3WLFA

Crystal structure of (r)-carbonyl reductase from candida parapsilosis in complex with (r)-1-phenyl-1,2-ethanediol
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
335
structure length
335
Chain Sequence
SIPSSQYGFVFNKQSGLKLRNDLPVHKPKAGQLLLKVDAVGLCHSDLHVIYEGLDCGDNYVMGHEIAGTVAAVGDDVINYKVGDRVACVGPNGCGGCKYCRGAIDNVCKNAFGDWFGLGYDGGYQQYLLVTRPRNLSRIPDNVSADVAAASTDAVLTPYHAIKMAQVSPTSNILLIGAGGLGGNAIQVAKAFGAKVTVLDKKKEARDQAKKLGADAVYETLPESISPGSFSACFDFVSVQATFDVCQKYVEPKGVIMPVGLGAPNLSFNLGDLALREIRILGSFWGTTNDLDDVLKLVSEGKVKPVVRSAKLKELPEYIEKLRNNAYEGRVVFNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords (R)-specific carbonyl reductase
publication title Unconserved substrate-binding sites direct the stereoselectivity of medium-chain alcohol dehydrogenase
pubmed doi rcsb
source organism Candida parapsilosis
total genus 97
structure length 335
sequence length 335
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2013-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wlfA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3wlfA01
4UVGA 4CLOB 1ML3A 1ADGA 1SCUA 1EFLA 4A10A 1BDMA 4L73A 1DBVO 1LQUA 3B1KA 4XIYA 1TT5A 1SB9A 1UXJA 1MB4A 4MJLA 1WDKA 4NI5A 4GQAA 3ZWVA 3F4BA 4PLVA 4BO0A 4GX1A 2ZB8A 2TMDA 3VKVA 3PFWO 5KVVA 1ULSA 1QRRA 5JO9A 3ZGYA 1ZSNA 3DBRA 1ZUD1 4YVFA 5KVCA 3M6IA 1C14A 1GEGA 2O3UA 5CFZA 4K1LA 4MIYA 4RF2A 2FZEA 5BQFA 4XYMA 3MOIA 4PZCA 2NACA 1PGPA 1O89A 1CWUA 3INGA 3HQ4O 1N9GB 1ZKMA 1BMDA 4M87A 2GDZA 4AJNA 3G3EA 2A92A 2EIHA 3GVIA 5A3VA 4ESOA 1WMAA 3ADPA 2DPGA 3PLNA 1Z7EA 2EGHA 4GWKA 3JD0A 5B12A 1LLQA 2X22A 4D3SA 3PZBA 3D0OA 1RWBA 3WMXA 1YL5A 1HDYA 3L4SO 3VZSA 5A1TA 4L0QA 3KYBA 4YT5A 4P8RA 5DNAA 4UVIA 2HMTA 3WOHA 2BI8A 1Q0LA 4Z6KA 3UHAA 2ZKLA 1PGNA 4E2WA 1Z6ZA 2QQ5A 3F5SA 3HN2A 1ID1A 4IIUA 3W1VA 4R5MA 2I5PO 3H2ZA 5ILOA 1P1RA 4AL4A 1VJ1A 3I4CA 4YACA 5CDGA 4I9NA 2AEJA 1MV8A 2RIRA 2GN9A 2Q2QA 4RLSA 3LC2O 1DC3A 1O95A 2NU8A 2O2YA 5TS3A 1Y5MA 3BMQA 4A26A 1WZEA 5JAIA 3ENNA 3ON5A 5TT0A 3W4IA 2D59A 5H82A 3I4FA 3ZW8A 4J2HA 4AJLA 1VE9A 4BB6A 3ORFA 3EZLA 3RIHA 1A5ZA 1X15A 2X0RA 3JQ9A 1IE3A 3U4IA 2JHFA 3ASVA 2JKVA 4IDDA 2WEKA 1KEWA 3EYWA 3N7UA 5BNTA 3VKUA 3PEFA 1Q2XA 2B4TO 3C7CB 2QRLA 3WYEA 3INTA 4WOJA 1NAHA 1E7RA 1H6CA 2CD9A 3BMCB 3OHSX 5FFFA 4DTIA 1HYEA 3A1NA 3R1IA 2GN6A 4RDHA 3I6QA 3ITKA 4YR9A 4F3YA 1UZNA 3JSAA 1LDYA 3E9QA 1J49A 2EG9A 3RQSA 4R1SA 1PGQA 1QXSA 4K9DA 1M75A 2QZ9A 5TT1A 2QIOA 2FPPA 1JAYA 1P33A 3H9EO 7MDHA 2A9FA 5I7VA 1EFKA 3PGXA 3OIDA 4XRRA 1KEUA 2BFPA 1PJBA 4HBGA 3WGIA 4TRRA 1NFRA 1WW8A 3ANNA 4IJWA 5JMPA 1ZK4A 2W8ZA 5IN5A 1GV0A 3FF4A 3GR6A 3MEQA 2BH9A 1V6AA 1PSDA 1KERA 4RQUA 1L1FA 3WLFA 4R9RA 3ITDA 3ZV4A 4BO3A 3DB2A 1U28A 3G0OA 4OH1A 3AI1A 4URFA 2GPTA 1P1KA 1E7SA 4XZ3A 3FWZA 4XRGA 2HU2A 3U09A 1XG5A 3QIVA 1AHIA 1B3BA 2CDAA 3P5SA 3HFGA 3QWBA 4GX5A 4WGGA 1DIBA 4F45A 1P1HA 2CFCA 3ADOA 1WP4A 3ONDA 3OJLA 1HSOA 4YAJA 3PZRA 4NPCA 3GFGA 4CR8A 3K6JA 1O94A 2FP4A 2NVUB 4J4HA 2ZB4A 2AQKA 1ZMTA 1IHXA 1T1SA 5CDTA 4L76A 4FGSA 3B70A 5L9AA 2PK3A 1XU7A 3L0DA 1AN9A 1N2SA 3TL2A 2O2SA 1PJ3A 1NWCA 1N1EA 2GZ2A 1I10A 3BAZA 3GH3A 4YAGA 1XQ6A 3C3XA 1K6IA 4FJ0A 1DSSG 3B1FA 1ONPA 3JD4A 2C59A 4XYGA 1E3JA 2AG8A 3RJ9A 3OFSA 3ROKA 3O38A 1GADO 1TLTA 4BNHA 5MDHA 2IXAA 4ITUA 4IQGA 1QR6A 2YQ5A 3CH6A 4I5DA 1OMOA 2D8AA 4MVJD 4BGEA 4FGWA 4AJPA 1NVMB 2OP1A 1Y8RA 4DREA 1NHWA 1PX0A 1G0NA 4CLHA 4U6QA 2QYTA 4J4BA 4U6SA 1GY8A 1N7GA 4NMHA 3FD8A 4MP6A 1MXFA 4QUKA 3RAJA 3UFXA 4FR5A 2Y1DA 2D2IA 4EZBA 1QYVA 1LSOA 2B5WA 1KVRA 2AE2A 3GLQA 1KBZA 4N7RA 4LK3A 5G4KB 4JQCA 1WNTA 4BO9A 4XQGA 1EDOA 3T4XA 1MFPA 1TA4A 3DBVO 2P91A 1Y8QA 4A5OA 1NQTA 2ZTVA 4BNKA 3IIEA 3DOOA 1ADBA 3RU9A 1UXIA 4D43A 1NAIA 4GH5A 4E5NA 3OA0A 4E4YA 1PJQA 4IJUA 4QO8A 2JCYA 3PK0A 1SPXA 3JV7A 2QZZA 1P9LA 3ZCXA 4HUJA 3JQ7A 2Q3EA 3T7CA 4WCFB 3DBHA 4D79A 5B4UA 4YJGB 1B8UA 1LSUA 2CF6A 5CAEA 3FI9A 2DLDA 3ENKA 5TGDA 5ILGA 4PLTA 2P9GA 3FPCA 5BNIA 4FQ8A 2AXQA 4PZEA 2CVQA 5JFOA 1CYDA 5F5NA 2BFOA 4GSKA 1WDLA 3VDQA 2JFHA 3N58A 4AFNA 4IBOA 4WLNA 3E9NA 2FR8A 1DRUA 3VPXA 2B5VA 1R4MB 1M6WA 3BTVA 3UICA 1UAGA 2DKNA 2B4RO 4OMUA 1XR3A 3QVWA 2NTNA 1E3WA 1GQYA 5F1PA 4XYBA 4JNKA 4GMFA 2OBNA 4QSMA 4WEOA 3AUSA 1E7WA 3CEAA 4OM8A 4YRDA 1ISIA 3DC2A 4RQTA 5L95A 5TJ9A 1SEVA 4CUKA 2DBQA 4U8GA 4WLUA 1WXDA 2B69A 4UEKA 3HADA 2G76A 5T67A 1DHRA 4H3VA 4WUVA 2J5QA 5IDYA 4MVJM 2GR9A 1YRLA 7ADHA 1U3WA 3IUPA 3PHLA 1ZMOA 1P74A 3WGOA 2YHIA 4YAEA 4QO7A 4P4GA 4GVXA 2Y66A 2E49A 1DPGA 3LF2A 1ZBQA 3OF2A 3OIFA 3UCEA 4E32A 4YAIA 5IZ4A 2PKRA 4EJ6A 5KVSA 4NHEA 2YQ4A 1DXYA 4E5KA 1XYGA 3KYCA 4DPMA 4ZD6A 1PJTA 2EGGA 4DIOA 4ALKA 1E7YA 1OBFO 3MJEA 5BNFA 1HDGO 2NU9A 3FRJA 2SCUA 2OORA 1K6JA 1QYWA 4ZVVA 1H9AA 1P45A 2AQ8A 4K28A 2EW2A 1HT0A 3ZWOA 4OJNA 5KJEA 1H2HA 1VI2A 2GZ3A 1AE1A 2EEZA 4RL6A 1E92A 2EJVA 4RDIA 1PJCA 4FC7A 4JIGA 3ZV3A 5DT9A 4BKRA 3NYWA 1B3RA 3WYCA 1VL8A 2NVWA 4R41A 5EQFA 4AJJA 2HKIA 2I99A 5KIAA 3SBOA 5DCUA 2RH4A 1WVGA 3DZHA 1ZCJA 1JA9A 5THKA 3WMWA 4AJ1A 4NU6A 3G79A 2RCYA 3NT2A 1EZ4A 2BGKA 4RVGA 1TT5B 1EBUA 3ZWWA 4Y98A 4ZQHA 4CLRA 1NBOA 1I3KA 1R0SA 4CMEC 3FR7A 1C3VA 1YOVB 2OGUA 1F8FA 4I5FA 4J2OA 5AXAA 5A9TA 4HFJA 4MIEA 5C7IO 4BO1A 3H9JA 2Z5LA 3DBRB 1HZJA 2EF1A 4YRBA 4EJ0A 3FR8A 2VRCA 4NQZA 3RI3A 1PGOA 3GVXA 3EUWA 5EQDA 1SAYA 2C0CA 1MP0A 4LSMA 1JQBA 3NJ4A 4NBWA 4E6PA 1YE3A 4DXHA 3JQAA 3WNVA 4XQEA 4QEDA 4IDGA 4TQGA 5TSDA 1Q7CA 4KUEA 4MVJG 5U4QA 1W0CA 2Y1EA 3F1KA 3P7MA 4EYEA 5EN4A 4CMIB 4L75A 3KSDO 2FN7A 1N5DA 1D8AA 2NQ8A 5CDUA 3I9OA 2WD7A 3OBBA 2P5YA 3P19A 3A28A 4FCCA 1V35A 3DTYA 5GMOA 3LU1A 4OKNA 5IXYA 2VZ9A 3DZKA 2F00A 2QG4A 1DFIA 3QA9A 1KOLA 3FNEA 4O59O 3WGHA 4OO3A 2FR0A 3CMMA 2OOSA 4UVDA 4F46A 5CG2A 3NT4A 3HHPA 4AJ4A 3E6AA 4KTVE 3DTTA 1M66A 3U0BA 3DFUA 4NJOA 3OQ6A 5BSGA 2J3KA 2Y93A 4H16A 1L7EA 4OXYA 1O6ZA 1V0JA 1LQTA 1EUDA 1VSVA 3PHIA 4W9NC 1R37A 4AJ2A 4E13A 1G6KA 4EUEA 4EUFA 4ONEA 4FFNA 4QX6A 4UUNA 4KWIA 3I1JA 1P1IA 2VN8A 3BMQB 2HMSA 1BSVA 3ANMA 1I32A 1J0XO 4AJIA 2I3AA 1LUAA 3CINA 4XWYA 1EE2A 2OFPA 3P2YA 4BB5A 1E6EA 4R4JA 1JKFA 2Z1MA 1U5CA 3KVOA 1K5HA 3E18A 2BHLA 4WECA 4YRAA 1H5QA 1XA0A 5A9SA 1YBVA 2WYVA 1DIGA 3GPDG 4PRLA 5DBFA 3TQHA 1FDTA 1GU7A 4TRJA 4CMEA 2ET6A 3RKRA 3I9JA 3SLGA 1I8TA 1DEHA 4YA6A 3WICA 1GZ3A 1YS4A 2PWZA 4PLHA 1JAXA 4L4XA 2NU7A 2IYOA 4XCVA 3PQDA 2P5UA 3WWZA 3BXXA 4R3WA 3NT5A 5G0TA 4BNMA 3PQEA 4WK6A 3WYBA 4BHTA 1ZK3A 3GDOA 1D1TA 4E33A 2W2KA 2F1KA 1ZJYA 1QYDA 3HDQA 5L7TA 1J5PA 3ETDA 3OEWA 1ZXBA 4OXNA 2H6EA 2DPHA 2VZ8A 3STHA 1HEUA 1UAYA 3GMSA 2NLOA 3EMKA 1UDCA 3O26A 3PVZA 1HE4A 2P4HX 3NTRA 3ZWXA 1HE3A 4AJHA 4B3JA 4D42A 3C7DB 3EY4A 1WDMA 3WSVA 3ZWBA 1ZK0A 5TC4A 1NQOA 4PG4A 1I3MA 2DBZA 5I9LA 4YBZA 3KYDA 4NBTA 4I5EA 4NBRA 1U8XX 3DZIA 3PHGA 4BV8A 3QP9A 1M67A 1XWFA 3D3WA 1HWYA 4J1QA 4BO7A 1QLHA 3D4NA 1FDVA 1NVGA 5DP2A 1ZK1A 4IJVA 3U4HA 1LI4A 1Y7TA 3IKVA 4M89A 2JHGA 4W9NA 1PWZA 2EKPA 4EEXA 4DBVO 1YO6A 2AG5A 4UUPA 3H9QA 3GUCA 5I7FA 2I65A 5L3ZA 5IZCC 2WMDA 4GSLA 1EVZA 3GZNA 4PCVA 5CPBA 1LDMA 1OAAA 1NPYA 4FC6A 4CM3A 1H93A 2OZPA 3UCXA 3I23A 2I3GA 2VT2A 1VSUA 4B3HA 1R4NA 2YZ7A 3ZWMA 2R00C 3ASUA 1B8VA 5LDGA 1UUFA 2YHUA 3JQDA 2C7GA 3SLKA 1UDAA 2AQHA 3BMOA 3HB5X 4FFOA 5AQ1A 4B4WA 3MJTA 4BO4A 4PLYA 4E21A 1HLPA 4XB2A 2B36A 2P2SA 3ZN2A 1HYGA 4EUHA 4D3FA 4B3IA 1FDSA 4DMLA 3GEMA 5CP8A 2ZYAA 4WOKA 3Q3CA 2HDHA 2X5KO 3HB4X 5A3JA 1HZZA 4FFPA 1BXZA 2ZTUA 3I9NA 4YPOA 2FPGA 1JTVA 1XIVA 4NFSA 3U49A 3ZWNA 2O7QA 4YJHA 5A05A 3WGYA 4LMPA 2BI7A 4JJFA 4OSOA 2BELA 8LDHA 1EVJA 1I3NA 1VJ0A 2GO1A 4J3FA 4A73A 1U3UA 4KOAA 3WIDA 5JNLA 5ER9A 3DMYA 4HV4A 4KZPA 3JYPA 4CMBA 5A06A 1Y8QB 1U2DA 2J3JA 2OBYA 2X0IA 3ZHXA 3WGGA 1NXQA 4E2YA 2GRAA 1W6UA 1A7KA 1T2CA 4K26A 3JD2A 1UJMA 1PQWA 2IDZA 3PI7A 5TQVA 1HRDA 4E12A 1GDHA 2YYYA 4UAGA 4GLLA 3RUEA 4OOFA 3WQQA 3QWHA 4GPD1 3TZHA 4CODB 4Q3DA 4RORA 3DBHB 3WB9A 1DFGA 1EUCA 1DAOA 1YBMA 1D4FA 1NP3A 4BKQA 2NM0A 2JFGA 4LN1A 2V6BA 3GRPA 1JVSA 5C37A 4YQYA 2I9PA 1DJNA 4O5OA 4RVUA 4BUCA 2B4QA 2WYWA 3O4RA 1LBEA 3MZ0A 4KTTE 4A2CA 5C3MA 4CQLB 5IZCA 4BGVA 2Q45A 2D5CA 3L6OO 1H6AA 4GWGA 3O03A 1VRWA 1U8FO 3VH1A 6LDHA 2IEBA 4NBVA 1GPDG 2PR2A 3H2SA 4XIJA 1T1RA 4YYZA 5KJ6A 1ISFA 4BGUA 2Q1TA 5EERA 2R00A 2RBEA 1FDUA 4RPLA 3QE3A 3PWKA 4NK5A 3ZW9A 3GN1A 5AVOA 1VM6A 4PLZA 3MTJA 3PIDA 4KDEA 3EDMA 3QQPA 2WDZA 3MWDB 2GN8A 4GAEA 4CMKA 2VWGA 3G1TA 1SOVA 3IL2A 3U9LA 4BKOA 1B16A 1BXGA 3ZH2A 5A4DA 1O5IA 4J7XA 3DHEA 1N7HA 2O3TA 1FXSA 3A9WA 2QRKA 4AG3A 1FK8A 1QORA 3ONFA 2P9EA 3RC1A 1CIVA 2Y0CA 2Q2WA 2VCYA 1KYQA 4B7CA 4WEQA 1XCBA 3RSHA 3GNSA 4J1TA 5G0WA 4IIVA 2OUIA 3RVDA 4NR0A 4NDNE 4Q9NA 3SJ7A 4BO2A 2YHIB 5ITWA 1HE2A 1KC3A 2PKQO 4JP3A 4QQRA 4PG6A 4PLCA 2IXBA 3IOYA 1ONOA 1PWXA 1EQ2A 4O6VA 1MX3A 4YEDA 2C2XA 2GASA 2AQIA 3PXXA 3GOHA 2ZQYA 2GNAA 1MXHA 4IS2A 5KJCA 4TZKA 3AM3A 3TFOA 4IDBA 4ZN6A 2LDBA 4CM8B 4RJTA 5KJ1A 3EVNA 2WTBA 3CZRA 2YW9A 1U9JA 4NNJA 4Z3DA 1YGYA 3QLJA 2G5CA 5A02A 1B0AA 4UREA 1A72A 2DUWA 1Y9EA 1ZEJA 4XGNA 4WLFA 2X1HA 3K92A 1C0IA 1GCOA 4QFCA 3BHIA 5CPFA 4EEZA 4BV9A 3SX2A 2O3SA 1ENYA 1C0KA 1ZW1A 3DWFA 4U0JA 1E1MA 4DIBA 1CERA 2O4UX 4GI2A 3UAGA 8ADHA 1E3LA 3DONA 4CMHA 1A9YA 3H3FA 4UVEA 1XLTA 2NQTA 4CV0A 1E7QA 1C0PA 4XB1A 2X23A 1PL6A 3CZMA 3FPLA 4XJSA 3IP1A 2C82A 4CLRB 4J1NA 3H5NA 4RF3A 4IDEA 3DOJA 1UDBA 1U4SA 4NU5A 2Y1OA 3JYLA 4AJEA 1PZHA 4QTZA 3U4DA 1R0KA 1ZZEA 5K6AC 3PPIA 3GDFA 1UP7A 1A27A 3OP4A 3X2FA 3NDJA 4CR6A 3RROA 2QX7A 2ZTMA 4ZQEA 3TZ6A 1LLUA 4ND2A 5EINA 5I9MA 2HMVA 3C1AA 2POQX 3DFZA 1DLJA 2Q50A 3RWBA 3CXRA 3RUCA 1PIWA 3H9GA 1K2WA 3UGKA 3RD5A 1I0ZA 3BMNA 4MVJP 3WTBA 1BW9A 4JLWA 5FYDA 1GYPA 1Y6JA 1ZSYA 2VYVA 3HDJA 5K0ZA 1Q0QA 2WD7B 2X9GA 4PFJA 3WGQA 1GYRA 3WJ7A 1XDWA 4II3A 3ROPA 5JW6A 1J6UA 4NIMA 3KOUA 3RC9A 1XHLA 5HS4A 1MG5A 5BSEA 3JQ8A 2C7VA 3GY0A 1LNQA 4M8SA 3QVTA 3JQ6A 4NG5A 2ZCVA 4DYDA 1Z74A 1V9LA 3ZI0A 5CEJA 4Z0PA 3DMTC 1I24A 4RVDA 1BVUA 2BLLA 1TVEA 1P0FA 4G5HA 3PJDA 4Q3AA 4YT4A 4P4LA 5H83A 4BO8A 1E3EA 3CUKA 3R3JA 4O0LA 3BHJA 3DBLB 4TKMA 4Y9DA 5KWEA 2HLPA 4XQ9A 2H1SA 4YT2A 5C5IA 4XEHA 2YDXA 4PN3A 2ZB7A 3CPSA 5IXSA 1Q7GA 4BVAA 3U4CA 2WWRA 2H5LA 2VHZA 5ES3A 3R0IA 1XSEA 4DPLA 1GQQA 1PR9A 4J49A 1GUFA 2HUNA 4OKIA 2G82A 3H4VA 3AI3A 2XAAA 3PHJA 4HNHA 5CG1A 2JD0A 3D4PA 5TRTA 1U7HA 3IP3A 1GCUA 3MJCA 3M1AA 4XR9A 3L77A 3BYZA 3HSKA 3MWEB 4EJMA 1P44A 5DDIP 2O7SA 1PGJA 1ORRA 3TZQA 1DAPA 1GUZA 4FPXA 4CLEA 1NFQA 3JQEA 5K6AA 4CV2A 1EUZA 1KY5A 3WX0A 3TZCA 3ROMA 2VRCD 3AOEC 1ADFA 3UUWA 1SOWA 4WKGA 2VWHA 1EVIA 3ICCA 1PZEA 2CNBA 2PV7A 3E5RA 4YDRA 3JQAD 2BF7A 4IQ0A 2W2KB 4AVYA 4Y6RA 2Q1WA 5AOVA 2J5RA 3JQBC 3ZHBA 2HSDA 3ZU4A 2G17A 4N5LA 4ALNA 5KCZA 1Y81A 1OFGA 5DN9A 2E4AA 2Q4EA 4FDAA 1V8BA 5EL0A 5TJHA 2Q1SA 2WSBA 1V3UA 1NWHA 3JQGA 1HDOA 4FW8A 3WGZA 2X7HA 4CJXA 2VNAA 3ZWYA 5H81A 2X58A 2J3HA 1JW9B 4BMVA 4ALIA 2EHDA 1PJSA 4J6FA 5IG2A 4H15A 3WQRA 3NDIA 3D3WB 3DMTA 1T25A 5IN4A 3AM5A 3KEOA 3H9UA 5LC1A 5A5EA 3NTOA 3MJSA 1YDWA 3NRCA 5B4TA 1Q1NA 1XU9A 3FBGA 1W4ZA 1GUYA 1H0KA 1UP6A 1C1XB 1QSGA 1NR1A 4I08A 1Z75A 1ZEMA 1HYHA 2P9CA 3KB6A 4LVCA 4BKPA 2QRJA 4RV9A 4XGIA 4B7UA 2QHXA 4NBUA 5COQA 3HDYA 4RF4A 4BQPA 3DZFA 3GZNB 3WIEA 5A9RA 1C1DB 3W8FA 2ILTA 3NJ8A 4YJFA 4JGBA 2PZLA 1KIFA 1PL7A 2CVZA 3KLPX 4CLOA 2JCXA 3JYOA 5JLAA 4NH4A 4MKRA 1WPQA 4UUOA 2BD0A 5HM8A 1X14A 1E3IA 5THQA 4CQMA 3IKTA 3BMOB 2VTEA 3HFSA 3M2TA 1ZNQO 4ZJUA 3DOCA 4IXTA 4C4OA 2OXIA 2AEMA 4RO0A 4D46A 2GGSA 3Q2KA 5ADHA 4GL4A 2ZQZA 4IPTA 2D5AA 1M76A 4GGOA 1HXHA 3U62A 3RKUA 3TDKA 1NQAO 3AOEA 1ZH8A 4Z0HO 1RM3A 1EQUA 3O9ZA 4CR7A 2W2LA 3HUDA 2YFHA 1Z45A 4PG7A 5TF4A 5GY7A 2DC1A 4A7PA 3LT2A 4D0SA 3RCBA 4E5MA 2W90A 3D5TA 4IGFA 4XJTA 3WLEA 3JQBA 1LTHR 1QMGA 2FY8A 4IDAA 1E1LA 1SBYA 2H9IA 1QKIA 3NEPX 3OQBA 4YJHB 3ZU3A 3FHLA 3OMLA 5MGBA 1R15A 2FR1A 5JDCC 2BFMA 3KTDA 3MTGA 4MVJE 4OQYA 3LF1A 5A04A 3UH1A 3WFIA 3WTCA 4II2A 5CHEA 2BMAA 1ISGA 2AHRA 1X1EA 3ZWAA 1PEDA 3QVXA 1U7TA 1RKXA 3MJVA 1LRKA 3KZVA 1FMCA 4BL5A 2EWMA 3HWRA 1M2WA 4RPGA 4MKXA 3NV9A 1CDOA 3AUAA 4DA9A 3Q9UA 4WLEA 5EJ2A 1GYQA 2JD2A 3PWSA 3V8BA 4CLXA 4RCVA 3OEYA 3ULKA 3HN7A 4IGEA 4M1QA 5JC1A 3W8EA 1NHGA 2B35A 4K6FA 1R0LA 4DLBA 2G0TA 3BTSA 3GT0A 3H6KA 4J0FA 2HK8A 4ALLA 1PJ2A 4KUHA 1KVTA 4L4RA 2D0IA 3ST7A 1HDCA 1ENOA 1SC6A 1T2AA 4YQZA 4E5YA 2FZWA 3EZYA 4G81A 4I9UA 1FF9A 1LDGA 3JYQA 5CEEA 3OIGA 1DJQA 4L74A 4IQ8A 4S3MA 4E3ZA 3QWAA 2EW8A 3AJRA 4IY1A 3PRJA 5HTOA 4XR4A 4R1TA 3V5NA 5AXBA 2PZJA 5GZ3A 2C54A 2DFVA 3OA2A 3C85A 4KQXA 5F21A 4YXFA 5HBRA 4JROA 4YTEA 4GX2A 5JXWA 4BNFA 2GD1O 1GZ6A 3ETEA 2WE7A 1LLDA 3OICA 4GKVA 1R16A 1EE9A 3JQFC 4LMRA 3F3SA 4WASA 1H9BA 3AY3A 1BXGB 2NU6A 3CE6A 3DAPA 2Y05A 3S2FA 1E6UA 4B8ZA 3UN1A 1F17A 1YB5A 3W4JA 3MJ4A 3K96A 2IODA 2C20A 2I66A 1N1GA 5IDXA 4MVJI 4ZRMA 1LSSA 4Y6PA 5IDQA 3COSA 4Z0TA 2Y0EA 4H7PA 2OMEA 3PJFA 4Q3NA 1KVSA 1YXMA 4NK4A 4B4UA 3L6EA 2J8ZA 3Q9NA 3NKLA 4D3DA 1B26A 2GUGA 1J4AA 4BNNA 2J6IA 1GPJA 1VL6A 5JDCA 3LT4A 3VPSA 2VWQA 3I6IA 1T24A 2TMGA 3HG7A 1OZAA 3F47A 1QYCA 4OSPA 3VOSA 4BNUA 1TB4A 4JBHA 1ISJA 4A27A 5CDYA 3SC4A 3TRIA 1VPDA 3ZV5A 4ZU3A 2A4KA 1ARZA 2CY0A 4WCFC 4A0SA 1P3DA 4MVJH 2I67A 2OL4A 4FSHA 1SNYA 4FOSA 1EVYA 4DC1A 5JC8A 1U3VA 2VZ0A 1JKJA 1I33A 1V3TA 2H63A 1D3AA 3DDNA 5KTKA 3OJ0A 3VTFA 3L9XA 2PD4A 1YWGO 4LRSB 5J23A 1SMKA 3QHAA 2GERA 1DIRA 1YONA 4BNVA 2PH3A 4IZHA 3GF4A 4JBGA 4MINA 2HK9A 2FOIA 4PZDA 4F6CA 2AA3A 3IDSA 2FSVA 1I30A 4M54A 4WJZA 2V7PA 2CVOA 2B0JA 2HK7A 2VNSA 3AWDA 3K9QO 3V1TC 4CV1A 1HDXA 3GVHA 2EKLA 3LLVA 3LLSA 4OIMA 2C2YA 3M2PA 5F5LA 5T57A 5C7OO 2DAPA 3FNGA 2X4GA 2DTDA 5JPIA 5T6BA 4E31A 3RC2A 3JD1A 3LQFA 4W82A 1AUPA 3Q11A 2NUAA 4WNCA 3JYNA 4R16A 4FD3A 3VPHA 3GUYA 1NX6A 3EK2A 4DRYA 4GVLA 1UXKA 2ZIZA 3F1LA 5JAZA 2UDPA 3FTNA 3H5RA 2NTVA 3WFJA 4DLLA 3QW2A 4CM1A 5F1OA 3JQFA 3FCOA 3ZNNA 4MDHA 2UVDA 2VYNA 3BMNB 2R6JA 2YUTA 4ID9A 4RF5A 4EI2A 2IRWA 3D3EA 5F1KA 1U5AA 2YJZA 1LXCA 4CV3A 1JN0A 4D41A 1DB3A 2W98A 4FJ2A 3VZQA 5EMHA 2NSDA 1GD1O 2AW5A 1K6XA 2Q49A 4JBIA 4BNJA 2Q4BA 1KVUA 3GPIA 1BVRA 2ZJ1A 4XA8A 3C1TA 1DLIA 1NQ5A 1M6HA 4XDZA 5G4KA 3LSYA 3CKYA 1X13A 1F8GA 3PJEA 2IE0A 3WWYA 1XELA 2GZ1A 3OM9A 4R68A 4DGSA 5I7EA 2Y99A 2WYUA 1OOEA 4D0RA 3GNQA 1CJCA 2CSUA 1YL7A 3LC7O 3KBOA 2YFQA 2CMDA 2X5JO 3EC7A 5ER6A 5JE8A 1YDEA 4MOWA 4DMMA 2YV3A 3MCVA 4HWKA 4CLDA 3CIFA 2J3IA 4WLOA 4E5PA 2Y0DA 1QP8A 3C24A 4MO2A 4WCFA 1NTOA 1X1TA 5JCJA 3ZHZA 1UR5A 4BMNA 2EJWA 4EGFA 2VUSA 3M1LA 4YJDA 3E8XA 3GVPA 4M55A 2P68A 4PLFA 1MLDA 2DTEA 4BNIA 3BZUA 4TZTA 9LDBA 4S1VA 2X9VA 2X0JA 2I76A 1I3LA 4IXWA 2PKQP 4LSWA 1YQXA 4CM5A 3RUDA 2C29D 3GFBA 3BTUA 2DUUA 1I5RA 1JKIA 3OJOA 3F5QA 3FBTA 3VH2A 3D1LA 1NPTO 1VC2A 1WWKA 1Y8RB 3FNFA 3WBFA 3UXYA 3AOGA 1F12A 2WD8A 1DHTA 3I9KA 2AEFA 3KHUA 2Z1NA 3LK7A 5DBGA 3GC6A 4CPDA 2HAEA 5AYVA 5GZ1A 3QV1A 3I5MA 4P38A 4EW6A 1ZVMA 1E5QA 3IAHA 1Y5RA 3K31A 4LGVA 3GHHA 4CMAA 1P77A 1MC4A 3OH8A 1MC5A 2HO5A 2JCVA 4IM7A 3KLMX 2OO5A 3WXBA 3TN7A 3AK4A 2VHWA 3A06A 3DZBA 3WR5A 2VYVD 1DRWA 4IZIA 4XYEA 4JX8A 1DRVA 1RYEA 2WM3A 4GMGA 1U3TA 3JQGB 5JSFA 2V6MA 5CEFA 5DOZA 4ZICA 4X54A 4U7WA 4QT0A 3TZKA 3VH3A 1BXKA 3GZ4A 1EEHA 3IMFA 3QJ5A 4W6ZA 1T2FA 4ZQGA 4XQCA 4BQRA 2IYPA 1JWAB 5T64A 5DP1A 1EK5A 2BFAA 3JQ7B 1NYTA 4HY3A 4AJKA 1IZ9A 3GHYA 5U1PA 3MOGA 1GAEO 3W4KA 3N74A 2PGDA 5FEUA 5TNXA 4ND4A 4BO5A 3PDUA 4K6CA 3RBXA 4E0BA 1LRLA 3GRKA 1MFZA 1T4DA 3WG9A 3ONEA 5EESA 3LDHA 2E6UX 1UXHA 3VPGA 3NGLA 4J16A 4JCOA 3DZGA 4R9SA 2PD3A 4RVFA 1YQDA 2AE1A 1E1NA 4P22A 1X7DA 2BRUA 3PHHA 2I6TA 5G2OA 3JQ9C 1QV7A 4XX0A 3KRTA 1E3WB 4L8VA 1S7CA 3QWIA 5FI3A 5JBIA 2VHYA 4UVHA 3RFXA 5JY6A 4W7IA 1UXGA 4CQMB 4B7XA 1YOVA 4FJ1A 3WS7A 4L4SA 1K0UA 3EGOA 3RBVA 3DEYX 5BSFA 2GN4A 1PJ4A 2DBVO 1KETA 3DZJA 4XD2A 5ICSA 2WE8A 2O23A 2UAGA 4U0KA 2D4AA 3I9LA 4J9VA 1R12A 5COBA 3IJPA 2A94A 4W4TA 1H6BA 3RFTA 3SEFA 1PZGA 4E2ZA 2GLXA 5L4NA 1PS8A 5DBIA 2X6TA 4CL8A 2EERA 3KUXA 3A4VA 4CMIA 5G4LA 4RLHA 1U4OA 4PVDA 3VZRA 1IULA 4DUPA 1YL6A 3GA0A 3O8QA 5BR7A 3KYCB 3TOXA 4IINA 1CQIA 4Q3CA 3RASA 4CUJA 1E77A 2JAHA 3NTQA 4CM4A 3T4EA 3SVTA 3JCZA 3VC7A 5IJZA 3VPFA 3IUSA 4BS9A 3E03A 3G49A 1X7GA 3PIIA 4RZIA 1JWBB 1CQJA 1PU2A 5COAA 1UZLA 3G17A 5L51A 4R54A 3ANLA 3K8ZA 1NM5A 3Q1LA 4JJIA 4ZQFA 3HE3A 5L4SA 3AU9A 3D4OA 1G1AA 4TVOA 4QECA 1LRJA 1QLJA 5IDWA 4E2XA 1GQ2A 3EW7A 3GAFA 3X2EA 2JFFA 5EPOA 2Y1FA 4PRKA 4HADA 1GL3A 4CMCA 2X0NA 1YB4A 4DLAA 2FPIA 4YCAA 4NFHA 4N18A 5G0SA 1DC4A 4XGKA 4D44A 3R3SA 1A4IA 1PS0A 2PZMA 3IQDB 4TMFA 1G0OA 4BNYA 2GYYA 3FTPA 4RPHA 2ZB3A 2V6GA 4YWJA 1T2DA 3ZWCA 4N5NA 3C1OA 4OYRA 2X86A 1JU9A 1X0VA 4YT8A 4Q3EA 3ZHYA 3JQAB 3WQSB 5C7LO 3K73O 4KQWA 1V3VA 2FMUA 4IUYA 4CM9A 4CQMD 4B4OA 1A71A 3HDHA 3GAZA 1LU9A 1E1KA 3L07A 2BGMA 2DTXA 1P0CA 4J9UE 5K1SA 1H94A 2VUUA 1ZFNA 4OAQA 3L9WA 4NJMA 5ICMA 1YJQA 3I52A 4XYLA 2XOXA 1O8CA 2PGJA 2W2LD 2RHRA 3AI2A 3FNHA 3PP8A 1N8KA 1XQ1A 3BHMA 2ZYDA 4J43A 3AW9A 2RAFA 4TSKA 5DCYA 3ETGA 3OJEA 3EHEA 3F46A 1Z82A 4ND1A 1RPNA 1LDBA 3PLRA 4LVUA 3TF5A 2P4QA 2VUTA 5A5FA 5L40A 1KVQA 1VL0A 2GF2A 4QFDA 4J0EA 4DQUA 4GX0A 5LDHA 4R5HA 4KWHA 4ZHSA 1KC1A 1IYZA 4QXMA 1U2GA 1LC3A 3L4BC 4OL9A 1LEHA 5HS6A 3W8DA 4TWRA 4D7AA 3S2IA 1NNUA 3T7EA 4OQZA 2ZTLA 1AHHA 2Z95A 3K2BA 4HNGA 5B4VA 3I3OA 4LW8A 1NASA 1RM4A 1GFSA 5L4LA 2VOEA 2VTDA 5A9SB 1Z7BA 5T8KC 1YJ8A 1YKFA 2O3JA 3F6YA 3FSRA 4HFMA 4J1SA 3D5QA 3RUIA 1LJ8A 2HJSA 2ZATA 4J7UA 1KS9A 3OQ1A 5JDIC 2EP5A 4XKJA 4WE3A 4J91A 4E30A 4TROA 5HWSA 1DO8A 3QVOA 2DVMA 1A7AA 1O0SA 2XXJA 4Z3KA 1LDEA 1GEEA 1E0DA 2O3RA 2A35A 3BTOA 3UF0A 3E82A 3HJAA 4OGWA 3FN4A 1X7HA 2VT3A 1B8PA 2UUOA 5ITVA 3NX4A 1PJLA 1YVEI 4F6LA 1QV6A 1RJWA 1F14A 1P1JA 5LCXA 3ZZNA 1BG6A 2YDYA 1ENZA 5DULA 4DIFA 1XEAA 3QRWA 2JL1A 2CDCA 4JP2A 3KSZO 5JO0A 3HZZA 4PIVA 4R1UA 3CSDA 1A4UA 4RVSA 5I8ZA 1HDZA 1ZXLA 1U1IA 3W6UA 1N92A 1ZIDA 3VVCA 4JXKA 1B7GO 1BWSA 4YB8A 3NDRA 3ZDFA 3V2HA 1HL3A 2B83A 1PR3A 1PL8A 2ZCUA 3KYDB 1VKNA 3PQFA 1GV1A 3F9IA 1WZIA 2OP0A 1ZJZA 5KJFA 1DIAA 4LISA 1I2BA 4BMSA 3OSUA 1UZMA 3E1KA 4R51A 4ZA2A 3DQPA 4WLVA 2ZJ0A 2CF5A 2PNFA 1DC6A 4HXYA 1CF2O 1LX6A 1YQGA 2E37A 4TRMA 5JMWA 1HDRA 2NWQA 2O3QA 2QW8A 1KEPA 3QY9A 3L4BA 3ZWPA 3S55A 3S2GA 3TL3A 4MIOA 4KP7A 4MP8A 1HTBA 2J5KA 4CL3A 4AJOA 1WAMA 3VVBA 2ZK7A 1DFHA 2XF8A 5KVQA 3V2UA 5U9CA 3GG9A 5L7YA 1R4NB 3WBBA 2D1YA 3JQCA 1IPFA 1H6DA 3WNQA 3KO8A 3PGJA 1UH5A 4FN4A 4CM6A 5FI5A 5T8KA 4HFNA 4KUGA 4RPKA 4BNTA 2PGLA 1WLYA 4CQLA 2CDBA 4G2NA 4DQVA 5JYEA 5JDIA 2Y1GA 3UOGA 4R01A 4GLOA 3TFQA 2Q46A 2NVBA 2PZKA 4FIZA 2VHVA 4Z9XA 3PYMA 1EBFA 3C8MA 1O9BA 1LA2A 4BNXA 3I83A 4CM7A 1SZJG 5IF3A 1F06A 2HCTA 1KY4A 4D45A 5DCWA 1YBAA 4INAA 1OC2A 2HRZA 1N9GA 1T26A 2Q2VA 5JAMA 1AXGA 1HF3A 3AM4A 1T2EA 1IZ0A 1VJTA 3U3XA 3H7AA 4KMSA 2NADA 4O1MA 4OXKA 1LSJA 1ZO8A 1SEPA 4ILKA 3H3JA 3OECA 3PDJA 3QWFA 1RYDA 3DL2A 2IEDA 2VYND 5EIOA 1XKQA 1A9ZA 2RH8A 4N5MA 4R3NA 3AUUA 1X0XA 5DZSA 4ROSA 3IC5A 5K9ZA 3LYLA 2IZ0A 4CMGA 4J90A 1QG6A 5BT9A 5G0UA 5B37A 5KNLA 1JVBA 4IDFA 1E5LA 2FWMX 5T5QA 4FB5A 3S1LA 1FJHA 4ND3A 3GN2A 1VLLA 4Y67A 3PJGA 1IPEA 4DL9A 1B2LA 4PG8A 4W7HA 1D7OA 1LLCA 2LDXA 5HA5A 9LDTA 2NTJA 3KSUA 1IL0A 4AICA 4U5QA 4CM8A 2R2GA 2HJRA 3RC7A 4C7JA 4OHUA 3B20A 3TPCA 4BNWA 2G1UA 3Q6IA 3RBZA 1BTOA 3B1JA 5BSHA 3PYLA 5JAQA 4ALJA 4R1NA 2HQ1A 4CUZA 1LDNA 4LCEA 4JJGA 2AMFA 1L7DA 4R69A 4BIIA 3KV3O 2IZZA 3GMDA 2UV8A 4DBZA 3ABIA 4PGFA 5JCJD 2X5OA 1UP4A 4HX5A 3WJAA 2RHCA 2PD6A 4N54A 3K30A 5DOVA 3VAZA 3BMCA 2BKAA 3WDSA 2DBRA 4BO6A 2ZYGA 4GKBA 3VH4A 3DHYA 4B8WA 4PLWA 1I2ZA 4MVJA 4EDFA 3IJRA 4I8XA 4WPGA 4GGPA 1IY8A 3GQVA 1YH3A 3GEGA 3ZU2A 4M49A 4IS3A 1IB6A 4DYVA 2NNLD 1JDJA 1TI7A 2D3TA 4EBFA 2YY7A 3NGXA 4BKUA 1RM5A 5G0VA 3CMCO 4IMPA 2Q1UA 2GCGA 3U5TA 1H2BA 3LC1O 1YB1A 2X8LA 3O8QB 2HRBA 5A03A 4MKZA 4RGBA 3D64A 4JN6B 4O63O 1NVTA 3TSCA 4J7CA 1DOHA 4CM4B 2JD1A 2PTGA 3GDGA 4Y6SA 1Z73A 1NR7A 4UEJA 4JK3A 3H65A 3LT1A 3QVSA 1GR0A 3OJFA 1PTJA 3DHNA 2O4CA 1E6WA 3V2GA 1HSZA 4XDYA 3R6DA 1CEQA 2OHXA 2VRBA 4HKTA 4MVJF 3DXFA 3CTMA 4Y8VA 2W4QA 4EITA 4DC0A 1MUUA 1C0LA 3G1UA 3ICPA 4FFLA 3DBLA 3UVEA 2NVUA 1TXGA 3VDRA 1DDOA 2UUPA 3A14A 4I9HA 5HRUA 4UUMA 3BA1A 4IDCA 4NFYA 1P31A 2YV2A 1S6YA 1BGVA 4A03A 3AU8A 2DT5A 4RVHA 3V1UA 5AXCA 3HNPA 4MPDA 1JLLA 2VWPA 1Q0HA 1P1FA 3LZ6A 4KDFA 1ONNA 3VHRA 4RPJA 1ZK2A 1TT7A 4TVBA 1DIHA 4YAKA 3DR3A 3TNLA 3GG2A 1ISHA 1FDWA 4B79A 1Y9AA 1I2CA 3L6DA 3UKOA 1SO8A 1BRMA 4M86A 2PY6A 1IUKA 5JCXA 1E3SA 1W73A 3PTZA 2QYSA 2C5EA 1BW9B 4FFRA 3Q2IA 2NV6A 2EV9A 3QSGA 2PLAA 2VHXA 4BNLA 2Y67A 5JYDA 4NJMB 4RZHA 2HMWA 1K89A 2V6FA 2DU8A 1HETA 3Q0EA 1RM0A 1VKOA 5I7SA 1TEHA 3V1YA 4DPKA 3JQ8B 1IHYA 3SC6A 3AY7A 1D1SA 3ZV6A 1I01A 3GNTA 3VTZA 1ZSVA 1NFFA 2XPCA 1PS9A 3BIOA 4CMJA 1PZFA 2DM6A 1CETA 4ND5A 3AUTA 1GTMA 3P2OA 1Q7BA 3RFVA 3KEQA 2GSDA 3F4LA 3LT0A 3RU7A 2DQ4A 2Y1CA 3PYXA 3ZNOA 2EXXA 3INRA 2Q99A 3LVFO 1ISMA 4FS3A 1WMBA 2XXBA 3DO5A 3K2EA 2WJPA 1PQUA 5TX7A 3I9MA 4B4VA 2CZCA 2PFGA 3KETA 5L45A 4HP8A 4FFMA 5IFLA 1AGNA 4FBGA 4Q3BA 4PLPA 4BNGA 3ZU5A 3AFMA 3GEDA 4YJGA 1CRWG 3UW3A 2V65A 4P4NA 3JTMA 3RJ5A 2BGLA 4BOYA 5I8WA 2YV1A 4W99A 1C1XA 2JJYA 5TLSA 2C07A 2C5AA 3C7AA 3H5AA 4Z9FA 3EAGA 3NUGA 4MP3A 5FF9A 3VZPA 3ZNQA 2O50A 4L9RA 3RUAA 3KM0A 4ZQBA 1ULUA 4PG5A 4LRTB 1C1DA 1Y1PA 1R4MA 1MGOA 3W6ZA 4DVJA 3E48A 4DQXA 3GK3A 4PLGA 2X9NA 4FOOA 4GBJA 3TWOA 2PA3A 3GGOA 3SJUA 3OETA 1F0YA 3GVCA 3B6ZA 3D7LA 5FWNA 1K3TA 3E5MA 5F3RA 5I9NA 2VOJA 3EVTA 1XGKA 4BNZA 1EDZA 1I36A 5KOIA 3E9MA 1W8DA 3ROQA 4CM9D 1MA0A 1GZ4A 4WNIA 3TJRA 1E7MA 3DAFA 4ALMA 2IZ1A 5JS6A 1R66A 1NPDA 5KKAA 4I1IA 2Y68A 1SB8A 1IOLA 4LCJA 4Q39A 2PH5A 4ZGWA 1DC5A 1B14A 2FSSA 4HFRA 1OI7A 2UYYA 2FHSA 3AY6A 4J4TA 1ENPA 4Z9YA 5CDSA 5IAAA 1BDBA 1EK6A 1KEVA 3GGGA 6ADHA 5L53A 2B37A 2CUKA 3S2EA 2O48X 5TIIA 2FRDA 4TKLA 5JY1A 3AFNA 1HE5A 2EP7A 5L7WA 2DFDA 3K5PA 3PFFA 3GGPA 3SXPA 3NAQA 3FWNA 3UCFA 2E48A 3H8VA 3S8MA 2JAPA 3KXDA 5GZ6A 5DF1A 1OC4A 3ZNPA 2EKQA 3WSWA 1PQPA 1AXEA 1MG0A 5AXDA 4BGIA 5KKCA 2VQ3A 4I5GA 4IMRA 3RUHA 4UEOA 1QYXA 1HKUA 3IS3A 4TRNA 4DWVA 4C7KA 4OOEA 1T4BA 3JD3A 4NZ9A 4UULA 2HMUA 5B1YA 1R6DA 5ENDA 3RUFA 4PVCA 3PWZA 1BHSA 3DAGA 1HLDA 4WCDA 4ZRNA 1ADCA 3WGTA 1LC0A 3TOZA 2E82A 5ENVA 4IJKA 1B15A 4G65A 4YJFB 1EMDA
chains in the Genus database with same CATH superfamily
1C9NA 3IJEB 4A10A 2W0SA 2IY8A 2A9OA 3H42B 4MWSA 5HZKA 1MB4A 4DT1A 4JY7A 1V1JA 1YMQA 4AQYB 4NI5A 1DWQA 1XDBA 1QU3A 1GRVA 2C8KA 1TU4A 4Q4JA 1LNSA 5TQ2A 3TX2A 1RJ9B 2ZB8A 3VRHA 1P0QA 2ZRGA 3KU1A 5GM2A 5AVWA 1FYXA 3OQIA 1ZUD1 2EGUA 5FPKA 3R5FA 3SR0A 2O3UA 3PC2A 4PX9A 4L3OA 4LEIA 2ZRKA 1T4CA 1DOAA 1T10A 1WD5A 3MYYA 5CFZA 4MUMA 4H3KB 4UPVA 3N6VA 3SG0A 3DJYA 1Y1KE 3QFTA 1KWKA 1ZUIA 3KWMA 3LBIA 3NONA 1V16A 3K2IA 3UJ8A 4P5PA 2HK6A 2NYUA 3WBKA 1N9GB 1GLNA 1ZKMA 2IU6A 1RAIA 2VQEB 2QAGA 3I30X 4CIDA 1S2LA 2A92A 2EIHA 3GVIA 4R1QA 5EZ6B 4ZVQA 5A3VA 3RTAA 2ZRFA 4DNOA 4NOLA 1GGMA 2ZR8A 2DPGA 3ONWA 4K81B 4NS4A 4NPHA 2JFPA 1LY1A 2EGHA 2EKBA 2NZ2A 2BSAA 4QUJA 4YH1A 4DVGA 2PX5A 2W0MA 2R97A 1PR5A 1RWBA 3D0OA 3QFSA 3QH4A 4A16A 1MJ5A 1NW6A 4EPWA 2IGTA 3VZSA 3O92A 2WYOA 2JIBA 2G1KA 2HMTA 4OHFA 2XIQA 4F2PA 1D4AA 2BI8A 1Q0LA 3O82A 4EVRA 4Z6KA 4S04A 4OCZA 2ZKLA 3TLZA 4UUBA 1W19A 3PR1A 1E1RD 1E2NA 3ND5A 5GJBA 2HU7A 2IUYA 1M6EX 2PFSA 4HEA6 4ILEA 1TCUA 1NVFA 4IIUA 4JQOA 4KXXA 4R5MA 3UK1A 2E87A 3W1VA 2I5PO 4D2IA 8AT1A 4CKWA 3H2ZA 5JNWA 5ILOA 5FR2A 5I9IA 3CEMA 3I4CA 4I7EA 4EJ2A 4I9NA 4NMMA 3GLFB 3ZY5A 2CB9A 2BHRA 3Q3IA 2O2IA 2QGFA 3AF6A 1U6IA 3WLTA 4RLSA 1G3RA 1DC3A 1EWVA 2Q0XA 1NYLA 2Z09A 1CSEE 2FH5B 3PQ3A 4JVOA 4RHXA 5HXAA 5I7HA 2O2YA 5TS3A 2BR5A 1PJ8A 3FNIA 1H1DA 3Q2OA 2W43A 2P6RA 4MUKA 3EEQA 2P5SA 5CH3A 3FYUC 2IXFA 4ZANA 1WZEA 1E4OA 3NH6A 5TT0A 3W4IA 1XXHA 1JS1X 2FZLA 4JUAA 5AW1A 2C1EA 2CLCX 5B6PA 4BB6A 2ZJBA 4V0ME 1N2BA 3RIHA 3BORA 2XVMA 1CFZA 3CUTA 5BN3B 5EMJA 1KRWA 3AP1A 4C0LA 4H77A 3LUJA 4BX3A 3X43A 4WJLA 4ER6A 1HT3A 4P0TA 1KO8A 1Y8CA 5FOQA 3A1VA 1Q2XA 3F74A 4MA0A 3C7CB 5CK4A 1YZ3A 4A6PA 3U6KA 3DE3X 2FTKE 4WOJA 4DG5A 3GGSA 3JZIA 3O74A 4AS2A 4C3ZA 4DV4B 3HB1A 2GN6A 4WVFA 2SKEA 1YS1X 1FVHA 3DF9A 1CRLA 2F4VB 1KNQA 5F3WB 1J70A 4NMLA 1VE6A 5IAGA 5T4EA 1P5FA 1T3HA 1WY7A 2WIKA 5AW7A 5GVRA 2QTHA 2X0FA 3WRYC 1NJ5A 1PGQA 1QXSA 2C42A 4O02B 1MIOA 2QZ9A 5TT1A 2QIOA 2YJ3A 3NHUA 3RTCA 3EIWA 5CJPA 2UZ0A 2CMHA 4QYIB 1XPJA 2DE0X 3CH7A 4MHTA 1WOMA 3AF0A 1K0FA 2XWJI 1Z8NA 1C2YA 3PGXA 5B58T 3UOAB 4N03A 4OYLA 1K6MA 1KEUA 4HBGA 2HRRA 5DM2A 1X9GA 4J6EA 5JPDA 4TRRA 3U48A 3A0UA 2GO7A 1ZUHA 4Q4DA 2WMNB 2IH5A 1N6NA 3KZKA 4RGQA 1E60A 2GKOA 4Y1GA 1RCTE 4UZSA 4NL4H 3HBAA 3HCNA 1WM1A 2BH9A 2BGNA 1L1FA 2P30A 1AS0A 1L3BA 3ZV4A 2H0RA 3NTXA 3T94A 1JR2A 2Q4DA 3IHWA 4H0FA 4S1WA 4BRZA 4M4SA 4OL0A 5IWCA 1KMHB 1P1KA 2YMQA 4M1SA 4OIFA 1UOEA 1QZTA 3FWZA 4MW5A 4XZ3A 4XRGA 4WZAA 5JAPA 5DSXA 3HR7A 3UMSA 1W4CA 1TJ5A 3EEFA 3WLJA 4FCWA 1B3BA 2CDAA 4K9LA 4YJ2B 2D7DA 2WT8A 4LX0A 4WGGA 4EO4A 3AC0A 4PC7A 4EDHA 1H3NA 4F45A 1NUHA 5JSZB 2Q7DA 2CFCA 3FDZB 1DWOA 4NEHB 1GKYA 1WP4A 1GSAA 1FUKA 1ZM9A 3IPCA 3LXXA 1RVV1 1AZSC 1IXKA 1IJEA 4M99A 4HRYA 4W5TA 2FMTA 3I9FA 3NCTA 1JKJB 1N6OA 2X8BA 3TQFA 2R47A 4CR8A 4RAQA 3K9HA 2GVDC 2QTZA 1PR0A 2O8EB 4FOPA 4QJ5A 1ZMTA 1U2ZA 1IHXA 4XWAA 1OB5A 2HEGA 4L76A 4WAUA 2CLMB 4G0UA 1X1SA 2R4QA 1ORHA 3PI6A 3BD7A 3G9XA 1SVUA 3T4PA 1NVVR 2OCYC 1Q74A 1N2SA 4YR7A 5AUPB 1NWCA 2GZ2A 3DYVA 2IKSA 2WHEA 1CUYA 1NBWB 3DVLA 4MV1A 1QPZA 2RIPA 5YASA 4OG2A 1C5KA 1J8MF 2C59A 1UJ4A 3FCXA 4NU8X 3SBEA 1FRQA 1E5VA 4Y2GA 3N7TA 2JHCA 3PVSA 5KWSA 4GOXA 4GPBA 1KIAA 5SY6A 3K3PA 2AG8A 3EUFA 5AKIA 2BM0A 1JQJC 2CT8A 4NE2A 3T3OA 4BNHA 1QQTA 2IXAA 1UPUA 3BIFA 4ITUA 5CFQA 1M2HA 5T7BA 3CH6A 1PG2A 5FX2A 4G25A 4FGWA 1NVMB 1EP2B 4C0AC 2OP1A 1SFRA 2QJRA 1Y8RA 3D6VA 1P4RA 4OFZA 4RVCA 4TKVA 1PR1A 2XNDD 3H11B 3LOPA 1G0NA 5K0SA 4JELA 2QYTA 3ETNA 4J4BA 4NOMA 1QANA 3AYZB 5KQPA 1GY8A 2QZ4A 1N7GA 1IXYA 5LVAA 1H69A 1YAJA 3CN9A 3MXTA 2WF6A 3ZBPA 9ATCA 3C3BA 1FX1A 3FMVA 2VS1A 3K0EA 4Q03A 1M5TA 1TQDA 2D2IA 4G0QA 4XJVA 4WXYB 4Y1RB 4C7XA 3LRTA 1LSOA 4TUYB 3FTFA 1KVRA 3CX8A 2AE2A 4P1ZA 4A9AA 1I7SB 5D6NA 5HCIA 4BO9A 3PSAA 2FJ0A 4LVNA 1YJXA 5CT9A 3ZUPA 1TLLA 1C1HA 3MLBA 5LXTB 1XU4A 2P91A 2QP4A 3B7PA 3TSAA 2REOA 1NQTA 3OCWA 4XOIA 3IIEA 3UFBA 3DOOA 4CYMA 4E22A 3GJTA 1XCJA 2NO5A 1GPWB 1WKVA 3I01M 1P2GA 4GH5A 4RC9A 1PJQA 2FQ1A 4QO8A 4DDHA 3KJNA 3PFNA 4BWGA 3OZEA 4Y9RA 1SPXA 3JV7A 1HTWA 1ND5A 2BKXA 1U0GA 2Q29A 5I5EA 4R2KA 5LOVF 3ABRB 4R8LA 4Z4IA 3AVYA 5K8JB 2LUOA 3I1IA 3DBHA 1RBQA 3T7CA 3ZPXA 4D79A 4YJGB 3RIXA 2P2ZA 3CIOA 2W6JD 4RFVA 4DSTA 3TXYA 2WFMA 4IOKA 5ILGA 2KLHA 3GZTB 3ZXUB 5A0VA 3IMGA 4FQ8A 5DHRA 2ZU0C 3HVKA 2AXQA 2ODNA 4EYKA 5BWBA 4CVNA 5F5NA 2VHQA 3IA7A 3HSSA 1JPJA 1PFKA 1EI9A 3A25A 4NY1A 1EXDA 2CLKB 2H2FA 3MHPA 2RHDA 4I6JA 2WD9A 4QEZA 3E9NA 2FR8A 1N9KA 5HJ2A 1RNLA 3VPXA 2B5VA 1R4MB 1B43A 2VK4A 1UAGA 3GFQA 3UICA 3HI6A 2IY7A 3ORQA 4OMUA 1XR3A 1Q0PA 5C1DA 2JAUA 2O2XA 3QVWA 3HYNA 4RIEA 2NTNA 1PWYE 1BH2A 3DDWA 3HBNA 5F1PA 3WIBA 4XYBA 2PUGA 4DCPA 1KTVA 1W4RA 4QSMA 2OLKA 4WEOA 4TS9A 3AUSA 3UMFA 2PKYX 4O3MA 4RA9A 3MWDA 2J5XA 4M1KA 1QFJA 1GKLA 4RQTA 4ENTA 5BORA 1SEVA 1V1MB 2HWXA 4MR7B 2OOKA 4U8GA 4OF4A 3YASA 2P6OA 1ORIA 2QDXA 2PMFA 3W3AD 1GGNA 2QSJA 4GOND 4AI6A 4MVJM 2JLBA 3EMBA 3RLIA 2GR9A 1ONBA 5AK0A 3BD9A 1SKMA 1YRLA 3F2VA 1A1SA 4F4FA 3QVUA 1U3WA 1FTWA 4ESEA 2MSDB 3IIKA 4YRQA 1IONA 2YHIA 4IWXA 4KO4S 4P4GA 4GVXA 4X85A 4IFEA 1D1QA 1ZBQA 1K1EA 4E32A 1NNSA 2PKRA 4ZEWA 4EJ6A 5KVSA 3J80A 1A1VA 2GA9A 4DPMA 1JGTA 1XNRB 2CB0A 3BM5A 4LHVA 3RFFA 4ALKA 4DIOA 1THZA 2CNNA 2JB9A 4HJRA 1RYMA 5AI9A 5BNFA 2NU9A 2QN8A 3THXA 5M5BA 1K6JA 2L18A 3NTVA 5IVIA 4MGHA 1RU3A 4AQ7A 3AEXA 2GBLA 2XWBF 2XRZA 1HT0A 1PP4A 4C43A 2Z4RA 1GPBA 4R8MA 2VJMA 4RL6A 3ZCUA 4BKRA 3STUA 4FC7A 3ZV3A 3OX2A 3JAKB 3FOCA 1B3RA 5D1HA 3CPEA 4IEIA 1GVHA 4R41A 5AVUA 4AJJA 1H2YA 3IIIA 4DTCA 5KIAA 5DCUA 1G4HA 1G5QA 4MARA 2FAXA 4NV1A 3GBVA 5E0OA 1ZCJA 4B40A 4JI0B 4HWTA 3DV9A 4NU6A 4UHDA 2FFRA 2O07A 2GXUA 2QMZA 3NT2A 4PX3A 2BGKA 4RVGA 1O4WA 2FLWA 1ZD5A 4ZQHA 2BZ0A 3WGJA 4DT1B 1R0SA 3KJFA 3FR7A 4ND7A 4MEAA 3JAWA 1YOVB 2OGUA 3RTBA 1KZ7B 3ETLA 4HFJA 1IWBB 5IW8A 4C0WA 4BO1A 3FUCA 1YDHA 3K6KA 1A4RA 4PSKA 3HYLA 4Y2YA 4YRBA 3FR8A 1XZ8A 4EOGA 1T4CB 4NQZA 8GPBA 1R6BX 4MH0R 3EUWA 1XCMA 4LSMA 1GFIA 4DCNA 1JQBA 1L4YA 1N2CE 3NJ4A 3GUUA 1JLSA 4MCJA 2FB9A 1XJWA 1YD7A 2DHRA 1QFZA 3F3KA 1IVYA 4ZPJA 1ZM3A 4WBXC 2C2MA 3BDVA 3I6BA 2ASVA 2JVJA 4L85A 4TQGA 2QAGB 3FLBA 5U4QA 3ZG6A 4BVEA 3P7MA 3F1KA 4LHZA 1I3OA 1YJAA 5EN4A 4ZMSA 3KSDO 2V7UA 1P5ZB 3LCMA 4H1UA 2Q2NA 2WU3A 1N78A 3G6WA 3I9OA 4P53A 3K9GA 4ISBA 1K63A 1FFGA 1RI3A 1G21A 1YRHA 2C9YA 2P5YA 2H2IA 1V35A 1XRJA 2IOFK 3KOWA 4JJKA 2VZ9A 1Q3KA 1NYRA 4YONB 1BO6A 3ELDA 5SZKB 1KK1A 4M0UA 3FNEA 1M2FA 4KPUA 4MLZA 3QI7A 4J0CA 4ZXFA 2BFCA 4MB6A 1X8JA 4BLOA 3NT4A 3ZY4A 1CEYA 1ZVVA 1H8HD 5CCXA 1MABA 4RADA 5EXDA 1ISSA 3DFUA 3U0BA 1JPVA 4NJOA 2ZI6A 2MSCB 1H1LA 3CBQA 2PWYA 5F33A 1L7EA 4OXYA 4RZQA 1O6ZA 4C0BA 4TQUS 1LQTA 1EUDA 1CK4A 1LW7A 1U9IA 2IE8A 16PKA 1R37A 2PS3A 4N8SA 4W9NC 5AHOA 2AJ8A 4AJ2A 4EUEA 4YV2A 4UUNA 1N2HA 4J0KA 1Y9DA 3D0QA 4KWIA 4WTOA 3U7RA 1F2UB 1LPPA 1TMYA 4OTZA 1VLQA 5IX8A 4FZ3A 1SUAA 3F96A 1I32A 5A7HA 3AMVA 1C7RA 5AKGA 1A8IA 5DE3A 3QTTA 1LUAA 4GOMD 4XWYA 2NSHA 2OFPA 3P2YA 4R4JA 1N9ZA 5AJWA 2M1ZA 2Z1MA 3PNPA 1FVFA 2JLUA 3KVOA 3EWAA 1S8OA 2HHJA 2V3CC 3U7JA 5JD6A 2B6NA 3KL2A 4BRSA 1GA1A 3OPYB 1UFVA 5DBFA 4WOPA 1YQ9A 4RKYA 3TQHA 1BVYF 3KXKA 1NJSA 3SIWA 4GP9A 4MW7A 3D4BA 4TRJA 2ET6A 4JYCA 4CMEA 1HM5A 3CT4A 1DEHA 1GP2A 3L7JA 1CZNA 1GZ3A 1TZBA 2P3SA 2V59A 3DMPA 2PWZA 3PRHA 4PHTA 1SCIA 1WPGA 4PLHA 4TWJA 3F6RA 3RE1A 3WL7A 1DKQA 5WRFA 4Z1MD 1T8RA 2IYOA 3TLJA 1Q57A 1O2DA 4TMKA 2PYZA 1NF2A 1CS4C 2FZ4A 3BXXA 3H6GA 4QOHA 4X60A 1H0RA 5G0TA 4BNMA 1MIOB 4WK6A 4UQLA 1ATZA 4CXMA 3GDOA 1D1TA 1YF3A 2R79A 2GPNA 4KQGA 2W2KA 1RMYA 3WL5A 1ZJYA 4TSFA 4XVRA 1UBUS 1J5PA 3MFQA 5D3MB 3RHSA 3REGA 3V97A 1D6NA 2A0WA 1HNWB 5KYWA 1M2VA 4IKEA 4MXDA 4OXNA 5JNSA 2CXHA 3RRZA 3UK2A 2VZ8A 3UPTA 4Y2VA 3IQEA 3H0KA 3SX4A 1DRJA 2C9ZA 4FU0A 1L7QA 2HJWA 4HQFA 1GZUA 3GMSA 2NLOA 3COWA 2Q3CA 3LY9A 1KKLA 2P4HX 3B1ZA 3NTRA 3AHGA 3O26A 1QTNA 5F2KA 5SYAA 4B3JA 3EY4A 3LD9A 4Y2HA 1JJAA 2PMCA 4RIIA 5C32A 3O91A 4Y0VA 4DMKA 1I3MA 3Q7EA 2P7HA 3FAZA 1CXZA 2V7XA 3HXTA 4Q66C 4YBZA 3WGMA 5I9LA 1DKUA 3OQNA 4ESVA 5DYTA 3U31A 3PHGA 3EGEA 1Y3AA 5DHFA 4DJFC 1SUWA 4MW6A 1HWYA 3IR5A 4J1QA 4BO7A 2GUWA 1QLHA 3D4NA 3D9QX 3ZJ5A 1DAMA 2OTCA 5AQEA 3PC3A 4RXMA 4DFDA 2LCIA 1LI4A 2F3SA 4M89A 5HF5A 1HH4A 3EQ8A 2WHPB 1D09A 4X84A 2YR0A 1UBMS 4ZVKA 1PWZA 2EKPA 4PEVA 4V0NA 5C18A 1O95D 5EQTA 2GDJA 2OCAA 4WZBA 3SZMA 5I7FA 2A78A 4X64B 3P2IA 2WMDA 2ZIUB 1V2HE 3OD1A 1HNZB 1EVZA 2IU4A 4G4SO 1A8HA 1SU4A 2IGBA 3B2NA 5FI1B 5KDOA 1LDMA 3EXG2 1OAAA 4CM3A 5HKKA 2OZPA 4EGSA 2GRUA 2H65A 5FWYA 1L7XA 2FN4A 2BY4A 2W6NA 2WAYA 2WR8A 4PTLA 4B3HA 4FYIA 2QMUA 3ASUA 3BERA 1B8VA 4BTEA 1G66A 1UUFA 4LNUB 5HF8A 1YIDA 1XD2B 3BMOA 3O8NA 5ESDA 1Y3IA 2W6MA 2WJ6A 2E9SA 4B4WA 2NAFA 3NBYC 4U00A 1JG1A 2ZWVA 2JCBA 4AY6A 4DLZA 4R2HA 2B36A 4YAOA 4P7FA 3S99A 4FOLA 3R7WB 5DGHA 3S8EA 2C8JA 3BIJA 1YAHA 1RADA 4XTCS 5E4JA 3WGUA 3GEMA 2ZYAA 2PUFA 2LP4Y 4EW1A 5CDFE 2GZHA 4F6CA 4L95C 4H7IA 1NYQA 3O4IA 4TKVB 3VX4A 4PPGA 1XDUA 3CRNA 3DQZA 4UBIA 3OM8A 3OE7A 4J1TC 1PZXA 2XF2A 2PT7A 4Y2JA 3D54D 1QGUA 1RZVA 1XIVA 1Q3TA 2ZYHA 4BCDA 4DS3A 5KNBA 1XVAA 2O7QA 4LDNA 4R3UC 3HJUA 4YJHA 4MUJA 4LMPA 3WGYA 5A4JA 2ZJ6A 3T1HB 2IS4A 2PBRA 5KQGA 1QHYA 1VG0B 8LDHA 3N2KB 4UATA 4ICIA 4W5QA 1GPLA 1I3NA 4J3FA 4S2EA 4F4HA 3PE4A 1NOIA 3I2JA 3D59A 3WIDA 3FYCA 5ER9A 1DQNA 3I12A 5BOVA 1LH0A 1KDYA 3EG9A 3ZXIA 1UPAA 3AKYA 2V4UA 3QENA 4KZPA 3SDSA 5DN6D 3GRVA 1E98A 1ULBA 2ZI9A 3WGGA 1G3QA 2J0UB 4EGJA 2GPJA 5IBQA 3EVDA 3EVEA 3MS4A 4ARIA 1W6UA 5EVCA 1GNRA 2JAQA 1F9AA 1K7SN 5DGXA 2UXBB 4E7PA 3LHSA 3WYNA 3CS3A 1J8DA 1KJJA 1GDHA 3VPDA 4XXHA 5B58C 1N4DA 1L5LA 2H31A 4RMJA 2DMRA 4RETA 4R1PA 4C0XA 3IDZA 1Z3CA 3QWHA 3O84A 4GPD1 4HWGA 1VYVA 4OQMA 3DBHB 3UWDA 2UXCB 3Q40A 3PJRA 1SUDA 1JJBA 3DKPA 1OVMA 2Q5FA 4N0PA 4LN1A 1EFHA 2A4MA 4OP1A 3HUEA 3RRBA 3R6TA 1G18A 2G70A 4RVUA 2F9FA 2J3DA 3RAPR 2RGEA 4PX5A 4U9IS 4ZVSA 5J5AA 4A2CA 1LBEA 3GA7A 3MZ0A 4PHCA 3BGDA 5BW6B 1RW4A 4D8YA 4E4RA 3STWA 5C8XA 1U2SA 2GF0A 5IZCA 1VA5A 2Q45A 2D5CA 3Q7IA 2FEMA 3UMJA 2R62A 1IN7A 1QB7A 2OO7A 2VK1A 2Z98A 1QGOA 3JASA 3SSMA 2ZT8A 1ZVQA 4TYNA 2H1HA 6LDHA 1GNTA 3FVVA 2IEBA 3LUKA 3HWX1 2RBKA 2ORYA 5FTMA 4YCNA 2BCEA 1JLHA 3UJCA 1KEEA 4Q7MB 5EERA 3UNXA 3MT7A 4HTFB 1YI8A 4ZGBA 4CFSA 4DJJA 1RTTA 2QN6A 1B4DA 5LZ2A 5HCUA 5IEBA 2PL1A 3VC3A 1U1DA 3PWKA 1MEEA 4ZYXA 4DMGA 3ZLJA 1JXAA 3GN1A 4XPIB 5DBOA 5EVJA 3GOQA 5BSVA 4RBNA 2AOVA 3WDMA 2VSOA 3QQPA 3I1FA 4Z4GA 3MWDB 1XN1A 1N6RA 2YWXA 3ZQ4A 5JU6A 3G1TA 1DADA 4DV5B 3GD7A 4JMLA 5GTDA 1CUIA 4FNMA 4PBRA 1BXGA 1KDRA 4YRIA 1SQSA 3U9TA 3GLVA 4J7XA 3DHEA 2ODBA 1FXSA 2G63A 2QRKA 3DTVA 1DC8A 1X1AA 3GLHA 3ONFA 5CW1A 1BIFA 2BR4A 3OLZA 3PNMA 1CIVA 1W76A 2Y0CA 3E84A 3NHLA 2Q2WA 1Y4SA 3UB3A 2JJMA 2C3YA 2VCYA 4B7CA 3DE7X 4I4CA 2EFGA 3H4IA 3GNSA 1E6KA 4LY6A 2DF8A 2JIMA 2OUIA 4IIVA 4NDNE 2ZRDA 1Z39A 2P1RA 2UVPA 2YHIB 4Q9NA 2B4AA 1KC3A 2O20A 3O2SB 4KQKA 4R2WA 4JLJA 4B7ZA 1QH0A 1MNAA 4PLCA 1S2IA 1U8TA 4O2AA 1OFUA 1ONOA 2DP4E 3CRVA 3G2QA 3M5CA 3WYAA 4OHKA 2B8JA 3G82C 4HVTA 4DF3A 1OGIA 3GOHA 1KOGA 4IS2A 1DKOA 5KJCA 1XVLA 4QWMA 5FTNA 5H5JA 4F8JA 3TFOA 5DT2A 4MTLA 2NU9B 1OYVA 2JFOA 4ZN6A 1JHPA 3THXB 3ZKWB 5E3IA 3ESCA 1U9JA 1G8PA 1YGYA 5AUNB 3Q7PA 1VMEA 1B0AA 4DA4A 4UU0A 1P2DA 1N3YA 3H19A 4D96A 4WLFA 2X1HA 2PN1A 3BE8A 3K92A 1BC5A 1C0IA 3BGOS 5JZ9A 5FCDA 4TLCA 4CFYA 4YDQA 1JQLB 3DEFA 4JDPA 4EMUA 1S0UA 4GRDA 2I4IA 2KBEA 4YCJA 3C3AA 3F97A 4J3NA 2ENUA 3HB0A 3B82A 1QRTA 2CW5A 2G72A 2Z9CA 8ADHA 1YR2A 2OV4A 3H3FA 4UVEA 3U26A 3WNDA 1KDPA 1E7QA 2Q5QA 2R1TB 1C0PA 2ZJAA 3AGPA 4FZVA 4L1KA 5CIWA 3TB4A 5ALKA 3CZMA 5KOYA 3B6MA 4XJSA 4D82A 3F7OA 3IP1A 2P9BA 5IP5A 1GG9A 3D43A 3LPMA 5FBWB 3FROA 3JAWB 4UTZA 3PA8A 1PDWA 1Z26A 2DOKA 4YO8A 1PZHA 3U4DA 1R0KA 1TPZA 1ZZEA 5K6AC 2CLIB 3GDFA 3U3ZA 1UP7A 3E22B 3FVRA 4TT3D 1G55A 1A27A 1U04A 3CFYA 5FLEX 3X2FA 1V1RB 3P0RA 3TRFA 4ZQEA 2QL7A 4UAVA 2A0FA 3M0EA 3SC3A 4KX3A 3QUAA 3MERA 4HVCA 1XZJA 1BXRB 2O0JA 1FDOA 2B1QA 3P9PA 4ND2A 4ZGGA 2FN9A 1E5DA 3HO8A 1Y5NA 2YZKA 3KTAA 4BRUA 1T15A 1XJCA 2Q50A 1P3Y1 1SXJD 5CVUA 3HWWA 3RUCA 4WY5A 1F8XA 3H9GA 1QOPB 3QXXA 3D8RA 2EG5A 2OV2A 4JWTA 1HNNA 3BMNA 4MVJP 3EJWA 3DEAA 5TVKA 1BW9A 1S1MA 4JU9A 4I4NA 4NCKA 5DGCA 3VZBA 4EFMA 5LBTA 5AW0A 1Q0QA 2L69A 4PFJA 2J31A 3WGQA 2GCOB 4BQOA 2FETA 1D1PA 3HY4A 5LIPA 1JVNA 3GD5A 4RFSB 2VPWA 1D8TA 1FRNA 4W8OA 4RW0A 4EBBA 5EE0A 1L5MA 3M9WA 3G2LA 4UNQA 3MTQA 5LQRA 1MG5A 3TEMA 2YWCA 2C7VA 1V5FA 5KC8A 1LNQA 3IOCA 4M8SA 1M34E 3HXOA 2WJYA 2GK7A 3MVEA 4V0MA 1J90A 1YQUA 2XLCA 4DYDA 2DUJA 4LGYA 2VJAA 5GQSA 2ZYUX 2ZUDA 1EAYA 5F3DA 3ZI0A 1IWPB 3DMTC 5CEJA 1XTBA 1MABB 4ZO4A 1JEYB 3NAZA 2W00A 1UOPA 2BSXA 3C3WA 2M6RA 3NHMA 3T3NA 1T36A 2VKQA 2C00A 5B6IA 1Q21A 4M6WB 4EA8A 1DG9A 3CVXA 2HA7A 3IP9A 4JR2A 2BZSA 4UU1A 2B3DA 4HQLA 4IF6A 1Z68A 5BT8A 4XQ9A 5ESRA 2VJKA 3F5MA 4PN3A 4M9RA 1XRRA 1R8QA 4PFSA 1P6UA 2PIDA 4YAWA 4BLUA 1HX7A 3A3NA 4Y7CA 1LVUA 2X8JA 5AKLA 1OJ7A 2AFHE 2H4JA 1X7XB 3H5LA 3KTFA 2YBDA 1XSEA 4JFAA 1GQQA 4J49A 4CL2A 3DOIA 4OKIA 2I1WA 1AGXA 1A8PA 2V6IA 5SYNA 4LHWA 2J9XB 3RVRA 3B7WA 3I05A 3AI3A 3E1GA 2X9QA 1FPQA 1G20B 1LJUA 2NYAA 3G5MA 3DBIA 3PHJA 4MITA 1YUBA 2JD0A 3D4PA 4Y2XA 5EZYF 2FEOA 3HA3A 3SY8A 1L5ZA 1N1DA 1JIQA 1XNJA 4EJMA 3L77A 3BYZA 3DWGA 2RHHA 1EQAA 1L5YA 3IXLA 1V8PA 4RJIA 2WKSA 1GUZA 1UDWA 4FPXA 3U39A 3W9BA 5LWHA 3AUXA 1HK7A 1HYBA 2EJUA 2YCLA 3GO4A 3HSYA 3L2OB 4MQEA 1CEEA 3FVWA 1XJ5A 4FCVA 1Z47A 2ADOA 3DT8A 2C9BA 3O4GA 4R81A 3O7MA 1RPAA 1DTSA 3UUWA 2OZVA 5ISMA 4DAOA 4WKGA 1RHMA 1PD0A 4RHYA 3FETA 3ICCA 1PZEA 3AKDA 1SC3A 1SVNA 5LA6F 2UUCB 3CWQA 1KHHA 1XMVA 1ZCAA 3GJ0A 3NAMA 2BF7A 1QF7A 2W2KB 1L3CA 5LNK1 3QNWA 3ZHBA 5DYYA 3LWNA 4YP7A 2G7ZA 5LQKA 3FPKA 3QYFA 4Y1EA 2G17A 1E0SA 3UWKA 2DJIA 3O3NB 4C0KA 4DC9A 5KYWB 4JVSB 1OFGA 3IO3A 2B8EA 5E4FA 5EQJB 10MHA 1RRMA 2E4AA 4IVQA 4YRFA 3LUAA 1B23P 3H13A 3X0DA 2QL5A 2CBZA 3TRDA 4H18A 1NN3A 5E95A 5ICGA 2I4MA 2Q1SA 2WSBA 2OD2A 2VF7A 3JQGA 3DDUA 4Y18A 4N9WA 1MV5A 7REQB 5TPWA 4CTNA 5IDVA 2ZAOA 3HYRA 1WUTA 2PX0A 3LLMA 1E2HA 1XAGA 3M4XA 2VNAA 4C7BA 2J3HA 1QGDA 2QUBA 3GH1A 1JW9B 3OCVA 1XKTA 3M89A 3NGMA 1JIKA 1RRCA 4QM7A 1NC3A 2GCEA 4JJ4A 1JF8A 4BJ3A 5LUAA 3ZW7A 1GDDA 4BQSA 3NDIA 4TXLA 4ZHQB 1ZONA 4GDFA 2VYCA 1WOYA 2O6LA 2FN3A 3NTOA 3GRFA 1T0HB 2JFNA 3EPHA 4H0CA 4PNPA 3DPUA 1U02A 5TQ0A 3UXMA 4X94A 1QSGA 1NR1A 3WQHA 4NTZA 4W6QA 2RK6A 2Z8ZA 1V71A 2HA6A 1Z07A 4ZT5A 4WZBB 1KFBB 3ZX4A 1FUIA 2Q7OE 2NNWB 4D9BA 1VLHA 4WL0A 5CB6A 3WIEA 1XVIA 3W8FA 4CCSA 4HNUA 1R64A 3NHYA 3NKVA 3VQTA 5BUCA 1SCBA 2ACVA 2GFQA 4JGBA 2PZLA 5F4BA 1GSIA 3DSRA 1M2KA 1Z2EA 2JCXA 3KLPX 5FWYB 2MU1A 4FHGA 3T9AA 1E2QA 4DLSA 3C16C 1A7UA 3KL4A 4HNQA 2R1UA 3FPEA 4JUCA 3ZGNA 4BWVA 2CV1A 3FF1A 1NMZA 4DKXA 1OT3A 4KXQA 1G8AA 2COUA 4N7JA 5FULA 1YZVA 1KI3A 5HM8A 1SQ0A 3BMOB 3HMQA 5B1HA 3VR3D 4OQPA 3DOCA 2ECFA 2CXPA 4IXTA 3BKWA 4GO1A 4C4OA 2OXIA 3CLTD 2X15A 1XB2A 2AJDA 5ILQA 3VX3A 3KQQA 1SOAA 2PSSA 1JZTA 5BR1A 3DULA 3K0AA 4ATNA 2V0NA 5BWLA 4AX4A 2PE5A 3U4QA 2D5AA 4UDYX 1DX4A 4HOYA 3IMEA 4RZSA 3U62A 3RKUA 3WWCA 3TDKA 5KQSA 1NQAO 1B73A 1EQUA 2RI1A 3DL0A 1NDHA 1Z45A 1E5XA 4PR3A 4BAZA 4Z5XA 1UJNA 1GU0A 5KYKA 4ZOLF 3BX1A 4TS3A 4PPYA 4D0SA 3RCBA 4YCMA 2ENWA 1QGUB 1SVLA 3H16A 3D5TA 4IGFA 4H1TA 4XJTA 5GGXA 4KITB 3UAXA 5K2OA 1LTHR 1QMGA 2FY8A 4YJHB 2H9IA 3SD7A 1QKIA 1ZVJA 2CWDA 3NEPX 4GR9A 4GLBA 4XSVA 3MRSA 2PX3A 4XD7D 1R15A 4I2VA 2QVCA 1XEXA 2ZSFA 5JDCC 5JNTA 3KTDA 2GM5A 4C2TA 4MVJE 4RTLA 2WUFA 3FDJA 2WF9A 2WG2A 3L0IB 3UTDA 1KQGA 2X2EA 4OU4A 4M1OA 4II2A 4FXPA 1R8JA 2AHRA 3L06A 2KS6A 3QVXA 3EBLA 3FIJA 1BAPA 5KEIA 3MJVA 4BL5A 2R8BA 2D3WA 2ALJA 3WL4A 1BKSB 1FP2A 3C70A 3HWRA 4OATA 3NV9A 3AUAA 4MDYA 2UZ3A 5CM9C 4WLEA 5EE3A 4DA9A 2G1PA 3GMIA 4RD6A 4IO0A 3GJQA 1EJ6A 2YN4A 2B1IA 4OI4A 4BXOA 2HXYA 2WP8J 5EP3A 5G1OA 2H11A 4BMCA 1X8XA 4IEFB 5DASA 4M1QA 2XGMA 4YASA 1WZCA 1L8QA 1EK2A 1N5MA 1XJQA 1R0LA 2QTAA 1Z08A 3BTSA 3KKLA 2WSMA 4OBWA 4BU0A 1RI2A 1PJ2A 3RVLA 1P7CA 1T13A 3J7TA 1NOKA 1ENOA 2QR2A 1ND6A 4OUDA 5EY5B 1K68A 3EZYA 4H4DA 4JLAA 4B6PA 3C98A 1LDGA 3JASB 3BIWA 4UNSA 1CLEA 1DJQA 3AR5A 3LGAA 1YR9A 4IQ8A 4U8HA 1PG5A 4E5NA 1AB5A 1OKKA 2ZPAA 4GVPA 1SGWA 4MI3A 1KEEB 2R66A 3K9LA 4XR4A 5LZ4A 1SXQA 2XZPA 1ES9A 1OFHA 3FHJA 4WFIA 1PFWA 2GD0A 2H1FA 3C85A 5AXBA 4ETWA 3R7FA 1OIWA 1H85A 4C6SA 3AESA 2PANA 3FPGA 3SOPA 2FVXA 2ZVJA 1I7NA 2W2NA 1B8NA 2WRZA 2X2FA 3AF4A 4QTTB 3BN3A 4YUYA 2EFEB 3QHPA 2TSYB 1JIIA 1P62B 4Q9KA 3KQNA 4PHGA 3ISJA 1PUIA 3PNYA 1R16A 1XHFA 3JQFC 3KFXA 4JSRA 2WT4A 1H9BA 3AY3A 1BXGB 3CE6A 3DAPA 1WXQA 3A7DA 4B8ZA 3CB4A 3IAUA 3TJMA 1NMSA 1JFVA 2PBZA 3OU2A 2CMKA 4HG2A 3VR2D 3MJ4A 5IJ0A 2WHRA 4FZ5A 1Y3BE 5DRTA 3QF7A 2XNSA 4UTNA 2ZGVA 4ZRMA 1AXRA 4Y6PA 4C0QC 2GN2A 2W22A 3KKPA 1KE1A 1FYDA 3QE4A 1MJFA 4G0MA 2UVPB 2B7LA 2Q3FA 4H7PA 4B6QA 4P2GA 3AQIA 3EPPA 3JATA 2CKDA 3EBOA 4Q3NA 1PQ4A 3REOA 4B3CA 1JHUA 1M8KA 4B85A 3K1YA 3O2JA 2NV2B 3NKLA 4DN6A 3QFFA 2HMYB 2QI9C 2GUGA 2WU1A 1J4AA 3DZ8A 2O7VA 4AAYA 4KFRA 2IUEA 2NAPA 2XMGA 2OPHA 4TXNA 5EG5A 4LY0A 4AF7A 1T9DA 3AV3A 4ZWNA 3AI7A 2XCRB 2A14A 5SY9A 1T35A 4RKRA 5A5GA 3JX9A 1G59A 1YVDA 2R1VA 1A8SA 1I0LA 1O6FA 2Y1KA 3WZLA 1VQ1A 1MDFA 1IFXA 2W6OA 1GNQA 4R6WA 4A8JB 1Z0JA 5C5CA 4D3YA 4LX8A 1H4VB 4BFWA 2A4KA 1N2CA 2AF3C 2CY0A 4FX2A 5KYUA 1VJDA 1MOSA 1U7XA 5JALA 2C4WA 3PQ5A 3PSHA 4P08A 5CA1F 3T7AA 1DQRA 1JR3E 2IX3A 1R3DA 2FSHA 4FYKA 4HI0E 5AIAA 3U17A 1I33A 1Z5WA 2VZEA 3CHYA 1RYYA 1D3AA 3O90A 3TTXA 1ECGA 3SDBA 2R6AA 2W70A 5JECA 2PD4A 1ZA2A 4LRSB 5J23A 5DTMA 4CCYA 1DIRA 1YONA 3T7IA 4RD1A 2JJ1A 4Y2SA 2C5GA 2G6BA 2HV9A 4JBGA 4MINA 2F7SA 1XF9A 4PZDA 3U44A 2QA5A 2ZIAA 2FSVA 1JR6A 4EPRA 1E1QA 2O5VA 3HBJA 3QJYA 3TFWA 4NBLA 3VAYA 5JS8A 1VE3A 2JANA 2HK7A 2WZBA 2I6FA 3AWDA 3K9QO 4Q34A 3V1TC 3IVAA 4OIMA 3VAAA 1Q44A 2LCFA 2GS9A 2J1LA 1PAUA 2V03A 2BGUA 1CE8A 3FNGA 4MS1A 2PGAA 1SG9A 1GGKA 1Q1GA 4HR7A 3S44A 1RZUA 2ZS7A 1ODCA 3PNBA 3ZWKA 1GGJA 1Q77A 3JD1A 3LQFA 2NUAA 2NZYA 4L6AA 4AWXA 1VSTA 1OZ0A 1WXGA 1SA0B 1UXKA 4OMDA 4RLQA 2GPWA 4YECA 3KTAB 1ULTA 2OCXA 1TQ2A 2UDPA 2AG1A 1PHRA 3B53X 5DWDA 2HNAA 1X1BA 2BSQA 2XMQA 3N7AA 4QPDA 2G1JA 2HC9A 2Q5JA 1M2JA 4S0ZA 5DX1A 5F1OA 1XA4A 2K4MA 1LLFA 1S4MA 2EFJA 3CWZA 3BMNB 3A2KA 2FQYA 2R6JA 2ZVQX 1MZVA 2C95A 2OO5C 3UTCA 3QELB 4YBRA 4JI1B 4RSMA 4Q1BA 4HMOA 4CV3A 4CNQA 4UM9B 2PSHA 5FPQA 5CLJA 1WCWA 5FJJA 4UUAA 4D41A 1NUTA 1SPBS 5F76A 3D3QA 1KDTA 3H5OA 1M1NB 3FTDA 3RB8A 3VISA 4H1HA 3VZQA 2XBMA 1WTCA 3H6HA 4JHXA 1TOAA 3LDUA 3OHPA 1G8JA 4FBLA 4JBIA 4BNJA 4OHCA 1CR0A 3PB3A 2ZJ1A 1PEYA 5FBVB 1NQ5A 1U6KA 1M6HA 3D81A 3DUWA 5G4KA 3NDBB 2BE7A 3S2UA 1AKWA 3FGZA 4LDPA 2F6RA 2R11A 2GZ1A 4JLBA 4CG3A 4DGSA 4ZJPA 2ATIA 1JPNA 5BURA 2WYUA 1EJ2A 4ZI7F 2B34A 4YCBA 1OOEA 5HF9A 2JAXA 1AN0A 3X1DA 1CJCA 4JGGA 3LC7O 1YL7A 4NRDA 3A2NA 2AN4A 2L19A 3PEUA 2C7QA 2FP4B 2HLHA 2YFQA 5E1BA 1SQGA 4FYVA 3HA2A 2X5JO 2P2YA 3ONNA 1S2NA 2W11A 4CLDA 3MCVA 4HWKA 5DW0A 3T06B 5EC8A 1XZHA 5K8TA 5D3KA 3D6JA 3IA2A 4WLOA 2Y0DA 3DPSA 1DJLA 4MO2A 3OF3A 4DLUA 4BZXA 1YR7A 2X8JB 2WAOA 4QT4A 1DCKA 2WKRA 2VUSA 2X0KA 3DXZA 4P3PA 5KNCH 3P0HA 1OBOA 3BZUA 4LJSA 3QVVA 4TZTA 3H5WA 4S1VA 5KHOC 2OK7A 4DR3B 1K5GA 2BT4A 5CNMA 2I76A 4B2IA 2PKQP 4HDNB 1U0LA 1YQXA 3TM4A 2O52A 1M2OA 3QKIA 2PXHA 4L0CA 3GFBA 2BM1A 3BTUA 2XVAA 1U7DA 1G4UR 1HMYA 4JUDX 5K3BA 3VNRA 1JKIA 3UXHA 5LOVB 2R5FA 3ZJ4A 3VH2A 1MTOA 4TL8A 4FX5A 2C4NA 1PR2A