WA 2Q2QA 1F8GA 5DCUA 3Q9NA 5I7FA 3D3EA 4NPCA 5G4KB 3CSDA 3AU9A 1U4OA 3JQBC 2V6FA 4IDEA 4BNXA 4UAGA 2X9NA 1LLDA 3D5QA 1LBEA 4HNHA 4U6SA 4RLSA 3RUCA 1YL6A 4BNTA 4BMVA 4OSPA 2H1SA 2NACA 4GSLA 1QYWA 1FJHA 1E6EA 3RBXA 3WQQA 3ZU2A 4BS9A 4CMGA 5KJFA 5DNAA 1KERA 2WDZA 1Q7GA 1K2WA 3K2EA 3DHEA 1I33A 1PZFA 3DWFA 4M86A 4G2NA 2OP1A 1UP6A 1NYTA 3I9NA 3WNVA 3GEGA 1LEHA 5AOVA 5IDWA 4PG7A 5AVOA 1FDWA 2VOEA 4TZTA 3QIVA 1VJ1A 4MIYA 4TRJA 1O94A 3VTFA 3UXYA 2B4RO 3JQCA 2BFOA 3FPCA 2D59A 3UF0A 2QW8A 1CDOA 4M54A 1AXEA 4TROA 1GUYA 1DIHA 3LDHA 4CMEC 5MDHA 2E82A 1F8FA 1PJLA 3RBZA 4Y6SA 3RU9A 1F17A 2X9VA 2HK7A 2ZYAA 3WGZA 1H9AA 4NH4A 3DOCA 4YYZA 5A3JA 3GMDA 3F5SA 5HRUA 1LLCA 1PGQA 2RH4A 4FFLA 5I7SA 2YUTA 4OXNA 4LISA 2CFCA 2QIOA 3V5NA 5IXYA 1HDZA 4ZD6A 3VH4A 3JQFC 5H83A 2W4QA 2EV9A 3TFQA 2PZLA 3PJGA 2O7QA 4K26A 5IAAA 3GH3A 3AOEA 5ADHA 2XAAA 3VH1A 4HFNA 1NXQA 4RLHA 1PJCA 1BVUA 4BO4A 3GOHA 1DLJA 5L45A 1J4AA 2J5QA 4L4XA 4PLTA 3OEWA 1ZSVA 4E33A 3V1UA 2I76A 2YHUA 3S55A 2GZ3A 3CH6A 3OJEA 3U4DA 3IQDB 3ZHZA 4A2CA 1IB6A 3V2HA 4AJOA 1PS9A 1YOVA 5G0WA 2GYYA 1ZZEA 3EDMA 2GN9A 2RBEA 5THQA 1NBOA 1NM5A 2J5RA 2YYYA 3TZ6A 1UJMA 3KYCB 2NVUA 2D5AA 4W99A 4WPGA 4LW8A 4PRKA 3ST7A 1KBZA 1AXGA 2O3JA 4UUNA 1DC3A 4BNIA 1IHYA 3ZWBA 1KS9A 1DJQA 3DB2A 3ZWWA 4N54A 3H2ZA 5DOVA 1EUZA 1DEHA 1XSEA 1C3VA 4Y6RA 1CRWG 2HO5A 1QV6A 2VTEA 4TKLA 4F45A 3RAJA 2P4QA 3DHYA 1UDAA 3PVZA 3UHAA 3FWZA 3T4EA 2WD7B 5EJ2A 1U2GA 3PFWO 5U9CA 4DUPA 5T57A 3S1LA 1NQAO 1XWFA 4HP8A 5KJ1A 4U7WA 5IJZA 2JD1A 1G0OA 3OQBA 2VHWA 2AE1A 1ARZA 2C5AA 3PGXA 2O50A 1EDZA 3ZI0A 4I5GA 1SB9A 1X7GA 3EZLA 3KYDB 5C37A 2OMEA 3DFZA 3E6AA 3INRA 4R3WA 1P1KA 3TZQA 4Z0HO 4XQ9A 3WBBA 4F6LA 1GEEA 3DAFA 1B8PA 3O26A 3CEAA 4IDDA 3WOHA 4YAGA 2W98A 1U3WA 2DTEA 2HMVA 5K9ZA 4BGUA 3GN1A 1T25A 5G4KA 4HBGA 2D1YA 4KZPA 3ONFA 1LXCA 4MPDA 2P9CA 4NI5A 4QUKA 1ZH8A 5EL0A 4ND1A 3LLSA 3Q11A 3U0BA 2PD4A 3PIIA 4LMPA 2O7SA 4U8GA 3STHA 3FBTA 1LC0A 4JX8A 3RBVA 5JMWA 2GPTA 4U0JA 3U09A 1T24A 1DFIA 1YGYA 3JQ6A 4R41A 4XGIA 4DQUA 2PKRA 4IJVA 3GGPA 5ICSA 1Q7CA 1SMKA 4IDFA 4XIJA 2W2LA 4J2OA 3I9KA 1ZJZA 1WLYA 5F1PA 2HSDA 3FTPA 5KVCA 1BRMA 5BSGA 4GWKA 1ADGA 3OQ1A 2V7PA 4EYEA 2HJRA 3GQVA 4IQ0A 1U4SA 4ALJA 3MTGA 2P9EA 3Q3CA 3P2OA 1H2BA 3I9JA 3ROQA 3ETDA 3OF2A 3ZZNA 3PGJA 4WGGA 5JMPA 3PYMA 4NDNE 4KDEA 1QP8A 4RORA 1SNYA 1I8TA 2O3SA 3FNEA 3WLFA 4B8ZA 3EZYA 3QWAA 4KMSA 1DAOA 3TRIA 4CMHA 4ZQFA 5KOIA 4E31A 1ORRA 4JBIA 3L4SO 1BG6A 2A35A 2WYWA 4CLXA 1QLJA 1U5AA 1UAYA 5A02A 4KUEA 4PZEA 5L53A 3KSUA 4YTEA 1YH3A 1DO8A 5KIAA 2B83A 5KVSA 4UVDA 3OJLA 3ZU3A 3SXPA 4RO0A 5CFZA 2Y0CA 3TZHA 3NJ8A 3V8BA 4XEHA 4RDIA 3WSVA 1P1HA 5FF9A 5TT0A 4RVDA 4CUKA 1MC4A 2EKQA 1LDGA 5ER6A 1AGNA 5JLAA 2JKVA 4QTZA 2DBZA 3G1UA 3OP4A 4GX1A 3V1YA 2FHSA 3H2SA 5IN4A 1J5PA 4ZHSA 5ER9A 2GO1A 2JL1A 1ZSYA 3KYCA 1IOLA 3E82A 4DYVA 3DZGA 4J9VA 2JJYA 1E3WB 2VHYA 4CV1A 3NKLA 2JCVA 3WX0A 5KJCA 2JD2A 2Y1FA 3JQBA 4EITA 4Q9NA 3C7AA 4YACA 4C7JA 4QFDA 4HKTA 2DTXA 5KKCA 3IAHA 4RF3A 4CJXA 2WD7A 3ULKA 3B1FA 1TEHA 2CDBA 1E92A 3ANMA 4NK5A 1I0ZA 1QYCA 3PYXA 4TZKA 3I3OA 1VJ0A 3AY3A 3CIFA 4YVFA 3DZBA 4K9DA 5B1YA 1LDEA 2C07A 2GD1O 5COBA 4LRTB 1VJTA 2VTDA 4BNHA 5F5NA 1Y7TA 2Z95A 1NVMB 4PLCA 5G0UA 5HA5A 3HSKA 3ETEA 3G0OA 3TL3A 3PRJA 4FOSA 3MOIA 3R3SA 3JQ9C 4XZ3A 1PQUA 2RH8A 2Q99A 3S8MA 3OH8A 1I30A 1HWYA 1NHGA 2EXXA 5CDUA 3E5RA 5JY6A 2Y66A 5HBRA 4E3ZA 2HMSA 3JQFA 5L7WA 3HG7A 1IE3A 4E5NA 1LRLA 3WGGA 4YJDA 3MZ0A 4LMRA 5G0SA 1YL7A 3C1AA 5KVQA 5JYEA 2J3HA 2YDYA 2DUUA 1HDGO 4MKZA 1CF2O 3DZIA 3K2BA 5GZ6A 1T26A 1JKIA 1GUFA 3ETGA 4AJHA 4J2HA 1W4ZA 4RQTA 5TLSA 1PJQA 4J3FA 2B5VA 2WEKA 1ZFNA 4W4TA 2DUWA 1T1SA 2PR2A 4EUHA 4L0QA 4R1UA 3G3EA 3M2TA 2CF5A 3D5TA 2ZTLA 4GVXA 4WLFA 3W8FA 4J43A 1GL3A 5BSFA 4FFOA 1N5DA 3HE3A 1U7HA 2FMUA 1LUAA 1UDCA 2QHXA 4QQRA 3ZHYA 2YFHA 3ZNOA 4AICA 1VSUA 5JAIA 2FR8A 4P4LA 4IGEA 5L3ZA 4RL6A 6LDHA 4YXFA 4DPKA 3DBVO 5TIIA 1PGJA 1WZIA 4PN3A 3GR6A 2GN8A 4ZQGA 3UOGA 3COSA 4PVCA 1SAYA 5JO9A 4GX2A 5ILGA 5L4SA 3I4CA 3PWSA 4B4OA 2HMWA 2HMTA 4IXWA 1KVUA 3ASVA 3TWOA 1VC2A 2JFFA 4H15A 4AG3A 1FK8A 4HNGA 4E5YA 4IDAA 4FQ8A 4EW6A 1XGKA 1ZW1A 1IZ0A 3JQAD 2I5PO 2HUNA 3VKVA 1IYZA 3ROMA 3OQ6A 4NFYA 3LT1A 4J1TA 4BO6A 1N2SA 3R1IA 1JTVA 1VL8A 4IDGA 2PKQO 4RGBA 3OIFA 5B4TA 3NT4A 4J7CA 1PGNA 1PJSA 1PU2A 1ZEJA 2EWMA 4EZBA 1E3WA 2NUAA 3EY4A 2ZKLA 4CM7A 1QR6A 2RCYA 2PFGA 1GY8A 1YWGO 4M89A 1GV1A 1OOEA 1TLTA 1V35A 2AMFA 1LC3A 2AQIA 4YCAA 2WWRA 3GRPA 1JWAB 2UV8A 4N18A 1LDYA 1H6BA 2BGLA 4I9UA 2E37A 2POQX 4UEJA 4DIFA 3F1LA 1Q2XA 1P0CA 4O59O 4NQZA 1ML3A 3BMNA 1SB8A 1ZBQA 4JIGA 3BTUA 1PQPA 1KOLA 1A27A 2X5OA 3NT2A 2GLXA 3WICA 4FJ1A 1P77A 1DHRA 5JNLA 5F3RA 4J16A 1MC5A 2IZZA 1E5LA 3OA0A 4BNKA 4PIVA 2JFHA 3O8QB 1KEVA 5JDCC 1HE4A 4DC0A 3KB6A 4OQZA 7MDHA 5CPFA 3ABIA 3JQ7B 1N7GA 5A1TA 1YB4A 3WGOA 3NDJA 4PZDA 3I6QA 1JQBA 4G5HA 4UVEA 4XX0A 3DC2A 5ES3A 4CL8A 5G0VA 1V3VA 5C7IO 1S6YA 3JD2A 1Z74A 4BQPA 3A4VA 1Y1PA 2WE8A 2NWQA 4OQYA 2WMDA 3HDHA 4GGPA 1YJ8A 1B3RA 3JYQA 3HB5X 1NX6A 3PXXA 3PWKA 3RVDA 1LTHR 1YONA 3DFUA 3UN1A 5DZSA 2G17A 3LT0A 4CM1A 3PLRA 4ALNA 2NU8A 2VWQA 1FDVA 4LRSB 4KP7A 3Q2IA 3WFJA 1N9GB 2FY8A 4BMNA 3AOGA 4JP3A 4ROSA 2A9FA 4DMMA 3FNHA 2FR0A 3TZKA 2JD0A 2VNAA 1ZXBA 3T7CA 1Y81A 1G0NA 3D1LA 3QW2A 4CR7A 1HE2A 1N7HA 4CM8B 3WNQA 5BSHA 3BAZA 1E7MA 1GPDG 3LK7A 4NHEA 4OHUA 5HS4A 3PZRA 4R4JA 1MA0A 3S2EA 1HDCA 4OAQA 3PTZA 3K31A 4BNGA 2P9GA 1E6WA 4WKGA 1I3LA 4R69A 4RV9A 3CZMA 1ZSNA 2RHCA 2BLLA 2Q49A 2FZWA 4QEDA 2Q45A 3VPGA 4ZGWA 2I3AA 1EFKA 3RROA 2C2XA 5IZ4A 3O9ZA 1K5HA 4JP2A 3UFXA 2CZCA 2R00C 4CR6A 2GZ1A 4II3A 4M87A 2EP7A 3WS7A 1WVGA 5IF3A 4AJLA 1QMGA 2IODA 3MJTA 3ZWXA 2G5CA 2YQ4A 3I52A 4MINA 4PLVA 1GEGA 3WJAA 4J6FA 4RVGA 4W7HA 3OA2A 4FFMA 3F4LA 4W7IA 2C59A 3ZWCA 3EYWA 1LU9A 3B6ZA 1P74A 4FBGA 5A05A 3N7UA 4BB6A 3JQ9A 4XYGA 4LVCA 2H63A 5COQA 4IDBA 1M76A 4I5FA 4E5MA 4QSMA 4RVHA 3DMYA 4A5OA 4J4HA 1MXFA 2X6TA 2DBQA 3CZRA 3PJDA 4TRNA 1KY4A 3C1OA 4B8WA 1U28A 1L1FA 2JHFA 5F1OA 4CM3A 1R12A 2VRCD 4QO8A 1PJTA 1EQUA 3GNQA 4B4UA 4CMKA 2X58A 4R68A 3WFIA 3TFOA 2NV6A 1HDXA 1XYGA 4HWKA 4NBWA 3OJOA 2D4AA 3K9QO 1XQ6A 1EMDA 4R1NA 5KVVA 2XXBA 2O3UA 3M1AA 4EDFA 3QV1A 1O5IA 2YDXA 4NR0A 5AXAA 4R51A 4ITUA 1JU9A 3IJRA 2CF6A 4XQEA 1L7DA 3U49A 3UW3A 4ZICA 4RPHA 2I9PA 1DHTA 5C5IA 1PZHA 1HF3A 3ADPA 1WWKA 4MVJE 3RC1A 4L8VA 3PDUA 4DIOA 4N5LA 2X0RA 1LA2A 2G76A 3GVPA 1C1XB 3GPIA 1VM6A 4YA6A 3I1JA 2W2KA 2QRLA 3HN2A 1B8VA 1P9LA 1VRWA 4TRMA 2Q1TA 3UKOA 1NNUA 1ENOA 1P44A 4CUZA 5CDYA 3GDGA 1MLDA 1C14A 3D4OA 3PHJA 1X14A 2ZYGA 4E32A 2OO5A 4BGEA 4GBJA 2NU6A 2X0IA 2CNBA 3WLEA 1GYRA 2Q1WA 3JYPA 1WDMA 4UVGA 1R16A 4YRDA 4A10A 4BO0A 1GPJA 4ZN6A 5TS3A 1Y5MA 2QX7A 1OFGA 3H9GA 2OXIA 1T2AA 1R37A 5TJHA 3UH1A 1UXKA 4A73A 1PL6A 4OKNA 1Q0HA 1NPTO 3W4KA 1N9GA 1YDWA 2DM6A 3HB4X 4M8SA 2DVMA 2V65A 4EBFA 4MDHA 3DBRB 2UVDA 4EUEA 3C85A 4CM8A 3DBHB 1ZK4A 2AA3A 1HYHA 3A06A 3QVXA 4U0KA 4CMCA 3A28A 4FFNA 3LLVA 2EJVA 5G4LA 2DLDA 4XDYA 2GUGA 3OHSX 1HLDA 2UDPA 2WYVA 4W82A 4YQZA 1I2BA 1ZMOA 3BMQA 3PQEA 3ANNA 3IUSA 2CY0A 1H5QA 1V3UA 4H16A 1RYDA 4J7UA 3QQPA 2RIRA 1E3IA 2HQ1A 3JD4A 4XDZA 1KC1A 3DZJA 3JQ8B 5DBFA 2VUSA 1FMCA 3WQSB 5CDTA 2QRJA 4PLZA 1I36A 2GCGA 2NM0A 2VRCA 3AUAA 3INTA 3AI1A 5DT9A 1U9JA 2BRUA 2GSDA 5ENVA 1XHLA 1BXZA 2TMGA 4CODB 4PLFA 2AQKA 4YT4A 3ZW8A 3AUSA 2BGMA 3F4BA 5A9RA 3RUEA 4TVOA 1E1KA 1ZEMA 1K89A 2AG5A 1QLHA 1EVIA 4DLLA 1Y9AA 3U9LA 1MX3A 2X86A 5JDCA 2C5EA 5J23A 1SCUA 1ZCJA 3RD5A 3P2YA 4CUJA 5JS6A 1YS4A 1UXHA 3B1KA 4GX0A 4BNYA 1R0KA 5A5FA 4L75A 4GKVA 4IBOA 1VKNA 1N1EA 3KSZO 4YWJA 4KUGA 2OBYA 4I08A 1SOVA 2YV2A 3LT4A 1KEUA 4DL9A 2Y1GA 1CETA 1GYQA 3W8DA 3KM0A 2B4QA 4KWHA 4OYRA 2JHGA 3IP1A 1Z82A 1U5CA 4XRGA 4MP3A 4OGWA 1Z45A 2VHVA 1B0AA 4J49A 1F06A 5JW6A 5JAZA 2GR9A 1Z73A 4YR9A 4D41A 2FPPA 3ROPA 2A94A 5EQFA 3WWYA 4J9UE 1UDBA 2ZB3A 4MVJM 1PGPA 4BQRA 3IIEA 3PQFA 3U4IA 4GWGA 3IP3A 5KJEA 1YO6A 4F46A 1P45A 6ADHA 4GVLA 5JAQA 1YDEA 3HUDA 3TZCA 4GMGA 1C1XA 4BGVA 4XR9A 4K28A 1DC4A 1BSVA 3I23A 2PH3A 3FHLA 1YL5A 2NTVA 3QHAA 4JLWA 5JPIA 3FBGA 4MO2A 4MJLA 2FSSA 5ICMA 4TSKA 1Q1NA 3HNPA 4KUHA 3AFNA 3C24A 3RSHA 2O3QA 1I2ZA 2OOSA 5CDGA 2CVQA 4R1SA 3B20A 2Q2VA 3SC4A 1J49A 1BTOA 1ID1A 4WECA 1W0CA 1BMDA 1A7KA 2R00A 3TSCA 1LNQA 1E1NA 3L77A 1VKOA 3AWDA 5CPBA 3WXBA 1XCBA 2IXAA 1LRJA 2VWHA 3GNTA 2FP4A 2VYND 3G79A 1ADBA 5JCJD 3RC9A 4FOOA 3DBRA 4Y98A 4M49A 3ZNNA 2E49A 2Z5LA 5BT9A 1V0JA 3LF1A 3DBHA 4DBVO 4EI2A 2QYTA 4J0FA 4Z9XA 2Y67A 1WW8A 1LI4A 5F5LA 3A14A 4YRBA 1H9BA 4W6ZA 4GLOA 3DDNA 5JXWA 3W4IA 1OBFO 3BMCB 2A4KA 3H9UA 1PR3A 4E6PA 3SVTA 3IKTA 3PHHA 4HADA 4MVJH 2EG9A 2AW5A 2O3TA 2CSUA 4CMAA 4MVJD 1NQOA 4AJ2A 3U4HA 4CM9D 1U3UA 3WGIA 2C54A 1KVSA 3GAFA 3JQ8A 4O1MA 4UVHA 2GZ2A 1AN9A 1NWCA 2J3JA 2PZMA 3GVIA 4IDCA 4OOFA 3VH2A 1I5RA 1ONNA 3BYZA 3IS3A 5JYDA 2PLAA 4J0EA 2BD0A 3PHLA 1Y5RA 1R66A 4E30A 3GG2A 1ULSA 3PQDA 1ENPA 2EGGA 5K0ZA 4I5DA 3MOGA 3AM4A 3OFSA 4L76A 2D3TA 5T8KC 4O6VA 4R01A 4RPJA 5DP2A 4P8RA 1ISGA 2DU8A 3ENKA 4BIIA 4CQLA 2DKNA 5EINA 4J1NA 1IHXA 4NJMB 3C1TA 4B4VA 4IQGA 4U6QA 2X5KO 1CQJA 2OZPA 3H5AA 4XGNA 3IUPA 3I5MA 3VTZA 3OECA 1UZNA 4NK4A 1U8XX 3LC1O 3VPHA 5CEFA 2DPHA 3ZV3A 2G82A 4XR4A 2TMDA 2DFVA 4L9RA 4ILKA 2NTNA 4BO5A 2BMAA 5ENDA 3FSRA 3MEQA 1XEAA 3O4RA 5FI5A 4J1QA 3SJ7A 3HDJA 3KLPX 4BKRA 3DBLA 1NPYA 4ZRMA 3WGYA 5JAMA 3H5RA 1GQQA 3N58A 3ZWPA 1OMOA 2NVWA 4BUCA 1BHSA 3BTSA 1ZK3A 3HDYA 1TI7A 2J8ZA 4XQCA 4OXYA 2QZZA 4IZIA 1V3TA 3BHJA 2H9IA 3PWZA 2AE2A 4IIVA 4OKIA 5KCZA 5TQVA 2ZCUA 3F3SA 2O3RA 5U4QA 3AJRA 4BO9A 1DPGA 2VYNA 3GDFA 5JCJA 1RM0A 3CTMA 3JYOA 4CMBA 1EVJA 3RJ5A 1BVRA 4K1LA 4WCDA 4P38A 2NQ8A 3GVXA 4BNZA 3QSGA 5JFOA 3L4BC 1UP4A 1BDMA 1P1FA 4NG5A 3ZNPA 5L51A 3Q9UA 2GASA 2QYSA 4EJ0A 2P68A 4I9HA 3KHUA 3KOUA 5KJ6A 2Y99A 1GADO 1EEHA 3HZZA 4Z0PA 3BMNB 4DGSA 1YRLA 1GDHA 4AJKA 3T7EA 2I65A 1D4FA 1SZJG 5B37A 2CMDA 3GLQA 2P5YA 4A27A 5BNIA 1B3BA 2Y05A 2BKAA 3E9NA 1B14A 5JY1A 2BGKA 4JBHA 2DTDA 3L07A 2X7HA 1WP4A 4IJUA 3MJEA 5EIOA 3E9QA 1E0DA 3WMWA 3OIGA 2JAHA 1RKXA 3RUFA 3ZHXA 3LF2A 4XD2A 1ADCA 5BNTA 3I9MA 1GZ4A 2B36A 2XF8A 1V6AA 1GZ6A 2O23A 3BMCA 3KSDO 2EERA 3GA0A 2YHIA 5GZ3A 1PJ2A 2NU9A 3A1NA 3CXRA 3UAGA 3JD1A 3SBOA 5BR7A 1B2LA 1YBAA 4LGVA 2UUPA 2OFPA 4E13A 1YBVA 1N92A 2JAPA 1T4DA 1ISHA 1IULA 2X5JO 2ZCVA 3FTNA 3BHIA 2O4UX 3WMXA 1Q0LA 1LX6A 5B12A 1F14A 4B3IA 1HDOA 3NYWA 4E12A 1A7AA 3JQAB 2PGLA 2PNFA 1P31A 4QFCA 3UCXA 3DTTA 2X4GA 3ITDA 1X15A 3RUIA 1ENYA 3EW7A 3Q1LA 3GUCA 4ZQBA 3VVBA 2JCXA 1UR5A 3NV9A 1OAAA 3ADOA 1K6XA 2Q3EA 1MB4A 4J4TA 4NJMA 1A4IA 4AJIA 5TT1A 1EUDA 1MV8A 3E1KA 4FC6A 2Z1MA 2GDZA 5CHEA 1FXSA 2HRBA 2PD6A 5EERA 1NVGA 3DXFA 2RHRA 5KWEA 1D7OA 3GNSA 3FR8A 4P4GA 2ZIZA 1V9LA 3ICPA 1JKFA 3H7AA 1T4BA 1IL0A 1DC6A 1F0YA 4FGSA 3WR5A 2C7GA 4PLYA 3WYBA 4F3YA 2ZJ0A 1DRWA 1VI2A 2Q4BA 1LRKA 3W6UA 3CUKA 4B3JA 1KVTA 3RQSA 1NFFA 2DT5A 1NR7A 4WEQA 4BNFA 5T67A 1NR1A 1A5ZA 1ZMTA 3E03A 4OXKA 1U2DA 5I8ZA 2HLPA 4XB1A 3DZKA 4TKMA 4BKUA 3FR7A 5CG2A 3WJ7A 4ID9A 3QWFA 3W4JA 2I3GA 1LSOA 4FJ0A 4XYLA 4RPGA 3QVTA 4CV3A 3Q2KA 4I5EA 4BO8A 4MP8A 4QO7A 1R4NA 1TT7A 2X22A 2JFGA 4FIZA 3H8VA 4PGFA 3DHNA 2OL4A 4YPOA 4FC7A 2C0CA 3Q0EA 3GF4A 4LK3A 1LSJA 2BF7A 3SC6A 1JVBA 4CMIB 5TGDA 4IZHA 1PEDA 4HFMA 3QWHA 2FWMX 1I3NA 1QSGA 3FCOA 1G1AA 1IZ9A 4UVIA 2E4AA 1Y8RB 2Q50A 3I9OA 3D64A 2GERA 3H5NA 3GHYA 3D3WB 4CR8A 3KXDA 4BOYA 5C7OO 4TWRA 4BVAA 2D2IA 5BQFA 1T1RA 2RAFA 1EVZA 2Y68A 3VDRA 1EUCA 1HSZA 4PG8A 3TF5A 1RJWA 2BHLA 4IPTA 5A04A 1MXHA 3EAGA 4RCVA 4YJHB 1U7TA 3VHRA 1QXSA 4H3VA 1YB5A 3A9WA 2X0JA 3WWZA 4GX5A 5T8KA 3GGGA 2AEMA 2H5LA 3E5MA 1ONPA 5K1SA 3JQGB 2YY7A 1PWZA 3QRWA 4Q3DA 4RPLA 1B15A 5COAA 3BTOA 3UUWA 4CV2A 4C7KA 5FYDA 2W2KB 2Y1DA 3WIEA 2IDZA 3PZBA 4IMPA 2ZTMA 2R2GA 1DIAA 1D1TA 1ZK0A 2AQHA 5MGBA 2I6TA 1BXKA 1DB3A 4YQYA 1P0FA 4ND5A 3IL2A 3TOXA 1W8DA 1ZK1A 1M6HA 4GH5A 1CEQA 3GC6A 3ICCA 4QXMA 3N74A 1N1GA 3FI9A 1UAGA 4KOAA 5HS6A 5DF1A 1DAPA 3NUGA 3W8EA 3KRTA 4CLOA 4B7UA 4TQGA 1P3DA 4OH1A 3JQAA 4OJNA 2YJZA 4XRRA 3VZSA 3WDSA 2EGHA 1NPDA 4IGFA 4Q3EA 5JBIA 3H9JA 4R1TA 3GDOA 4HY3A 1VL0A 1R0SA 5LC1A 3QVWA 4CLRB 5TNXA 1WPQA 1PS0A 2W8ZA 1HDYA 3IJPA 3AI3A 4YAJA 2YQ5A 1I3MA 1ZK2A 1HYEA 2AEFA 4DRYA 2EW2A 2IZ1A 4CV0A 3H3FA 1XQ1A 3PK0A 3HFGA 1UZMA 3WQRA 3RJ9A 3BMQB 5AXDA 3FNFA 2H6EA 1B7GO 3LQFA 3L4BA 1TXGA 1KEWA 3RU7A 3K92A 2XXJA 5DN9A 1XA0A 3AM5A 2IZ0A 5IDQA 4OO3A 3B1JA 4NJOA 3L6DA 4ALMA 4WE3A 1DFGA 3IKVA 2VUUA 2ZQZA 3HDQA 4WLUA 4BO7A 5JSFA 4CM5A 4MVJI 3RWBA 3VKUA 2V6BA 5JDIC 2PK3A 1FF9A 1HL3A 3ORFA 5IFLA 4IJKA 3PFFA 4PVDA 3ZGYA 3NJ4A 4BL5A 1S7CA 1BDBA 2HMUA 2DPGA 3JSAA 3ON5A 5H81A 2EJWA 1P1IA 3NDIA 5DOZA 5AXBA 1EK6A 4DA9A 1U1IA 5BNFA 4BNNA 3H3JA 3R3JA 3H9QA 3M6IA 4YRAA 4AFNA 1A71A 1WDKA 1DIGA 2UUOA 3DZFA 2X23A 1KEPA 4GMFA 3WTCA 2FR1A 5DBIA 3HADA 4B7CA 1NWHA 3TN7A 1K0UA 4DIBA 1UXJA 3KUXA 1X1TA 4CMIA 1I3KA 3EUWA 1DRUA 4UULA 1PJBA 2C2YA 1H6DA 2EKLA 3MWEB 3P5SA 2B37A 1SOWA 2HRZA 5GMOA 4DTIA 3O38A 1Y8RA 3W6ZA 4KTVE 2HCTA 2Y1EA 3GVHA 2J3IA 3L6EA 2LDXA 4DQXA 4I1IA 1C0PA 3D3WA 2A92A 2I99A 1GTMA 2XPCA 4FCCA 4NFSA 3GZ4A 4H7PA 5CP8A 3K5PA 2Q46A 4AJPA 1GU7A 4E2ZA 4P22A 2PZKA 4QT0A 3KO8A 3WYCA 4FPXA 4YJHA 2VT3A 4NU5A 3FD8A 2ZATA 3EGOA 4B79A 5A3VA 1A4UA 2X8LA 3H6KA 4E2XA 3L0DA 1TT5B 4RVFA 1M66A 2CVZA 1IY8A 3JQGA 5ITWA 1NQTA 1ISFA 1E6UA 3IOYA 2GF2A 2JCYA 2LDBA 1LSSA 4KDFA 4R9RA 3V2UA 4E0BA 5JCXA 2Y1OA 2PD3A 1DIBA 3DAGA 2YV3A 4IIUA 3NDRA 3EMKA 3GZNB 2IE0A 1AHIA 1YB1A 1A9ZA 1HKUA 1MFPA 3GFBA 1C0KA 3I6IA 3U62A 1A72A 2AHRA 4BGIA 5FI3A 1P1RA 1XR3A 1CERA 2EHDA 3MTJA 3JD0A 4ZA2A 3MCVA 2VHXA 2AEJA 1XU7A 5KNLA 3ZWAA 2VYVD 4JROA 1E7RA 2QZ9A 5TJ9A 2WJPA 1GCUA 1YKFA 3MJSA 3DO5A 4E2YA 1UXIA 1DC5A 3OEYA 1ZJYA 1R4MA 3ZU5A 2EF1A 4W9NC 4MVJG 4CLRA 3FPLA 3GEDA 2C29D 3I9LA 4CLDA 1EVYA 3GHHA 3RUHA 4BNWA 2OORA 3U5TA 1K6IA 1LDNA 4IM7A 3OSUA 3JYNA 5BSEA 4NNJA 2G0TA 2Y93A 4OSOA 2YV1A 3INGA 4Y8VA 4AJ4A 3CPSA 2P2SA 4ZQEA 1I10A 3MJCA 4BNVA 1I01A 2Q1SA 4XJSA 2F1KA 4ZVVA 4DREA 3ZCXA 2WE7A 3DONA 1OZAA 1O0SA 2IXBA 1E7SA 4G65A 4II2A 2NQTA 5A06A 1B26A 4A26A 8ADHA 3AM3A 1HZJA 1O8CA 1X7HA 1YJQA 2DQ4A 3VOSA 1ISIA 4NFHA 4GLLA 1NP3A 1D3AA 2PZJA 3F6YA 4RF5A 4BNJA 4YT8A 2I66A 1T2FA 4LCEA 3WB9A
chains in the Genus database with same CATH superfamily
1J5EB 1X0VA 1LKZA 1BGVA 2ZVJA 4PYKA 5EEHA 4DXDA 1ZM9A 1Z7EA 3BK7A 4ZO8A 3IPCA 5CIQA 3H6HA 5CVDA 2XECA 5BV8A 2BZ0A 3HL0A 1PAUA 4CL3A 4FI3C 4POAA 2NSHA 2BFWA 1Z25A 2IPOA 3JAWA 1N2CE 1YQWA 4LHVA 2VDRB 3RGGA 4YMIA 4XI9A 3TI7A 5LDHA 5LVAA 4KBYA 4ZI5A 4CQLB 3D6TB 3FPHA 1N5OX 1RYMA 1ADFA 1SC1A 4RJTA 5KOJA 2CDAA 2QRUA 4L0MA 3ODPA 1PFWA 4IIYA 4ZALA 5IYZF 2BGRA 3B3GA 1Q0SA 3PEWA 1IJBA 3KE8A 3TNLA 3MMSA 3P94A 4QOGA 1OXUA 5EZYF 1VA4A 2A9JA 3NHSA 3J81k 2XOEA 5IDYA 3SBEA 2JF0A 2DSNA 2ZDHA 3FFWA 3H1FA 5ALPA 3ZN2A 1UINA 4B71A 4BX9A 2QXTA 3RUDA 3MRXA 3USES 3U7IA 2A1UB 1AV7A 4BJHB 2FKNA 2CVHA 2IOFA 1JDSA 2DKOA 3HM9A 4A3SA 3VKWA 3L5OA 3T7JA 2PV7A 3O31A 3A1FA 4EYKA 1TQ8A 4H7JA 1WKBA 5KYWA 3DBLB 1MENA 5ELLA 1RXIA 1B43A 3CJQA 4NBSA 5B3KA 2BFFA 4LNAA 3ZBPA 1KI1A 1XNJA 4WCVA 3BHMA 3ZD6A 1V1RB 2VYVA 4DLAA 1OC4A 1YU6A 3EIHA 3AMVA 4UEOA 4PSUA 4AQ7A 3HPRA 1GKYA 3DKPA 3AQ4A 4JU9A 4QULA 4BE4A 1NUPA 2OYCA 4Q1VA 1ZA1A 3V80A 3ZPXA 3PG5A 1CDDA 2IHKA 4WXHA 5B58T 4P3XA 3RREA 1IHDA 1AZTA 1NBMA 3OJ0A 5LWQA 5LMUB 3RIYA 4KRXA 1GZ3A 1G291 4RABA 1K6JA 4QRHA 2YW9A 4J90A 5EESA 4Y2QA 4UNRA 1DJOA 2HJSA 2W6JD 2OV2A 3KB1A 3UJHA 1LFAA 4HDNB 2ZIXA 4OOEA 4CE6A 4DA0A 1O3YA 1WD7A 2WF7A 1KI6A 1T5OA 2AKYA 3GZNA 1D8TA 3MS2A 4B7XA 2ZUWA 2Q2WA 1RQGA 3OT4A 2B61A 2SECE 1J0BA 3NRCA 3W2EA 4A1FA 3DR3A 3GG9A 1KQPA 3U7RA 1YFLA 1VE9A 1V2HE 6AT1A 2I6UA 3JVDA 3R9XA 4WNCA 5JCZA 4LGYA 4AJJA 1AB5A 3TD2A 5KWIA 2VHTA 2WJZB 5TS2A 4J7XA 3PA6A 4FS8A 4XQGA 4WUTA 3QYJA 4DUYB 2ZGVA 2IJGX 4O2BA 3QEMB 2REQA 2VHZA 3BERA 3KLOA 4CM6A 5JC1A 5CD1A 2LGJA 1OB2A 3NHBA 2VPTA 4FOLA 3NTUA 4DC1A 3OFNA 3BB3A 3ZHSA 2CJWA 4DANA 2V3VA 2VWPA 4LBWA 4WCFB 2H31A 1GTG1 1G8KA 2C99A 2BFAA 2GTHA 2HK9A 2ZSEA 3IQWA 4V1CA 4BVBA 5CDHA 5KKNB 1HPLA 2FZEA 2PSDA 1PSZA 5IARA 3UHOA 2OV4A 4RS4A 4UU0A 1E79D 2G83A 1VKZA 2V7BA 1TUEA 2KQUA 2QIPA 1A96A 4S1PA 5KSPA 4D44A 3OTWA 5JVDB 2YHIB 4P08A 3GZJA 4WOKA 3KT8A 4URZR 4A6EA 5BURA 3TGWA 1ZIDA 5A5EA 3IPXA 3NYRA 1LVGA 3PC2A 1PE0A 2YY6A 3DZ8A 3KUKA 3PC6A 4MPJA 1PVVA 2PUHA 4HV4A 3UQYS 3LKVA 4R2LA 2P2ZA 1JUDA 3AR9A 1V7PC 3N76A 3PGLA 4JJIA 1RAEA 4M0KA 3VXKA 1BRTA 4CLHA 2IOQA 5GONB 1BKYA 3MM4A 3PPIA 3UJNA 3P20A 4D6YA 1Q91A 4CPDA 3ZV4A 3NTOA 5CJJA 1NUAA 4KQ6A 2RHOA 4HLCA 2ODEA 4G0MA 5DH9A 4MV7A 4KQCA 3RFTA 2C00A 2XWQA 1QFJA 2IYPA 3C98A 2PKWA 2CUKA 5AKJA 4UTXA 1SU8A 2QT1A 4YCSA 5CAEB 1B93A 2HK6A 5JZOA 1ZUD1 1Z6GA 3OPQA 5LKAA 4RFSB 3DOOA 3KV3O 3ZE8A 3BD6A 1QX4A 2PPVA 3UGTA 4UEKA 3B5JA 3TOZA 3K9NA 1JFRA 3TQOA 5L7TA 2ZRQA 3GRVA 3PT5A 2HDHA 4I4TF 1JKJB 4IILA 4EUFA 2WAOA 4DXHA 4YS6A 5IHPA 5ITSA 4OREX 3LDAA 5LDGA 1X86B 3A7DA 2FZKA 3NGXA 5EXPA 2NTYC 2ZU6A 3NIGB 1EWTA 4FSHA 1KOJA 4MRVA 4QOIA 1VI5A 1DFHA 3SX2A 1A1VA 3PRKE 3SJUA 3A9TA 2VZ0A 4URVR 3RBAA 3OIVA 3DBIA 5I9NA 2OP0A 2ZSIA 2JVKA 4RK1A 2DFNA 3V55A 1BX0A 4WK6A 3TECE 3JYLA 1RTKA 1PT8A 2A1UA 1LLQA 1QDEA 4JNKA 4NYIQ 3RU2A 3BSSA 3EGXB 1RPJA 5THXA 4IS3A 1XAHA 2A8YA 5IK2A 3QU7A 4AJ9A 1EB9A 1PCXA 3B2QA 1TEZA 2QT0A 5SYNA 4IXNA 1B41A 2VAPA 4Q3AA 4CG1A 1TO1E 2LIVA 2V7UA 2B25A 3N3BC 4G24A 1IBMB 4UMFA 3UH0A 2JA1A 1V1RA 2GGSA 1TU0A 3ND9A 4XB2A 3M9XA 4ZK6A 2FP3A 4PV7A 5JG7A 3RVRA 4JYCA 2P4HX 4I8IA 4CTOA 1RD4A 3SGLA 4C4XA 5JTUA 3WGHA 2ADOA 2POCA 1UZLA 3DZHA 1C3XA 3S2ZA 2RDMA 5IDXA 2A5GA 1W1UA 4RHEA 3NEAA 4Z3DA 1YUBA 4HDNA 3TIIA 3OJFA 4YRSA 1VXOA 3M6MD 4KQWA 1GG2A 1UXGA 2GFHA 1BYIA 1NYLA 3HB9A 3NNNA 2AG8A 1R0LA 3PCTA 4KAXA 4RJLA 3SJCA 2WT4A 1SXJE 3T8YA 2W90A 3VX4A 1GZUA 3VYTB 3BRWA 1X7ZB 4EECA 2H1IA 4BCCA 1CYDA 4G81A 1OX5A 1N1MA 1I2CA 5BUZA 1I1OA 2BKEA 2ZJ8A 2DAPA 2LBPA 1NUHA 3PGVA 1S8FA 3QEMA 5LB2A 3RG8A 1GQYA 2ONZA 4ZRNA 4M46A 2DRIA 3TOSA 1XL1A 3RNOA 2IFTA 1OR8A 1IUKA 3NT5A 2W6PA 5FULA 5BNZA 7GPBA 4OKSA 4ZQHA 5ILOA 1QWOA 3RJMA 3BS4A 3V3TA 5KKAA 2VOJA 1XTPA 4WCFA 1MGOA 5FL7D 2QM8A 2KJQA 3VVMA 3R20A 5A9SB 4GDMA 2FOIA 2UXCB 2ACKA 4TVSA 4NZOA 4WNAA 2DPLA 5D87A 3HBFA 4MAAA 3JTMA 2V98A 4JXKA 3MQFA 7ADHA 1MQSA 2PMCA 3GFGA 1FSSA 1XTVA 2J3KA 5JVDA 4RULA 3TDNA 1N5JA 3T3GA 4XH9B 3KJFA 2R25B 4KIWA 1L5HB 1Z7BA 4IJ6A 3PQ7A 4JBGA 1OIXA 3DJYA 4WASA 1PDWA 4B4WA 2NO9A 4N65A 4YT2A 4MEAA 1E9FA 1Q5PA 1U6KA 3C2QA 5AW1A 4WD3A 3HJCA 5GONA 5L3VA 3Q0IA 4HF7A 1DIRA 3VSBA 1CWUA 2B69A 1CUVA 1GYPA 1GIAA 4NAVA 5AOCA 1MPTA 5LBIA 1KJQA 3I6ZA 3P9RA 2LXNA 3W6ZA 4A91A 1Q15A 3EVNA 4CLOB 2G1UA 3PUVA 2NVOA 1KSGA 3TE6A 1FYFA 1OLXB 2GYVA 2V96A 1JDJA 1QYXA 1EX7A 1RAHA 3U2QA 1NNEA 3D59A 2FSPA 4BKPA 3HCOA 4BZWA 5DNEA 4K3UA 5CAEA 1LJUA 4LHZA 1F7UA 2JJ2D 4PQYA 4RFSA 4ZCIA 4AKIA 3EFEA 2I1WA 4M9RA 1N78A 2JH9A 3AR5A 3HY6A 4NZMA 3IT3A 4QQFA 1FU4A 3QEAZ 1M2VB 1YZQA 4H4CA 1UDXA 2XNSA 1JKJA 4JOCA 5ALTA 5DSZA 2W0MA 1DG3A 3EVEA 4H7EA 1MH1A 4LX8A 4PO9A 1EVKA 4HQ6A 4QXOA 2AVDA 1NFQA 2BMVA 3FTFA 1NVTA 3BTVA 4F5DA 2HWWA 5L40A 3G5LA 5HOQA 1GUZA 1XG5A 4RVOA 4WGFA 4N5MA 4GE3A 5KZMB 3KOYA 5AVKA 4M8LA 4GPD1 2PV0A 1JDTA 2ZYDA 4Q93A 5J58A 3AVYA 4L7QA 3TX6A 5TEWA 4F9TA 1HETA 3EGXA 1D1QA 2INGX 1DXYA 5DEOA 3E18A 4KPGA 3IA2A 3C7DB 4RDHA 1N0WA 2RI0A 4X3OA 4EELA 4G5XA 5JEDA 1X94A 2OUKA 3CISA 3GWGA 3NAQA 4I4CA 5ESWA 3RIXA 1YQ9A 3HO6A 5K0SA 4CL0A 2VSFA 2VK4A 3LUPA 1AVTA 4LN1A 1NJSA 5CA0B 3N0VA 3IALA 1Z2AA 4H7DA 3W90A 1F0NA 5FLXA 2OHFA 2B4AA 1ZR4A 5ALGA 4OX9B 2FQQA 3CE6A 3SBDA 1G6KA 4WLEA 5CM2Z 5KDDA 3IFSA 3PEFA 5FKJA 1V47A 2QG4A 3I39X 1P81A 4HMQA 2OORC 4NLLA 1XU9A 4F8YA 4P7BA 1VLLA 1KETA 4TXJA 5JO0A 3COZA 4HPWA 3MWDB 2VBGA 3QZUA 1QORA 3MELA 2BCEA 1K7FB 2OYSA 4TM8A 4UAJA 1W49A 3LX6A 1JT9A 3FIJA 3IP7A 2P9HA 1D2NA 1OXBB 3QIAA 3SQOA 1F38A 1HDIA 1JVSA 2RD2A 1FYVA 4CETA 1XTZA 4FZJA 2OPHA 4JT8A 1KP9A 3GT0A 4G97A 4HQRA 5HK8A 1IFXA 2XZLA 2RHHA 3AR7A 4IGIA 3VSEA 3VA7A 1YV9A 2W6NA 1R8QA 3GNLA 1X1EA 5FB3A 1JTFA 2P75A 3VI3B 1ZA2A 3VU3A 2VZEA 1A8PA 1OAOA 3DOFA 4ROTA 1L6IA 3X2EA 5F21A 1RM3A 1BCSA 2PH7A 3P4XA 3PXDA 4G8BA 2V6GA 1WMBA 2P3QA 1Z34A 1Z16A 4YAWA 2KPOA 2P5UA 3BBLA 2IX3A 2GKSA 4AZ0B 3ZD7A 3VO2A 2FUG1 1S8NA 2J4DA 2H92A 1IZZA 2WKWA 3E70C 3I0MA 4RXTA 5IS2A 4DWVA 1HYGA 2BH9A 2HDOA 1ZUHA 5AI5A 4P7JA 1DBSA 1X9IA 1XV5A 2OFOA 4JUCA 3BJEA 1JNXX 4IHQA 5I7RA 1M2NA 1SY7A 3IGFA 3K0KA 4G9EA 2B21A 2QQ5A 1VZ3A 4MGYR 3EGEA 5A9SA 4UDYX 1S2MA 2XVMA 1AKUA 3KVYA 1TL7C 5LN1A 3LVFO 4GR9A 1XOIA 1C1HA 2B2NA 3AY7A 2C9BA 1O94C 4R2JA 3RTEA 3X2FA 2WZDA 2E9SA 3GPDG 2WM3A 4UHJA 4NBTA 5ARDA 3FE2A 4MKIA 1RI1A 1SVOA 2Z9CA 1AMUA 3KETA 3E9CA 3LMKA 1L5HA 3L9WA 1DL5A 1V8DA 3PUYA 4KOEC 3F9IA 4YRMA 1PFKA 3ZHBA 4PR0A 1P3JA 1SVNA 1GA1A 1U65A 2FA9A 3BZBA 5C4GB 3TI9A 5ITVA 2EX4A 3RW9A 5HWSA 1Y1RA 2N0SA 2WKSA 1LDMA 4HHEA 4ZCQA 2DECA 1QTQA 4F3NA 1ORTA 2J46A 1ZKMA 5AW2A 1VBKA 3O8OB 5EJAA 1DKLA 1N8KA 1K97A 2O2DA 3C6MA 3C7CB 2CJFA 3OF5A 3R6WA 3RKRA 3SD7A 3STUA 1EK5A 2AFVA 1JQDA 3OPXA 3Q12A 4FFSA 4E5KA 5FPTA 3R7SA 5GIPE 3HQ4O 2NPIA 3CINA 1AN0A 2VHCA 1OLXA 4QDOA 4HLQB 4Y18A 1SN7A 4LDZA 5JXHA 3QWIA 1CR4A 4MUXA 3QP9A 4DVJA 5LKRA 2XUPA 1JH9A 3NHLA 1QZUA 4K8RB 3P9CA 3MJVA 4P82A 4TRRA 5U1PA 4AIRA 1QPZA 1RPTA 3LWNA 1JLLB 1PQWA 2B6HA 2Q3MA 4OK6A 5CLFA 2I67A 4LEIA 1IMOA 3TPCA 1F0KA 3W5UA 4QYIA 4I7EA 3JCZA 4X8HA 5KNBH 3F1KA 4LJRA 1JF8A 1YQGA 2E48A 4HQKA 3WFZA 4WJZA 2I9KA 5DGTA 1TW2A 1DEOA 4H7IA 4WEOA 4Y1FA 5AOAA 5DTRA 1PWEA 3EOZA 4ESOA 3WP0A 4TN5A 5KVAA 2Z8YA 2J9GA 1I94B 2QGFA 1KIAA 1Q83A 1X0XA 4GP7A 4CYMA 4HOYA 5DNYB 2W8BB 4TWJA 5TPZD 3EHEA 3RRNA 4PZAA 1SA0A 2XMQA 3RHSA 3W5IA 4FYPA 4RIGA 4WNIA 2I71A 5FFFA 5IT0A 2PWAA 1NJ1A 5JANA 4BVLA 1OWNA 3EFBA 3TUJC 4D43A 5E8JA 3VAZA 2EDCA 1UEIA 4PSDA 1GZ5A 1Y63A 3EWIA 4ESHA 4C4AA 1PSDA 5H82A 3DL2A 5CA0A 4OUKX 3FRJA 4KN6A 5EVJA 2RAVA 2XT0A 1E94E 1KZ1A 3DSRA 4GQAA 4M9ZA 4IFIA 3W8RA 1B6SA 3KLNA 5CEJA 2HAEA 1V5GA 1E1MA 3L0PA 1E2EA 1MX5A 1XIVA 3H75A 1BQEA 2XDYA 3K7EA 1Y37A 2QP4A 1MAAA 1A5BB 2G6TA 3FYCA 3PKZA 5D6NA 3ILXA 5AUQA 3OCXA 2FSIA 3OKPA 1CQPA 1YGPA 4HFJA 4L73A 4PNHA 5DX1A 1XHFA 3D31A 1LPMA 2OGZA 3EODA 4ZMBA 4CIYA 3D6MA 3KALA 2QAGC 3I42A 1LH0A 4RBNA 3WKDA 3MWDA 2YZNA 3X3HA 2GO7A 1QONA 1CPYA 3OM0A 1OI7A 5BQOA 4PLGA 4WLOA 1XF9A 4RVSA 4AUKA 1LBTA 2B35A 4OHVA 1ACLA 2GK3A 3ENWA 3VC1A 5JSUA 4OFWA 4U4AA 2GNAA 3MILA 3SS9X 5UKDA 3UCEA 2V7EA 3X44A 5JJKA 5DB4A 3NEPX 3P19A 4LMAA 1G2OA 1K3UB 1XCPA 2C7BA 2PGAA 3V2IA 4EJMA 3LV8A 1OH5A 3CMMA 1XP8A 2DMRA 2JFPA 1OU0A 3JQDA 4PBTA 1I14A 2AIRA 2J5KA 4R9SA 3NHKA 2UAGA 3EIQA 4U3JB 2FPRA 2Y1XA 5JXIA 4HL6A 5B1EA 1X19A 2PKXA 4H0FA 4AZ0A 1LWOA 4OK3A 1M67A 5AJUA 1SRQA 4C2BA 4BB5A 1OIVA 5HJEA 2NO4A 3ORRA 4JBLA 5JSQA 4TYMA 5IM4F 3A9RA 5G2OA 4NBUA 4D57A 1MNAA 2RK3A 3TM4A 5CEEA 5K3CA 1EIWA 4FGZA 4Z6KA 3PLAE 1LB1B 1RQXA 1ZUNA 5CYPA 2GN6A 4LZJA 5KYTA 5L9AA 4Q66C 1QIGA 1XRPA 1XTRA 5K2MA 4WZAE 5CITA 5CH8A 1DSSG 1JFVA 1T2UA 3MXTA 4JODA 4EA6A 2YRFA 4BLPA 3B52X 2BELA 3PQ8A 4IOJA 3KOWA 1CY7A 1Q21A 2EATA 5LP6C 3ZCUA 4B6EA 3HVUA 3D4IA 1Z29A 1Q0QA 3RIMA 4A23A 4EHLA 4YRKA 4JYAB 2NVUB 2LKDA 3SE0A 3NBXX 3JQ7A 1K8ZB 5REQB 4TS4A 4RTMA 3AIOA 5E3IA 3NATA 1YR9A 3M2PA 2VVTA 4HLDA 4LYDA 1A9TA 2PJZA 2VT2A 1UK7A 2V9CA 4BWYA 1R8XA 4LF4B 1HLFA 4NX2A 3AETB 2B1JA 3K70B 3KSMA 3ZWDA 4EEZA 4RGYA 1MB3A 4URYR 2PCJA 5KWVA 1D04A 1X92A 1P2SA 3GGCA 9GPBA 1C7ZA 3U3MA 2YWJA 1T2EA 4LSGA 3HWRA 1H2HA 3KQKA 1JLLA 5LXTB 221PA 1YBMA 3PCRB 1E32A 3CWQA 4D42A 4N9WA 3WG9A 3ZV5A 1OZFA 4KWIA 1F48A 1KDOA 1YVDA 2QU8A 4Q18A 2VCYA 4Q39A 1FDTA 2Z1NA 1LJ8A 5DHPA 4A9AA 3EJ6A 2UUCB 3E58A 4FQ7A 4Q15A 3GGSA 4G0UA 4NU6A 5AKHA 4D46A 1W0JD 2P9YA 3BFPA 2Z56A 5KPJA 2UZ1A 4C0SA 3JAMA 5LP1A 1DPFA 1PLKA 2YIDA 4FYHA 3LLUA 4I8DA 4R71A 4KYVA 2VUTA 4R1MA 3GVCA 4TVBA 3ZW7A 2X8BA 3KHKA 3SHWA 1ZVJA 2W8BA 4LOHA 4B46A 2ZM5A 4DR6B 1F8GA 2QORA 3K70D 2WJWA 5I7FA 1XQWA 1ZH2A 4LZPA 1PT9A 3EGDA 4HB2A 1U4OA 5LLDA 2V6FA 4BNXA 3ANTA 4G4JA 2X9NA 4UNNA 1LBEA 4HNHA 4K7JA 4RLSA 1EJBA 3LOUA 2XQVA 3TTSA 1OAKA 3SHOA 5HZHA 1QOQB 5TF0A 1ETHA 1W7AA 3ZDYB 4D3ZA 8GPBA 4MLZA 3T34A 1E6EA 3L8FA 1E2UA 2H17A 1M1YB 4BS9A 2NAFA 1KERA 2YN4A 5BORA 4EQ6B 5IVPA 5EA2A 3RK0A 5CB0A 5DM4A 1GRNA 2A1IA 3AYXB 1I33A 1STOA 2ST1A 2EP8A 4G2NA 4FYJA 5BWNA 1EZZA 2ZWMA 3T5GA 3WNVA 1R0BA 4FYKA 4MRNA 4V03A 3VU9B 1ULHA 2GETA 4PG7A 5CBPA 5AVOA 1FDWA 4TZTA 4EY5A 3TEMA 2G4LA 1GDDA 1VJ1A 4MJ7A 4TRJA 4XTRA 3FVQA 4HYEA 5JJIA 2IV7A 3UXYA 4O4IF 3EARA 1IXKA 3UF0A 4LI0A 4P80A 4FEAA 1Z4QA 3O1HB 4HAOA 3KNZA 4H7HA 3VUEA 1EXMA 5MDHA 1EB8A 3RU9A 3U37A 1PJLA 5P21A 1H9AA 2HLHA 5HRUA 2IOYA 1GVHA 3L82B 3M4YA 4YRJA 4Q4AB 4M76B 4TL7A 2V5UA 2WHPB 3KQUA 3I1FA 3LOQA 3IHWA 2CFCA 1OILA 4U3JA 5AFSA 3SDSA 1B0PA 4YP6A 2P2NA 4HQLA 5F9MA 2O1SA 2JIPA 2FFQA 3UUEA 2XCOA 3BORA 1Z22A 3EG9B 1JX6A 4ZK2A 2ZYRA 2BGIA 2XAAA 1GRRA 4OQQA 1BYUA 1NXQA 5AI4A 7REQB 1PJCA 4I81A 2VDJA 4LWPA 2G9NA 1QP7A 4N0EA 3DVAB 2PVSA 1SKBA 4JSYA 1ZSVA 3LHSA 2QUKA 1U0JA 2EL9A 2GZ3A 2YHUA 2W4MA 2H2FA 2X19A 3NAZA 4P36A 1S4QA 1EAMA 2OM2A 3A1CA 1QC5B 1OPRA 2OCBA 3OIUA 3V2HA 4W63A 4EZIA 2QB5A 4YQEA 4AJOA 1PS9A 3DGFC 1UEXC 2VQSA 4BMPB 3EDMA 3VPBA 1L7AA 4BVGA 4MGHA 1Z4KA 2QTMA 1AS3A 2RBEA 1NM5A 2QQ0A 4PYNA 5THQA 3AVTA 1XUOA 3KYCB 3LUKA 3PC4A 4LXXA 4FT4A 2NVUA 2B8WA 3FHTA 2H4ZA 3NAMA 4PRKA 3ST7A 1MO2A 2XYRA 3MWKA 1AXGA 2Q0QA 4UDXX 5REQA 1DC3A 4YALA 3LBIA 1A8UA 2R4QA 1L5LA 3DB2A 2QVGA 1IBLB 2P6PA 3LQ1A 1CD5A 3MTQA 3ZWWA 3G8AA 1QUFA 3PD1A 1EUZA 1DEHA 3AETA 1T43A 4LZZA 4AF7A 4DJFC 2WKRA 5GJVC 1G6HA 1KBOA 3EGCA 5IWAB 5IVHA 2B99A 1C3VA 4FE4A 1CRWG 5AJHA 3ZX4A 2HO5A 1QV6A 2VTEA 3DF9A 4QVKA 3L0YA 3DHYA 3IE1A 1E3DA 1P2BA 3HABA 3PVZA 3TSZA 3BE8A 3UHAA 5JJBA 3FWZA 1MN6A 2J3MA 3D7MA 5T57A 5F4ZA 1XWFA 1YHYA 3IPRA 2WU4A 1FFEA 3EUEA 4C01A 2BM8A 4U7WA 1VL5A 3E05A 5IJZA 1C2TA 4MW7A 5KX5A 4FM9A 2AE1A 4QOSA 2OENG 2V4ZA 2WJ4A 3LYAA 4BPBA 1ARZA 4C4YA 3PGXA 4GZ6A 1EDZA 2AOTB 2ENUA 2C3PA 1J1ZA 3FA2A 1OZHA 1SB9A 1X7GA 2ZBEA 4I5GA 3KYDB 4QUIA 1YRWA 3EGVA 3EIXA 2OMEA 1B8OA 2WZBA 1XBTA 3R0XA 3HXMA 1TFRA 4Z0HO 1E66A 2VF4X 3WBBA 1ZJ5A 4DNQA 4N8EA 4QAQA 2Q62A 5DM2A 1YK1A 3GL9A 4LSZA 2HMVA 4V0NA 4YAGA 4KITB 3DW3X 3T12A 2R6GA 3GN1A 4B3TB 1TAUA 1D5WA 1I3OA 4HBGA 3KAPA 4K05A 1G8SA 5A4MS 3ONFA 4NI5A 1XKXA 2P9CA 3NU1A 1KFCB 1TJ5A 1UBKS 4ND1A 5H7XA 2V3CC 3Q11A 4DLKA 3UOWA 2O7SA 3STHA 4B2IA 2R6ZA 2WVAA 4X9XA 3S81A 2W6IA 4QUJA 1VPLA 4YFYA 1AS0A 3D6FA 5JMWA 4M60A 1I6LA 4B87A 3U09A 1A9XB 4PGMA 5J59A 2IYRA 2QZSA 1KJYA 4MYTA 4MH0R 3NONA 3R0VA 3HDGA 4B76A 4QPDA 2PKRA 3IMCA 5D2CA 2X13A 1M1YA 4UASA 5ICSA 1SMKA 4CDGA 3CQ9A 2V6JA 3O4HA 4AB1A 3ZBTA 1ZJZA 1WLYA 5E7QA 1QHGA 1V11B 2HSDA 3AHJA 3FTPA 3Q3EA 3LPLA 4FLEA 5F1PA 3JAKB 2NNWB 3UA4A 3M82A 5TE9A 1MJFA 5IASA 1EK0A 1ADGA 1RAIA 1UM8A 4B3DA 4BMOB 2VI5A 3KQMA 2OXCA 2YOHA 4EFKA 4ERXA 3VU9A 1IU9A 1U4SA 4ALJA 4M9XA 4QPCA 1Z8FA 4IIFA 4TUYA 3QBDA 1KY2A 2C1ZA 4F3KA 4TS9A 3ROQA 3HCDA 5CT5A 3OF2A 1PJAA 1QHXA 3ZZNA 3PGJA 4WGGA 4BLUA 1SUAA 3DLPX 2FSUA 2I1LA 2BHSA 2I3DA 1FNCA 3PYMA 4ZT7A 4M9CA 1RBYA 3RVQA 4CF6A 4QXRA 2Q5OA 5KU1A 4EYQA 5JWHA 1ZQ1A 1JXMA 3L01A 3WHKA 3DO8A 4KMSA 4YMVA 4MB6A 2D8MA 4Q4AA 2O57A 3WO1A 2PS0A 3QQ5A 4AMGA 2WHPA 3WYAA 4CMHA 1P5RA 4E31A 1ORRA 1CY8A 4H4DA 5ALKA 3L4SO 2A35A 5HW0A 2W5UA 5KO2A 1AH2A 3GOQA 1W2HA 1U5AA 3AEXA 4PTYA 5FTWA 5KBYA 4OJTA 4KUEA 2CLHB 4PZEA 1T5SA 2WNHA 3IELA 3R41A 3IILA 1DO8A 3EG9A 2B83A 4WZBB 3EVDA 5MN5A 3FCCA 4K03A 4IV8A 5EE3A 4H1UA 7REQA 2EZ4A 4TTJA 3F90A 3IIJA 4K8OA 4UQLA 4DV1B 1THMA 3LRPA 4QUAA 3QUCA 1QHEA 4LJ4A 3V8BA 5HJ7A 3DVAA 3RSLA 2YJNA 4RDIA 4Z7OB 5C1BA 4RY0A 4LCBA 5ER6A 4KLZA 1U0TA 3A6DA 1GP2A 5LD2B 1QC5A 3CEMA 3IUYA 4ZT4A 3CRW1 3W6NA 2PRZA 3CLKA 4IUBS 3V1YA 5F3WB 4PNZA 1MOSA 4IYRA 2GF0A 2JL1A 3DVQX 3R4CA 1ZSYA 2XUIA 2HPHA 5FJIA 3KYCA 1IOLA 1H5NA 1FYWA 3CJTA 3TBHA 3ZXSA 1E1QA 3IBYA 4RFVA 1CUEA 3M6AA 1SBZA 4J9VA 3C4JA 3ESDA 1E3WB 1MOZA 1Y6FA 4I4IA 2LUOA 2UYCA 4XCXA 4HYTA 5J1SB 2P6NA 3CRNA 1QKKA 3BFJA 1SIUA 2P0EA 2WLSA 3D6AA 1V16B 2II6A 3JQBA 1AKWA 1OI2A 2JGMA 3C7AA 4OXQA 4C4RA 1IY0A 3QKSA 4C7JA 4AI6A 5DI3B 3K1ZA 1D2GA 2GJ4A 1WPXA 4HKTA 4DJ5X 2BM0A 4Q34A 2QN9A 4Z4FA 1T5LA 2E4WA 5CCXA 4M1ZA 2YTZA 1WRBA 2XDQB 3M83A 3WNCA 1LZKA 2Q5IA 2CDBA 1Y7HA 2BM9A 2OCLA 3ANMA 4NK5A 4YJKA 3QHQA 1ZM7A 5TARA 3SZMA 4CN9A 1YCFA 4TZKA 2GXQA 2DE0X 4D8TA 4EA7A 2G80A 3AY3A 1WHSB 2ERXA 2X0DA 1ZZGA 1BHJA 2GFIA 4K9DA 5B1YA 4DV0B 4JB3A 2AOTA 2C07A 1FOEB 4NNPA 2PEYA 5DTEA 2N3ZA 3FFTA 2FG6C 3ROEA 2VTDA 3TFWA 2FWJA 4MQ6A 2B1RA 3MUEA 3PC7A 5G0UA 4B2LA 4DR4B 3TL3A 2ZI5A 3BJIC 5AI0A 1EJ2A 1VQ1A 3JQ9C 4DR5B 4XZ3A 2WJ6A 3RVMA 3GLIE 4LOKA 1PQUA 4Z4IA 3SQNA 2HZBA 4K0RA 3T1OA 1FLAA 2FUG6 3C8DA 1CJBA 3SC2B 1I30A 2NW6A 2P1DA 1NRIA 3WK8A 3LUAA 2TECE 2ON6A 3WISA 5CDUA 3NS7A 1A9XA 2Y66A 1G8JA 3TEJA 2B98A 5EFOA 4BFCA 1BEZA 4ZP1A 4YJDA 2QG9A 4GOXA 4OLHA 3NVKI 3DVRX 4F9GA 1V11A 5JYEA 2B34A 2RK6A 2RSLA 2DUUA 1HDGO 3FNQA 3JAKA 4MKZA 1SQGA 3KQPA 4OHPA 4KIUA 3MD9A 1T26A 3AVPA 3KX2A 3NMUF 4FKZA 1RZVA 1PG5A 3CT6A 3EWAA 1W4ZA 2UZ4A 1TUBB 2QMEA 2R6HA 4GOOD 4HVLA 1PJQA 4B09A 1A4XA 2DQKA 2WEKA 3RS2A 3OF3A 1ZFNA 1TYDE 1ADYA 2DUWA 1O6CA 3R5TA 1SBTA 4J2TA 2C2WA 2IU3A 3A3KA 3M2TA 4KQIA 2CF5A 1WQ3A 2JCGA 1JR3D 4XM1A 1A5SB 4J43A 2I6XA 3IB3A 2BGTA 1U7HA 3E23A 4DQKA 2QHXA 5F51A 1F2DA 1NP7A 1PG2A 2VPZA 1MAHA 2HLDA 5GGXA 3ZHYA 3L84A 4AICA 4U2BA 4L5AA 1GPMA 2AOVA 3G5TA 4GIBA 4Q4JA 3KD3A 4UM9D 3OOEA 4W8HA 3KQHA 4RL6A 3R5HA 1T8RA 2FG5A 3DBVO 3ZHQA 3T9DA 1WZIA 5TIIA 4OQXA 3DUFA 4PN3A 2YJ4A 3GR6A 4D8XA 1HYQA 4PVCA 3F7TA 1K8QA 4WZBA 4BECA 3PNSA 5EZQA 4JZYA 3EG5A 4GX2A 1JFLA 4KX5A 3PWSA 2VP4A 4QBTA 1JYEA 2G1KA 2YOGA 2PSFA 4D99A 4NAUA 1DDGA 2O20A 1SOMA 5HCUA 3TWOA 4LPSA 1FK8A 1T4MA 1LK5A 4HNGA 4E5YA 1ULZA 2YC4C 2BY4A 3LG2A 5EP4A 2V9PA 2OAP1 3VJMA 1KNQA 1IYZA 3QXGA 3OQ6A 4NFYA 1HFWA 2B8NA 3H84A 1OCEA 1N2SA 1TJYA 4LBZA 1JTVA 4LKOA 4X00A 5ARBA 4BFLA 2R8EA 3OIFA 4EFDA 1CYEA 2KSQA 3LW7A 5FAKA 1GPYA 1KK0A 1TEVA 2GTPA 2OT3B 1GITA 3ECAA 3NAGA 4GRIA 4EARA 4R1QA 5FBVB 1QGDA 1FP1D 2VLIA 4G5QA 5A6SB 4JQZA 1UBTS 3I28A 1SBQA 1T9BA 5EJEA 1E3WA 3K32A 4BLVA 4JAVC 2IY8A 3K71B 1E6CA 3EY4A 3N7AA 4OJYA 3SI7A 3SIXA 2KWIA 2PFGA 2ZZKA 4R40A 1XAGA 4M89A 4GYWA 1GV1A 5KTRA 3DHWC 1OOEA 2W83A 3IAS1 1AQUA 2AMFA 3T9CA 1JDNA 1L5FA 1BD3A 2WWRA 2BM1A 1H3EA 2QLMA 3BOSA 1W5TA 2WVJA 4PU0A 1JWAB 2H5EA 3MHPA 4HR7A 4KYIB 1H6BA 1R1DA 2XDQA 4OM7A 3RVLA 1EP9A 2REXB 4OHOA 2POQX 3QEJA 4MYDA 5D85A 3OUUA 3LPDA 1XDUA 3F1LA 4B73A 5EMJA 1JKMA 1XD9A 1IWOA 3RE1A 1ML3A 5AVVA 2PZ8A 2C1EA 1LPSA 1WHSA 3BWYA 2OVBA 1ZKDA 1R5JA 2YNMC 4JIGA 2JHPA 4Y1RB 4AO7A 2YMLA 4X1IB 4YN3A 1A27A 3O5AA 3O7WA 2H06A 5G3YA 2HSJA 2O8VA 3A32A 4IJMA 1A88A 1AURA 1P77A 2ZRNA 1G2PA 5JZ9A 2MCFA 2P7HA 2W93A 4XDHA 4FP9A 2AMJA 1E5LA 3ORQA 3D2AA 4JMPA 4X24A 3NIDB 4JWTA 4PF1A 4PIVA 4OTZA 4DSNA 1DKRA 1KA9H 1RC1A 4OQZA 7MDHA 5L6MB 1N7GA 3HM2A 3AZQA 2HU5A 3SC2A 1FNBA 3QVUA 4P53A 3VMFA 4WADA 1NG9A 1FSPA 3G2JA 3HVIA 1QH0A 1IDN1 1JQBA 4L7VA 3DC2A 3PKJA 1BMFA 2IGBA 2WK1A 5E1BA 3VC3A 2O8BA 1EK1A 2XMGA 3PDIB 3ZJVA 1VIDA 1YMUA 2GJAA 4NESA 2OY0A 2EFEB 3TCKA 3WL3A 2IYFA 2WMDA 3BE4A 1DBIA 2YWEA 3HDHA 4TN1A 4WBSA 5FBHA 5B1SA 4YQFA 1WR8A 3WYNA 1B3RA 4Q9AA 3RNLA 3CM0A 1IOWA 1VJDA 4MB2A 3L6RA 3M6FA 3HB5X 4F5ZA 2JIBA 3CCFA 3I2YX 3PXXA 1HG0A 4LDJA 4AG5A 1Y3CE 1YK0A 2A88A 5KHAA 4CM1A 5DNUA 5KNBD 2WJVA 2ECOA 1JJFA 2TS1A 3S5UA 4PCUA 1E8MA 1FDVA 2EFJA 3IJ5A 3WLLA 1JAZA 4BN0A 4ZYLA 1T91A 2CXPA 3QLTA 4KKVA 5KC8A 3Q2IA 1C7JA 1JG4A 4MW2A 2FY8A 7YASA 4ROSA 3EAQA 1T4GA 1ZWLA 2CUNA 3RS0A 5P8WA 3HJGA 2X7JA 3B1WA 2PA0A 4QOHA 4QUDA 4Q01A 3GPCA 3R7NA 3C3WA 4PRZA 1DXOA 1Y81A 2I1VB 4CM8B 4GICA 4C5CA 3BAZA 2YWFA 1TF7A 3LK7A 4NHEA 2RH5A 5IVDA 4BTEA 1MA0A 2YWRA 2GEFA 3CEPB 1VKHA 1ZU5A 3NHJA 4N0DA 3NNDA 1TQ6A 1X70A 4H77A 4GI1A 1TMOA 2MIIA 5C5EA 3S28A 4PZPA 2P9GA 1I3CA 4WKGA 3WIOA 4WERA 3UJ9A 2UUBB 3EVGA 1ZSNA 3A4TA 5JD3A 3T94A 3FRIA 1G98A 4E51A 4DQLA 1VECA 3A2KA 2XDAA 2QM7A 3UPTA 4RNDB 2Q45A 4KH1A 1LF5A 4GLJA 2NXCA 3Q7SA 1BDIA 4ZPXA 3JXEA 3O9ZA 1CUHA 3EAFA 4L78A 2CZCA 3VRHA 1DIOB 1IRXA 2GZ1A 3DFKA 2EP7A 3QX3A 2P0AA 1NVKA 1P61B 1T2NA 4JKYA 5LOVA 1QMGA 3SKVA 3ZWXA 2O5EA 2G5CA 2ATVA 2YQ4A 4MINA 1JHUA 3ZJUA 4DMCA 3HEAA 3K9LA 5A6SA 3OA2A 3WP1B 2IZOA 4ER7A 4FFMA 3AW8A 1OPXA 1N36B 3E7PA 2P9BA 1UXOA 3B6ZA 4OD0A 1P74A 4JVNA 5K8IA 1Z5GA 5A05A 1VFNA 1VCNA 2M98A 4ZOLB 2ETXA 4XYGA 1QX3A 2GOYA 1DGQA 4HH1A 3WB0A 5COQA 3PB3A 5K0GA 4J3JA 1WCWA 4LQLA 4P5DA 3M1YA 4Q12A 4QSMA 4MI1A 2YWHA 1VMAA 1RKUA 1DT3A 2H18A 3PD7A 2AN3A 3PQCA 1PNVA 4JJZA 4L4ZA 2HSWA 4QATA 4Y2YA 4MDEA 1FLDA 2Q6KA 1ST2A 4KMRA 2WIBA 2V8OA 2WF8A 4CKEB 2B4KA 1U28A 3CSSA 4LX0A 2JGNA 2AOXA 4K2AA 3KKOA 1Z0FA 1H2WA 4C2UA 2VRCD 3TW6A 1PJTA 2YXPX 2HQRA 4TTVA 5JATA 1F3OA 1RFGE 2ICAA 4UQOA 2JG3A 2VNHA 4YRGA 3I2KA 4Y1RA 4X1IA 1DJMA 2E4XA 1E1DA 4WXPA 5DBHX 3WFIA 1HDXA 1VKRA 1A2QA 1E2IA 1U2QA 1XN1A 3DEFA 2PRJA 7AT1A 2WJYA 4LQ4A 2CBGA 1NLMA 2XXBA 4TXMA 3QV1A 1VP3A 1VZ2A 3JWHA 2G5TA 3HVJA 1Q0PA 4NR0A 4DIUA 3BICA 2HQOA 4ITUA 4QIHA 1MMFB 5KNBA 3DULA 3BIXA 2Q5FA 1KY3A 1DHTA 1HE1C 1YUMA 3HU1A 5EMNA 4L8GA 4F21A 3UK7A 1MRNA 2R0QC 5F35A 1K27A 2DHRA 3OP1A 3ADPA 4L8VA 1T6ZA 3PDUA 5JMOA 4DIOA 2QMZA 1LA2A 1C1XB 2ZBUA 1RE1A 3EXIB 3M6VA 3NUZA 1U8CB 3A6ZA 4KNWA 3I1JA 1CSEE 4YA6A 5EP3A 4Z1MA 2W2KA 2QRLA 2HB6A 3PDIA 1Z62A 4P0TA 4C6RA 3DM9B 1VHWA 5CDYA 5JPCA 1DOZA 3BXOA 1MLDA 3NPAA 4BFUA 5KB3A 1N75A 4G67A 2OO5A 4GBJA 2YHSA 3H6GA 2AW3A 2QZJA 4XGQA 4P32A 3R2JA 4Y30A 4DSZA 1UBLS 4YRDA 4KV9A 3ROXA 1GPJA 4AY2A 3K72B 4YI3A 3OCJA 3CZ5A 4KVGA 3SAJA 2I55A 2GAAA 1GZVA 2ZREA 3PVSA 4D4HA 1M2KA 1SHJA 3ND7A