3WNQA

Crystal structure of (r)-carbonyl reductase h49a mutant from candida parapsilosis in complex with 2-hydroxyacetophenone
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
335
structure length
335
Chain Sequence
SIPSSQYGFVFNKQSGLKLRNDLPVHKPKAGQLLLKVDAVGLCHSDLAVIYEGLDCGDNYVMGHEIAGTVAAVGDDVINYKVGDRVACVGPNGCGGCKYCRGAIDNVCKNAFGDWFGLGYDGGYQQYLLVTRPRNLSRIPDNVSADVAAASTDAVLTPYHAIKMAQVSPTSNILLIGAGGLGGNAIQVAKAFGAKVTVLDKKKEARDQAKKLGADAVYETLPESISPGSFSACFDFVSVQATFDVCQKYVEPKGVIMPVGLGAPNLSFNLGDLALREIRILGSFWGTTNDLDDVLKLVSEGKVKPVVRSAKLKELPEYIEKLRNNAYEGRVVFNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords (R)-specific carbonyl reductase
publication title Unconserved substrate-binding sites direct the stereoselectivity of medium-chain alcohol dehydrogenase
pubmed doi rcsb
source organism Candida parapsilosis
total genus 100
structure length 335
sequence length 335
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2013-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wnqA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3wnqA01
1WDKA 2NTJA 4IMPA 1C0PA 4NBUA 1WPQA 1IUKA 3HUDA 2VYVD 2Y05A 3OIDA 1Z74A 1H2HA 1N7HA 2NACA 4BUCA 2XXBA 2O2SA 4I08A 1ZEMA 1UDCA 3ON5A 1PU2A 2FSSA 4Z6KA 3DZJA 4JLWA 4A03A 1EUZA 1V3VA 3PK0A 5DULA 1FDWA 3RJ5A 1F17A 1D1SA 5JYEA 4NJOA 5GZ3A 1PWXA 1DXYA 4YWJA 3S2GA 5KVVA 4DGSA 1IHYA 2DPGA 4TVOA 2D1YA 1DHTA 3A28A 2FOIA 1UP6A 2NV6A 4CV2A 1BHSA 1B15A 4FB5A 3ZNQA 5BNFA 5EERA 1P33A 1HF3A 1Q7BA 5ITVA 4WJZA 5EQFA 4CLXA 3FSRA 1YDWA 3UUWA 5EIOA 5CEFA 1LSUA 1QYVA 4XX0A 3B1JA 4GAEA 1DLIA 5KVSA 4IPTA 1E6WA 2EV9A 3MJCA 2BFPA 1NHWA 1YXMA 4WOKA 1KOLA 1MFZA 3ASVA 4AVYA 3GLQA 1PGPA 3LYLA 1U4OA 1PL7A 4EITA 2AQ8A 1YRLA 3GNQA 1WAMA 4LSWA 1ONOA 3DHYA 1UJMA 5EINA 3WQQA 4ID9A 2Y0EA 2H6EA 1BXKA 2QRKA 4IDGA 2BMAA 3QSGA 3ZW9A 1H6DA 1RKXA 1Y5MA 3ADPA 4JCOA 3RBXA 5L4SA 4UVDA 1Q0LA 3LF2A 2VWGA 4UVEA 4YPOA 2OZPA 2EF1A 3K92A 4J90A 1B8UA 4NDNE 3KSDO 3WFJA 4YJFA 4AJNA 1C1DA 4E5MA 3AFMA 3UICA 1VM6A 4R1SA 1E1NA 4MKZA 1BSVA 2JJYA 2NU6A 3QV1A 5AYVA 1UXHA 1U7TA 4MVJF 4RL6A 4PRKA 1LLQA 4RJTA 1X13A 2OFPA 4OOEA 1ADCA 3ZWNA 1I2CA 3KXDA 1EK6A 1GUFA 2XAAA 4M8SA 4PRLA 5AXCA 5I7FA 2O7QA 2PR2A 1W8DA 4MIEA 3C7DB 4NI5A 4AJJA 4UAGA 1BW9A 3P2YA 1HSZA 3C85A 4YJFB 4K1LA 5B37A 1C1DB 3IL2A 1UP4A 3OJLA 3ICPA 1I3KA 3MOGA 2HQ1A 3CSDA 4PLYA 1YB1A 4RDHA 4S3MA 2YHIA 4DPLA 4EEXA 5BSEA 3TZCA 4CLRB 3L07A 5KCZA 3QVTA 1HDZA 4M1QA 1LSOA 3IC5A 4XYBA 5BSGA 2PD6A 4L8VA 4EJ0A 3RUEA 4EDFA 2OGUA 3JQ9A 3FN4A 5ER9A 1MLDA 2X5JO 5CEJA 2Q2WA 1E7WA 3RC9A 2P4QA 5U9CA 3NT2A 1T25A 1A27A 1O6ZA 1I8TA 4BHTA 1BW9B 1J49A 2PZLA 3M1AA 3FHLA 4Y9DA 4DIFA 1LLCA 3QA9A 1H94A 2O23A 2Y1GA 5IZCC 2VOJA 1DRUA 1T4BA 3C1OA 1UZNA 5EN4A 1P45A 1FDUA 4J1NA 2D3TA 1GTMA 1TB4A 1Y7TA 2VNSA 1W6UA 3WTCA 5ICMA 5JY6A 3AW9A 4R01A 7ADHA 4C4OA 4FFOA 1R6DA 3AOEA 3LC1O 4E2ZA 4F6LA 4GWGA 2GZ1A 1ZK0A 1CEQA 4GKBA 2I3AA 1T1RA 3JQBC 4RPJA 1EQUA 1UDBA 3RC7A 4QUKA 4WLEA 4JNKA 4PLPA 3WGZA 1TA4A 4CM6A 4X54A 3RU7A 2HDHA 3ONDA 1QRRA 1JWBB 4CMEC 4PLFA 4R69A 3H9JA 3DOJA 2AMFA 4GQAA 6LDHA 5G0WA 3W8DA 5DBGA 2X5KO 5L9AA 1E6UA 5ITWA 1D3AA 4ZU3A 3L4SO 3T7EA 5JFOA 1H6BA 1D7OA 5CPBA 5CEEA 5G0VA 1HDOA 3KETA 2JCYA 3OJ0A 3SJUA 1ZXBA 4L76A 4XEHA 2B4TO 3KBOA 2G5CA 1VJ1A 3KYDA 4HADA 4B7CA 3ROPA 3DOCA 2JFGA 3A4VA 4CL8A 1JQBA 3KSUA 3RFVA 3GZNA 4IIUA 3QVWA 4R41A 1SMKA 3HDJA 4F6CA 4E6PA 3UAGA 2P9GA 4CM9A 3LT4A 4DBVO 4KWIA 4EUHA 4R68A 3QWFA 1F14A 4J1SA 2J3IA 1CWUA 3LT2A 1H9BA 2D5CA 4RDIA 4WNIA 5THQA 4DREA 3HNPA 1CQJA 1VI2A 2X86A 2YQ5A 5KIAA 2EW2A 1F8FA 5TT1A 4U0KA 3G0OA 5CG2A 3O9ZA 4WLFA 4DVJA 3FR8A 5I9MA 4MVJA 2I67A 4JROA 1HKUA 3GZNB 1EVIA 4RGBA 1A7KA 1B8VA 1CJCA 3L0DA 3QY9A 4II2A 3GFGA 1EBUA 4J7CA 1X0VA 2X1HA 2RIRA 3LC7O 2VUSA 4PVDA 4YJGA 2O3UA 2H9IA 3VH4A 5A03A 3ANLA 3UGKA 1DO8A 1DB3A 3UVEA 2UVDA 4U6SA 2C2YA 1LEHA 2FZWA 5IJZA 2AEJA 2AQHA 3S2FA 5HS6A 4IZIA 3PHGA 2RHCA 4OKNA 1B14A 2I76A 2IEDA 3ZI0A 3WSVA 1Y6JA 4QO8A 1E7YA 2BFMA 4E2WA 1R4NA 3PDUA 3JQFC 4RORA 2JKVA 3F4LA 3HFSA 1GV1A 3DAGA 3RC1A 1YB5A 4MDHA 4YJGB 1E7QA 3H8VA 4DIBA 1ZEJA 2X0JA 1ID1A 3GN1A 3I23A 4B4VA 3ZWVA 3IS3A 1NWCA 3PDJA 1ADGA 3ZWMA 2VRCD 1KEPA 4M89A 2P91A 3FI9A 4CV1A 1R4NB 3CUKA 4CM8A 5A1TA 4FDAA 3V1UA 1NFRA 3DC2A 4DLBA 1EFLA 4NPCA 4XIJA 3VHRA 3ZWXA 2JD2A 2GRAA 4JJIA 4BNGA 3ZN2A 4FS3A 3M6IA 3PEFA 4IXTA 3DXFA 4NJMA 1IB6A 1ONNA 4OGWA 5EL0A 3IKTA 4K6CA 4DQXA 1K89A 1EE9A 1PQPA 4Q3AA 2YUTA 1EVZA 3S2IA 2D59A 3G1TA 3KVOA 4IDAA 4OQZA 1MP0A 2NLOA 1LQUA 3MTJA 3WTBA 5DZSA 2VCYA 4CR6A 3QWIA 4CM8B 3GOHA 1NPTO 5A4DA 5T8KC 1JVSA 7MDHA 3L6DA 4O0LA 1W4ZA 2SCUA 1EUCA 2ZB7A 4BOYA 4XYGA 3Q9UA 4ZQHA 3GNSA 4YT8A 1YJQA 5HTOA 3JD1A 1RYDA 1Y9EA 3K2EA 4IQGA 4P4NA 1DFHA 3RSHA 1E7SA 2P9EA 3GVPA 3UFXA 3GR6A 1BRMA 1S6YA 5TT0A 4RVFA 1PQUA 1BDBA 4Z0PA 2WJPA 1ZCJA 5C37A 3OJFA 1LA2A 3GEMA 1H5QA 5COQA 1IL0A 2HMTA 5DT9A 2ZTMA 1UUFA 1WNTA 1NPYA 4TVBA 4J0FA 4E5YA 1YBAA 2GASA 1GU7A 2Y1FA 3EZYA 3FBTA 4UULA 3WBBA 2VZ0A 1NBOA 4OH1A 1DC3A 4GGPA 5L7TA 3TSCA 1F8GA 1ZUD1 3L4BA 4A26A 2GZ2A 4UVGA 2Y68A 3JCZA 3N74A 1P31A 2QYSA 5ENVA 4ALMA 4I8XA 4GSLA 2V6MA 3CH6A 4HFRA 4KP7A 4CODB 3A06A 4AL4A 3ADOA 4YYZA 4J2HA 3PIDA 3WB9A 2ET6A 1Q0HA 1VKOA 4MVJD 4TKMA 3SJ7A 2VWQA 1E1LA 4UVHA 3QRWA 4IINA 2DFVA 5DOVA 2PNFA 2B5WA 2I5PO 4B8WA 4ZQBA 1GYPA 3INGA 5IDYA 2FRDA 3W8FA 3TZHA 4HUJA 1V6AA 4WCFC 5JY1A 2HCTA 4CR7A 4NFYA 4BNWA 1GFSA 1GCUA 4XQGA 2CD9A 1ISMA 1C3VA 1AHIA 4R1UA 3DZBA 3ZW8A 1GQYA 5FEUA 1XG5A 2YJZA 3GEDA 4E12A 3HADA 3DZKA 3ZU3A 3GH3A 2O3QA 4R1NA 2LDXA 2D0IA 1GV0A 4DPMA 1YS4A 1O89A 4F3YA 3K2BA 1PGQA 4KMSA 3D0OA 5HRUA 3TPCA 1LTHR 2UYYA 5IFLA 2CSUA 3C7CB 1KY4A 3ONEA 4YA6A 4BNUA 2WE7A 5TX7A 4JXKA 2DBQA 1VL6A 4JBHA 3BTOA 4Z0TA 3ZWBA 2WD7A 1TI7A 2Q1WA 5FWNA 3B1FA 3PQEA 1MXFA 1E3IA 4B7UA 1DC5A 2C29D 1N5DA 4PG5A 3H5RA 4ND4A 1PZGA 1YQDA 4DQVA 4E21A 1UXIA 1C0IA 3HJAA 3I9MA 1PQWA 3GPIA 1EDOA 2HMVA 5KWEA 2DC1A 1LUAA 4ZQEA 2ZJ1A 3I4CA 4H15A 4MIOA 3BTVA 5C7OO 3GHYA 4FW8A 4DXHA 1CETA 1YQGA 2CF5A 2JAHA 5L53A 2WD7B 4XR9A 1DFGA 2CF6A 4FOSA 3PGXA 2B0JA 3FTPA 3KV3O 4TRRA 1HZZA 1WMBA 4BNJA 5DCUA 4E2YA 3Q2IA 1WWKA 1YGYA 5DP1A 5BSHA 1U9JA 4LN1A 3DZIA 5JDCC 5LDHA 3EC7A 5TQVA 3PXXA 1LC3A 1IULA 4M49A 1DRWA 1MC5A 1ZKMA 4XDYA 2AA3A 3AY6A 3GAFA 4P38A 4CJXA 1EE2A 3U0BA 4M55A 3ZU4A 2GGSA 1YL7A 3OHSX 1PS0A 4EW6A 2VYVA 4NFSA 4XQEA 3T4XA 3F46A 2QG4A 2X9NA 4IJKA 3PI7A 3ZHBA 2EIHA 2YV2A 3N58A 4R9SA 3I9KA 4ONEA 3GGGA 2ZYDA 1WLYA 2X58A 5B12A 5A9RA 2P5YA 4E32A 4W99A 1ZJYA 1PGNA 1WDLA 2C54A 4JBGA 5DCWA 2D4AA 4A7PA 1B16A 1DHRA 2ZQYA 2YV1A 1PIWA 4BB5A 4WOJA 1H6CA 5G4KB 2WTBA 1Z6ZA 4MVJP 1OC4A 1CF2O 1HZJA 4NK5A 4J7UA 3X2EA 1E1KA 2OHXA 5I7EA 2NSDA 3BXXA 1DJNA 3GVHA 1E3SA 1ZW1A 3L9XA 1Y81A 3KYCA 3OQ1A 4AICA 5IG2A 3IMFA 4EUFA 3E8XA 1YO6A 4CMJA 4PG7A 4NNJA 4WLOA 1J5PA 1E3JA 2HK9A 4RPKA 1NM5A 1PX0A 1PGOA 3I4FA 1PR9A 1PL6A 2Q3EA 2Q46A 3UKOA 4N5NA 3VDRA 5COBA 4CMAA 2VUTA 2P68A 4Z9XA 4BL5A 1YL6A 1LRLA 3PTZA 3H5AA 4BGVA 2A9FA 3HWRA 1YDEA 4CM5A 2GZ3A 3BHJA 1T24A 5C3MA 1Y8QA 1A7AA 1QYDA 2O4CA 4EZBA 3KYCB 1Y8RA 4WASA 3WX0A 4AJOA 3VZPA 4E5NA 1P1HA 1XLTA 3DHNA 3ZH2A 3JQ9C 2Y1OA 4L73A 4BNYA 4YAIA 3AI3A 2YDXA 1NAHA 2QHXA 4U8GA 1ZK3A 4MIYA 3GEGA 3I6QA 2CVQA 4IS3A 2H63A 1IPFA 2PV7A 2CDBA 4L0QA 4WGGA 3DB2A 3TOZA 3R3SA 4ALIA 4RF2A 3JYLA 2EW8A 4YT2A 2JD1A 3TZ6A 4YVFA 5LDGA 3TL2A 3VZRA 4GBJA 3OJEA 1FJHA 1OOEA 1Y8QB 2UUOA 3EGOA 3RUFA 5ES3A 2CVOA 2I66A 4MO2A 4P8RA 1Y8RB 3FTNA 2I6TA 3GMSA 5CHEA 2QW8A 4WCFA 4Y6PA 4BQRA 3QWAA 3RUDA 4LISA 3EVTA 3AOEC 5CPFA 3LDHA 5L95A 3IQDB 4IJUA 2Q2VA 4BV8A 2TMGA 4KUEA 1MC4A 2VN8A 3CPSA 4XB1A 2PZMA 2A35A 3HQ4O 1JDJA 4LGVA 3BAZA 4KUGA 1AXGA 2QIOA 3NAQA 2HKIA 1LC0A 3AJRA 3I83A 4S1VA 4TKLA 3SBOA 3WIEA 3IJPA 1BXGA 1ZK4A 4RPGA 3LLVA 1ZK1A 3RIHA 4WCFB 1I30A 1MFPA 2DBVO 2NUAA 4QX6A 2C20A 4WK6A 3GFBA 1I3MA 4YBZA 2E48A 3RQSA 3KZVA 3BHMA 3OF2A 5JBIA 3HN2A 4DBZA 1QYWA 3F3SA 4TRJA 1PS8A 2X4GA 8ADHA 1BVRA 4CLOA 1HEUA 5MDHA 1VE9A 4IIVA 3Q2KA 1DIGA 1ZIDA 4TZKA 3PIIA 4GX0A 2DBZA 4IGFA 3HHPA 4NMHA 3F4BA 3PWZA 2W2KA 5TLSA 2BI7A 3FWZA 5BQFA 5HA5A 5JAZA 2RAFA 1A5ZA 2PH3A 4CV0A 3E82A 2GN6A 2Q4BA 1N9GA 2IRWA 1NXQA 4INAA 1QYCA 3DR3A 1T26A 4AJ4A 5EMHA 5JPIA 3L77A 3HDYA 3PYLA 5G0TA 1DIRA 3EHEA 1ZZEA 4P4LA 4CLOB 1PZEA 2HLPA 3QHAA 1SZJG 5TSDA 5JDCA 1CYDA 1MUUA 3GVCA 1IZ9A 3I52A 3I9LA 1GEEA 5CDSA 2AW5A 2FPPA 3AM4A 3INTA 2Z1MA 4FFNA 1E3WA 3WWYA 1LDEA 3GNTA 5ILGA 3RUAA 2OORA 4E3ZA 5G2OA 1Q2XA 3MJSA 4GSKA 5JC1A 4EBFA 1DC4A 3ZNOA 4JIGA 4TSKA 1JN0A 4IZHA 4A27A 3N7UA 3R1IA 3VPSA 4B7XA 1N2SA 3WOHA 3SVTA 1H0KA 4QQRA 2R2GA 2PTGA 1UH5A 1I2BA 3AM3A 1UP7A 4I9UA 1PZHA 5I9NA 3OSUA 2GYYA 1HT0A 2WYVA 1S7CA 4HX5A 5G0UA 5L7WA 3U09A 4R1TA 3NYWA 3JTMA 2WYWA 4J7XA 4RLHA 1EUDA 2JHGA 2Y66A 4OHUA 2ZTVA 2JFFA 3D1LA 4WNCA 4N5LA 4J1QA 2BGMA 3NGLA 4FBGA 1R16A 4J43A 3NTRA 3PFWO 4RCVA 2PKRA 3P5SA 1XGKA 2BH9A 3C3XA 4UUMA 4CUJA 2IXAA 1SOVA 2W2LA 5DCYA 2PLAA 1B7GO 3ITKA 4KWHA 1U1IA 3PQFA 1HDGO 1NQTA 1P1IA 2P9CA 2DT5A 2OBNA 2WM3A 3ONFA 3G1UA 3PLRA 4ALKA 1R66A 2C7GA 2FZEA 2Y0CA 3CTMA 1YBMA 1NVMB 3G49A 4ZICA 1LX6A 2W4QA 1X7GA 3RWBA 4PZDA 4J4HA 2QYTA 3L9WA 5DBIA 4BMNA 4E13A 2HSDA 1O94A 1GQQA 2Y1DA 4BO5A 4TMFA 3I9JA 4Q39A 3GMDA 1T1SA 4BNVA 4XYMA 2I65A 3GG9A 3C7AA 2XOXA 4XQ9A 2BLLA 1XU9A 3H6KA 3RKRA 4O1MA 5KKAA 3MTGA 5B4TA 3Q1LA 4P22A 4FFLA 4NZ9A 3B6ZA 4IXWA 4UUNA 1QKIA 3WGIA 3LQFA 5IDWA 3BHIA 4YAGA 1KERA 3OA2A 1I2ZA 3NJ8A 1H6AA 3JQEA 3PJFA 3DO5A 3KEQA 4L4RA 4A0SA 4Z9FA 1PJ3A 3U3XA 5JNLA 4BNNA 5CDGA 4FD3A 4IQ0A 3QVOA 1PL8A 1MV8A 3LZ6A 3LK7A 1ZSYA 1C1XA 2YHIB 3E48A 2NWQA 4G81A 3E9MA 1KC3A 3IOYA 2BHLA 1DSSG 5KNLA 1JWAB 2VRCA 2WYUA 4L74A 2HAEA 2VYNA 1N1EA 4W7HA 1AXEA 5JYDA 2E82A 2X22A 2PD3A 3F5SA 4O5OA 3UW3A 4W6ZA 5JMPA 3WLFA 1HRDA 1J6UA 3VTZA 2RH4A 4WECA 2X9GA 1SNYA 2GERA 3LT0A 1UR5A 1VKNA 4NU5A 4AG3A 1X1TA 2EKQA 1IY8A 2FR0A 4GLOA 5IXSA 4N5MA 4FN4A 3L4BC 4LCEA 4U0JA 2DTXA 4WEQA 1I32A 1XKQA 3HDQA 3WQSB 4BO0A 5L51A 2Q50A 4AFNA 5KKCA 4ALLA 1G0OA 4G65A 1LI4A 5GZ1A 3OH8A 3KM0A 2NVWA 1K6JA 4FCCA 3CZRA 3O03A 2AG5A 4XGNA 1FDTA 1K0UA 3DBRA 1YONA 4FGSA 3JYNA 3ENNA 1ARZA 4U5QA 2VHWA 2IE0A 1WXDA 3C24A 3D64A 1M75A 1NNUA 1WDMA 2V6GA 3RVDA 4IS2A 1IHXA 3ZWOA 4LK3A 3VPGA 2DAPA 4IJVA 4WLVA 2IODA 5BNIA 2PK3A 4CMKA 4NBRA 1P1JA 1V3UA 3CEAA 4CL3A 3MWDB 2VT2A 3RBVA 2EGHA 3BA1A 5AXBA 3EUWA 5T5QA 5JSFA 1SPXA 4D46A 3HFGA 1K5HA 4RZIA 2Y67A 4BNKA 2Q4EA 3E18A 4GGOA 4HFJA 2X5OA 3AK4A 4D44A 5F5NA 4XGIA 1ADBA 4M54A 9LDBA 3P2OA 2HUNA 3HDHA 4FPXA 3ZV6A 2W2LD 3TRIA 5ADHA 3ZZNA 4QSMA 1OAAA 1ISHA 3L6EA 4YJHA 4CV3A 2XF8A 4LW8A 4PGFA 4B4UA 4XYLA 4LMRA 3KYDB 1O8CA 1RM0A 3RI3A 1AGNA 1DC6A 4HFMA 2OBYA 4CQMD 1NR7A 1E77A 1WZIA 4MVJI 5A9SA 1E92A 1U4SA 3MCVA 1L7EA 2Z1NA 3C1AA 2H5LA 4AJIA 2EP5A 1DJQA 4CM3A 1D8AA 1HETA 3IAHA 4O63O 1RYEA 3V1YA 3I1JA 4IQ8A 3JQ8A 4HP8A 3G17A 4JN6B 3P7MA 2CZCA 5AXAA 2HK8A 4JJFA 4PG8A 1JKIA 2X8LA 4YDRA 4HY3A 1P1KA 4CR8A 2R00A 4M86A 1N92A 3Q6IA 1ONPA 2AQKA 1I33A 1UXJA 1XWFA 2EKLA 1NP3A 1QP8A 2DVMA 1BGVA 3GDGA 5FI3A 3ZWYA 2I9PA 3VKUA 5JS6A 4E2XA 1JTVA 1CQIA 2POQX 4EYEA 1EZ4A 1P44A 2ZB3A 1DBVO 3UCFA 3H9EO 4W4TA 3GDOA 3O26A 5BR7A 5L3ZA 5JW6A 4ESOA 2HJSA 4LCJA 1GUYA 5G0SA 5JDIA 4BKRA 4I5EA 3A14A 4MP3A 3UOGA 5AXDA 2ZTLA 1H93A 4KQWA 3WYCA 1I5RA 3ETEA 3PYMA 3VH2A 1PTJA 1G0NA 2PFGA 2ILTA 2VYND 4PZEA 4DLAA 2DU8A 3R3JA 4CMIA 1XEAA 2Z5LA 1J0XO 5GZ6A 1PZFA 2JCXA 3NGXA 5CDTA 3GC6A 2O50A 4J1TA 4UEKA 1LDNA 5KTKA 1EDZA 2E6UX 3I6IA 4H3VA 4O6VA 2X0NA 2BRUA 3D7LA 3H5NA 2IZZA 8LDHA 2DTDA 4BO3A 1KY5A 2GLXA 1LNQA 1A9ZA 1HDYA 3INRA 3M1LA 1JVBA 3ORFA 4E0BA 4FOOA 2YYYA 4IDCA 3EAGA 1CRWG 4MINA 1P1FA 1Q1NA 3U4IA 4IDEA 2G82A 4BNZA 4RV9A 4CMIB 1GDHA 4K28A 1IYZA 2C0CA 3ANNA 3O4RA 1R12A 1SAYA 3DAPA 1U3VA 1HLPA 1ZMTA 3X2FA 4R54A 3Q0EA 2DQ4A 3BMCA 4NJMB 1NTOA 4DPKA 4ZQFA 1VJTA 1YL5A 4ZGWA 1H2BA 4E4YA 2EKPA 2OO5A 2RCYA 3KO8A 1V8BA 4LVCA 4UUPA 5JAQA 1QR6A 3JYPA 5EQDA 3GGOA 2GN9A 2YDYA 1JAYA 1VC2A 4UUOA 3DDNA 4UREA 3MJ4A 2YHUA 1I3NA 4I5FA 4Y98A 3KLPX 4ITUA 2F00A 4XQCA 4B3IA 3NTOA 3UH1A 4BMSA 3OJOA 3S1LA 4ZJUA 3F9IA 1PEDA 1LDMA 4J16A 3BMCB 5IDQA 3WXBA 3AUSA 4BO9A 2GN4A 1X7HA 3QWHA 4MVJG 4OXNA 5JO9A 2UUPA 3D4OA 1G1AA 4PVCA 1U3UA 2YQ4A 3I5MA 3V1TC 2GN8A 4DRYA 3TNLA 4R3WA 4Q9NA 1I36A 4NK4A 5A3VA 3B70A 3PWKA 1RM5A 1VPDA 3DFUA 1B3RA 3GZ4A 5BT9A 3PGJA 4B3HA 3G79A 3WNVA 2WMDA 1MG0A 4HNHA 2W8ZA 3M2PA 5COAA 3ABIA 4BNLA 2D8AA 5GY7A 3DHEA 4PLZA 4C7KA 3ROKA 4YR9A 3KTDA 1IZ0A 3QQPA 3HG7A 5FI5A 2OUIA 3T7CA 1JAXA 4E30A 1B26A 1N1GA 2NU8A 2AEMA 5TJHA 5TGDA 4PG4A 3EVNA 4ZVVA 4KOAA 5T6BA 1YB4A 2PZKA 1KIFA 4I5GA 5TS3A 1TLTA 1F06A 1SEVA 1Y1PA 4QTZA 3FRJA 4IJWA 4E33A 4PIVA 2FWMX 3IIEA 5JAMA 4J9UE 1ADFA 3WGYA 1R0SA 3A9WA 4PFJA 4AJEA 1RM3A 4BVAA 2O4UX 4OMUA 4YRAA 4TWRA 2O48X 3RROA 1ZSNA 2PGJA 1ISIA 4RVGA 2FPIA 2BKAA 2FHSA 4YAEA 3LLSA 1GY8A 2YFQA 4NU6A 2Q1TA 4RLSA 1U2DA 1JKJA 4YTEA 5B4VA 5ILOA 9LDTA 3FWNA 3PVZA 5U1PA 1GYRA 1PGJA 2H1SA 4GL4A 1TT5A 5TC4A 5KJ1A 5KVCA 1HYGA 2BELA 3U62A 5JCJD 2CNBA 1YOVA 1UAYA 4PG6A 3V2HA 1HDCA 3ETDA 2NTNA 3OQ6A 4D7AA 4R9RA 2HMUA 3WJAA 3O8QA 2IXBA 4OJNA 1ORRA 4BV9A 3E5RA 3CIFA 3D3WA 3WICA 1ISGA 3D4PA 3HB5X 1HSOA 2J8ZA 5I7VA 3TOXA 1VSVA 1E7MA 1I01A 1JLLA 2EJWA 4BS9A 4L9RA 1MX3A 1TT5B 4Q3CA 5J23A 4DA9A 1JW9B 4R51A 4K6FA 4YCAA 2FN7A 2HRZA 4FFMA 1WMAA 1YOVB 2DKNA 2V6BA 3WR5A 4F46A 3H2SA 3KB6A 3TDKA 4CMHA 1P77A 1ML3A 1AHHA 2BGKA 3ZNPA 1H9AA 2VHZA 1ZFNA 1BVUA 2XPCA 4BGIA 5K1SA 1GL3A 3WGGA 2NTVA 3B1KA 3ST7A 5HS4A 3TWOA 5ICSA 3COSA 3EY4A 1IOLA 1T2EA 4EJ6A 5L4NA 3RASA 3MZ0A 1LDBA 1U5AA 3E03A 1LQTA 2TMDA 4ZRMA 5JAIA 1FDSA 2EHDA 3F1KA 2VZ8A 4KTTE 2G76A 3U4DA 3WFIA 3WQRA 3QP9A 3H65A 2RBEA 3VH1A 1Q7GA 2E49A 3NTQA 2VNAA 1XA0A 4OSPA 5DDIP 1MXHA 1V0JA 3GG2A 3NRCA 4CM1A 1YKFA 4ZRNA 2JL1A 3QW2A 4DC1A 1KVTA 4AJLA 4J4TA 4I9HA 1A71A 5CFZA 2A94A 4EGFA 2CMDA 3RAJA 2B69A 4GLLA 4RPHA 2NNLD 4NG5A 4BO1A 1A4UA 2AHRA 3EYWA 3VZSA 2J3KA 1GYQA 2C82A 4FQ8A 3SLKA 3U9LA 4II3A 1Q0QA 1JA9A 4GH5A 1SB8A 3K30A 4B4WA 1WW8A 3DFZA 1Z75A 2ZB4A 4URFA 4WLNA 2Y1EA 1I10A 4IMRA 3F1LA 1ULSA 4HV4A 3TF5A 1M2WA 3D5QA 4GX5A 4W9NA 3NX4A 3VDQA 1XIVA 4A73A 4XWYA 3PRJA 3CMMA 2NVUA 4XGKA 3H4VA 3I3OA 3VPFA 3ZWCA 4KQXA 3ZV4A 5BNTA 3DEYX 4CQLA 1PJ2A 1T2CA 3WS7A 4XRRA 5JLAA 1F0YA 4AJ1A 3JQDA 4J6FA 2RHRA 3R6DA 1U3TA 3EK2A 1YQXA 2OOSA 3AI2A 4A2CA 2X6TA 4PLGA 2QZZA 2EP7A 3BMNA 1J4AA 5F21A 4Q3EA 4OOFA 2IZ0A 4PLVA 3DAFA 2XXJA 2AQIA 2DUWA 2EXXA 3ETGA 3VVBA 1PJLA 1QORA 3RFXA 1LBEA 2B4RO 3JD0A 4WKGA 5IZ4A 2YZ7A 5K6AC 1T2FA 4GKVA 1PJQA 3SEFA 1DLJA 1HE4A 1RPNA 4CMBA 1SCUA 1B2LA 3R0IA 4FJ0A 3DBHA 4YAJA 1VL8A 1F12A 4Q3DA 1GADO 3K6JA 2X0IA 3LU1A 1ZBQA 3BMOA 1Z82A 2P4HX 3BMNB 3MJVA 4FJ1A 1QLJA 1XYGA 1UAGA 2B36A 1KS9A 1ZSVA 3KHUA 2FPGA 3JQAA 3C1TA 4D45A 2CUKA 3DQPA 5TJ9A 4BQPA 5FYDA 5ENDA 4D41A 3H9QA 1DAOA 2VOEA 1HDXA 3GRPA 1HLDA 4BGEA 3RUHA 3WLEA 5THKA 3NT5A 4RVDA 2ZB8A 4D43A 4ND5A 2YFHA 2ZYAA 1E3LA 5KJ6A 2FP4A 3BZUA 3ZWPA 2B5VA 3BMOB 2BF7A 4TROA 3E9QA 2P2SA 1GCOA 1BXGB 2NQTA 4CLEA 1PWZA 3EMKA 4TRNA 3JYQA 3E6AA 4EEZA 2Y1CA 3OQBA 3H3FA 2DPHA 2BGLA 3L6OO 2WSBA 4XKJA 3H9GA 5LC1A 1TVEA 3DTTA 1KEVA 2VRBA 1R0KA 2DLDA 2AE2A 3GY0A 4ZQGA 2O7SA 4N18A 3IP3A 2R6JA 2IYOA 4CLDA 3NJ4A 3WSWA 4ND3A 2UDPA 3OECA 3UF0A 4ND1A 2W2KB 2J5RA 3E5MA 1PJ4A 1GZ6A 1N7GA 1R4MA 4Y67A 3U49A 1HDRA 1GPDG 1EEHA 4JP2A 1N9GB 5L40A 2HRBA 1YE3A 1K3TA 4AJPA 3BIOA 4P4GA 2J3JA 2OP0A 1Q7CA 2PGLA 3HZZA 1EQ2A 4BO2A 3GN2A 4IM7A 1M6WA 1E3EA 3DTYA 1T2DA 3HN7A 4R5HA 1QV7A 3U4CA 1BG6A 1RJWA 2R00C 5HBRA 5KJCA 5F3RA 2BI8A 1WZEA 2AE1A 2GR9A 3KYBA 4E5KA 1ZXLA 1VRWA 2YV3A 1E3WB 3NV9A 4M87A 1R4MB 2HMSA 4NBTA 4A10A 4OXYA 3SXPA 2BD0A 3ITDA 2GD1O 3DWFA 1V3TA 1GPJA 1M66A 4W82A 2GO1A 5K9ZA 4L4XA 1U5CA 1NFQA 3PZBA 3ZWAA 4DC0A 1OC2A 3GAZA 5JCXA 1V9LA 3AY7A 4BKOA 4IUYA 4H7PA 4OL9A 1GZ3A 5IN4A 2CY0A 3VOSA 4W7IA 4BNHA 4BO6A 2BFAA 5JDIC 3DMTA 1OZAA 1KBZA 4BNXA 3Q3CA 3ROMA 3OMLA 3P19A 1U7HA 2O3TA 4NR0A 4BO8A 1KYQA 1ENOA 3WGTA 1KVUA 3AU8A 4FIZA 5AVOA 4CQMA 4AJKA 1QXSA 3SX2A 3VC7A 3CINA 1NPDA 3K5PA 4B8ZA 4DMMA 4MJLA 5A04A 3ZHYA 1X15A 2PD4A 4I9NA 1SB9A 1DIHA 4Z9YA 3WJ7A 4MPDA 3ULKA 1B8PA 3DBLA 1VL0A 1KETA 5A02A 3FD8A 2HJRA 4BB6A 4Z3KA 2CVZA 3PQDA 4QEDA 2NU7A 5CG1A 3GUCA 4OM8A 1KEUA 1XQ1A 2Q99A 3H3JA 4WEOA 4YRDA 4YT4A 1X0XA 4CLRA 4TZTA 5DBFA 4HFNA 4R3NA 5IN5A 4JK3A 2J5KA 2QRJA 2OXIA 1ISJA 1AN9A 2JHFA 3WYEA 4CQMB 1LSJA 1MGOA 3K9QO 1R15A 2EERA 1VLLA 1P3DA 3JQAD 4GMGA 3ZHXA 1R37A 4C7JA 4N54A 3ZNNA 1XELA 3JQGA 4J2OA 3DBLB 1UDAA 5FF9A 3W4IA 2D5AA 2ZJ0A 4PZCA 1BDMA 2NM0A 1ZMOA 1ZH8A 5AOVA 1ENZA 3KRTA 4ND2A 4R16A 3I9OA 4OKIA 2C5EA 1AUPA 4XD2A 5HWSA 3A1NA 2FY8A 4LSMA 3RCBA 3U5TA 1B3BA 1PJBA 2VTDA 2ZCUA 3F47A 2C5AA 4JBIA 5T64A 1DEHA 4CUZA 5EPOA 3GVIA 4IGEA 5JE8A 3ROQA 1FXSA 2J3HA 3FR7A 4UVIA 1A4IA 2Y93A 4E31A 1R0LA 2C59A 4FSHA 2OP1A 3JQGB 2PWZA 3TQHA 5K6AA 5A5FA 1G6KA 2D2IA 4MKRA 5A9TA 3PJDA 2A92A 3QWBA 2O3JA 3ASUA 3PP8A 1PSDA 1VJ0A 3NDJA 2VZ9A 2IYPA 4XCVA 4DMLA 3K31A 4CM4A 1C1XB 1UXGA 2GF2A 4KDFA 4D0RA 2JD0A 1Z73A 5C7IO 3CZMA 1MB4A 3OP4A 4RQUA 5IDXA 1GUZA 1KEWA 1NQAO 4PLCA 4UEOA 3O38A 2GPTA 3PYXA 3Q11A 4KUHA 3OICA 3V2UA 4D3SA 3WGHA 4NHEA 5L4LA 1AE1A 4XJTA 3IKVA 2UV8A 2RH8A 4MOWA 4CMGA 3KUXA 3PHHA 3WBFA 1NQ5A 1LLUA 2VQ3A 4XB2A 2HO5A 3FF4A 4G2NA 3MJTA 3WGQA 2Q1SA 4XDZA 1BWSA 3QVXA 1K6IA 4ZD6A 4CM4B 4GX1A 3QVSA 2QRLA 2ZYGA 5GMOA 4J0EA 1RM4A 3UCEA 4BKQA 1GAEO 4U6QA 5F1OA 4NBWA 4NBVA 4CMCA 4MP8A 1ZNQO 4DL9A 1OMOA 2HMWA 2QX7A 1EK5A 1ZO8A 3DBRB 3IP1A 4DUPA 1FMCA 1XCBA 5I8ZA 3STHA 3QLJA 4BO7A 1E0DA 3ZDFA 4CLHA 4LRTB 4RVHA 1FF9A 2PH5A 3KLMX 1EMDA 3PLNA 4GX2A 3B20A 1ZVMA 5KOIA 2PKQO 2CFCA 3IJRA 3RD5A 3H7AA 3FPCA 2PKQP 3GA0A 3JSAA 3KSZO 2VWHA 2PY6A 2J5QA 5IXYA 2G0TA 4BNTA 4BKUA 5DP2A 2QQ5A 2Z95A 4FC7A 3MEQA 1QMGA 4IBOA 2VWPA 2PZJA 4YXFA 2NADA 4HXYA 2WDZA 2Y99A 2ZIZA 3G3EA 4JJGA 2W98A 3RUIA 5JXWA 1L7DA 3WMXA 2FMUA 4DYVA 4YJHB 3ZU5A 1LLDA 5KJEA 1NWHA 2ZQZA 1SEPA 4DTIA 3PWSA 1TEHA 2F1KA 1XQ6A 3F5QA 1YH3A 2EJVA 2OMEA 4GMFA 3IUSA 5A9SB 5I9LA 1GQ2A 3KEOA 2X7HA 5DOZA 4ZA2A 2GNAA 3E1KA 1Z45A 2B35A 5H81A 3OBBA 3PHIA 5T67A 4PLTA 3HB4X 3ANMA 1O5IA 3JQ8B 3PPIA 4F45A 3DOOA 3VPHA 5A5EA 1QLHA 1XR3A 3FBGA 2I3GA 2DFDA 4GPD1 4YB8A 4FC6A 3AUTA 1DIBA 1ISFA 1B0AA 4L4SA 4RF3A 3NEPX 3VH3A 3WYBA 2Q2QA 4GI2A 3AM5A 3GF4A 5U4QA 4BMVA 3FCOA 3JD2A 2UAGA 5TNXA 1HE3A 4CPDA 2PA3A 1DFIA 1WVGA 1E7RA 2EEZA 1U28A 5C5IA 3U4HA 1PJSA 1SC6A 2DUUA 2WD8A 2Y0DA 3W1VA 2WWRA 4YAKA 4D42A 3QIVA 1U8FO 4WUVA 3VAZA 1MA0A 1SOWA 4ILKA 4EUEA 1LXCA 1XSEA 1SO8A 1NASA 4B4OA 5JCJA 4FJ2A 1NR1A 4MKXA 5JO0A 4DQUA 4LRSB 5HM8A 1D4FA 1LSSA 5T57A 4KZPA 3DBVO 1NX6A 1BMDA 3DL2A 2VHVA 4K26A 1X14A 1QG6A 3DONA 2JCVA 4WLUA 4OQYA 4WE3A 4N7RA 1X1EA 5F1PA 4Q3BA 5JC8A 2E37A 4K9DA 4DIOA 3Q9NA 2JAPA 5DF1A 1ZK2A 3VKVA 1OBFO 5C7LO 3OIFA 3PJGA 1L1FA 1M67A 5CDUA 3JD3A 4OYRA 3RFTA 1I3LA 1YVEI 4FR5A 4TRMA 3WGOA 3GGPA 4QT0A 3NUGA 4BNFA 2B83A 2EGGA 4U7WA 3ENKA 5FFFA 1PJCA 3RUCA 3PHJA 4KDEA 4BNMA 3GRKA 4PN3A 1P0CA 3D3EA 1TT7A 1JU9A 1KVSA 1PS9A 3GQVA 4D3FA 2ZK7A 2A4KA 4PLWA 3SC4A 1XDWA 3RBZA 3DZGA 4FFPA 4GWKA 3M2TA 1CERA 4ZN6A 4XYEA 5TF4A 4KTVE 3ICCA 3W6UA 4W9NC 2WEKA 2OL4A 4GVXA 4B3JA 3S55A 1KC1A 3TJRA 5IZCA 3HE3A 5K0ZA 3VVCA 4PCVA 3WNQA 2X0RA 3AWDA 5AQ1A 4CM7A 3DMYA 3IDSA 4O59O 4QFCA 2VUUA 3W4JA 1DAPA 2X9VA 1BXZA 2EG9A 1Z7BA 2Q49A 4RF4A 1HL3A 1T2AA 5KJFA 1M76A 4CM9D 2VHYA 1GR0A 4EI2A 5EESA 2X23A 3JQCA 3UHAA 3V2GA 3JQBA 5ER6A 4TQGA 2C7VA 1KVQA 3S2EA 3PZRA 3EDMA 3TFQA 3JV7A 4NH4A 4HKTA 1KVRA 2V7PA 5IAAA 1GZ4A 1C0KA 3AOGA 4OSOA 2Q1UA 2NQ8A 4CMEA 3ZV5A 1T4DA 3OM9A 3AI1A 3AU9A 3GUYA 1NVTA 1HTBA 4QFDA 3JD4A 4YEDA 4BKPA 4RQTA 4YQZA 2FR8A 3WWZA 2G17A 5A06A 5MGBA 3NT4A 5DNAA 4Y6SA 1O95A 4OO3A 2GDZA 2W90A 4YT5A 5CP8A 4WCDA 2GSDA 5TIIA 1HE2A 1K6XA 2AG8A 4IDBA 2O2YA 4QECA 2BFOA 3JQ6A 2E4AA 2FR1A 2NVBA 2PGDA 2ZKLA 4HBGA 2V65A 3E9NA 2DTEA 4IY1A 3V5NA 3RJ9A 4Z0HO 4I1IA 1YBVA 2GCGA 1N8KA 3OA0A 4D79A 2ZTUA 1VSUA 4YQYA 1DOHA 1I0ZA 1EBFA 4CUKA 1I24A 3WIDA 1FDVA 3MWEB 4YJDA 4HWKA 2IDZA 4RVSA 5CAEA 1RWBA 4QO7A 3GVXA 4J49A 1JKFA 3K8ZA 2EWMA 3ZCXA 3OEWA 1LDYA 4OXKA 5L7YA 4XR4A 4IDDA 3GDFA 1GEGA 2CDAA 3SC6A 4DYDA 1IE3A 2VTEA 3H2ZA 3JQ7A 4JP3A 3W4KA 1QV6A 2FSVA 1HE5A 2J6IA 4RO0A 1LJ8A 2O3SA 1W73A 3WDSA 1P9LA 3CKYA 3ZWWA 4BNIA 3NDRA 2B4QA 1EVYA 1ENYA 4J91A 4LMPA 1QYXA 4YRBA 3V8BA 4QXMA 4FFRA 4RPLA 4A5OA 1IPEA 4J9VA 3PFFA 5BSFA 3KOUA 3WMWA 1NYTA 3TFOA 2HU2A 3O8QB 3QJ5A 1DRVA 3LC2O 2B37A 3JQFA 1UXKA 2WE8A 3JQ7B 4G5HA 5A05A 3FNHA 3W6ZA 1QSGA 3AUAA 4ALJA 5A3JA 5DN9A 1DIAA 3D3WB 3GHHA 3GT0A 1PR3A 4Y8VA 5JMWA 3LT1A 1NQOA 5EJ2A 1U3WA 4Q3NA 1HYEA 5G4KA 1HXHA 2V6FA 1DDOA 1YJ8A 1FK8A 4AJ2A 3T4EA 4E5PA 3C8MA 4DWVA 4NQZA 3ZU2A 3TZQA 5H82A 1EVJA 1ULUA 1M6HA 4NIMA 4FGWA 5KVQA 4XRGA 5I8WA 5B4UA 3W8EA 3MJEA 4BO4A 2GUGA 3LVFO 4XJSA 5L45A 2DM6A 3HSKA 3DMTC 3IUPA 1CDOA 5CDYA 2ZCVA 1U2GA 1X7DA 4RF5A 3OIGA 3CMCO 3GPDG 4I5DA 3ZHZA 1W0CA 1E5LA 1GD1O 3VZQA 4ALNA 3OETA 1C14A 2NU9A 1LRJA 3BTSA 1DPGA 1O9BA 1TXGA 3AFNA 4Z3DA 5F5LA 1LU9A 1E1MA 4DLLA 3UXYA 3AUUA 1P0FA 2G1UA 4LVUA 4R4JA 1E6EA 5T8KA 3AY3A 1MG5A 4GVLA 3ZGYA 1XU7A 3ZV3A 1Y5RA 2C2XA 2JFHA 2YW9A 4PLHA 5TRTA 3WG9A 1D1TA 4MP6A 3OEYA 4OAQA 3BMQA 2YY7A 4D3DA 1E5QA 3CXRA 2I99A 3BTUA 1BTOA 4WPGA 3RKUA 4BGUA 3CE6A 3LF1A 3RC2A 3PHLA 5I7SA 4MVJE 3DZHA 3FNEA 2C07A 2P5UA 1U8XX 2VT3A 1OI7A 4OIMA 4J4BA 1A9YA 1P1RA 4H16A 3JYOA 3FNFA 5H83A 1V35A 2IEBA 3MOIA 2AEFA 1NHGA 4L75A 3TN7A 3EW7A 4JGBA 4D0SA 1ZJZA 3UCXA 4HNGA 4XZ3A 2QZ9A 3D5TA 1Y9AA 6ADHA 2ZATA 4RZHA 3DZFA 3BMQB 2NVUB 1WP4A 2O3RA 3GK3A 1XHLA 4NFHA 4ROSA 5G4LA 3QE3A 4RVUA 3VPXA 1HYHA 4CQLB 3S8MA 4J3FA 4XIYA 3FNGA 1A72A 3LSYA 3VTFA 2CDCA 2DBRA 3RU9A 1O0SA 2HK7A 3FPLA 4MVJH 1LDGA 2VHXA 1LRKA 3NKLA 3OFSA 4MVJM 4ZHSA 1OFGA 1Z7EA 3D4NA 1SBYA 3BYZA 1K2WA 5B1YA 4UEJA 3SLGA 3TL3A 4IDFA 4AJHA 1HWYA 1NFFA 3K73O 1C0LA 4JQCA 3EZLA 2AXQA 5F1KA 1NVGA 3NDIA 4JX8A 4EJMA 4XA8A 4BIIA 1PJTA 1CIVA 3I9NA 1EFKA 3TZKA 3DBHB 1UZLA 1ENPA 5IF3A 5LCXA 4B79A 1P74A 4Y6RA 2LDBA 1NAIA 1UZMA 3F6YA 3H9UA 1YWGO 4R5MA 4YACA 3K96A 2Q45A 3PJEA 3JQAB 3UN1A 2IZ1A
chains in the Genus database with same CATH superfamily
3WYNA 1E6CA 4NBUA 4P7GA 3ZHOA 4D98A 5C5CA 1IUKA 3LFTA 3MINA 3OIDA 2VHTA 5IRCD 1H2HA 3ZVRA 1GILA 2AMJA 1RRVA 2XXBA 3E9YA 4N0PA 1F5SA 1ZEMA 1UDCA 1S5PA 2FSSA 1TYZA 4Z6KA 4HYQA 2J09A 2JFUA 3BJMA 4JLWA 4A03A 3OEED 2FP4B 1ECCA 3PK0A 5KNCD 1M2KA 2A1UA 1MVLA 3L4KA 4UTRA 1JIKA 5GZ3A 1PWXA 1DXYA 3R20A 3S2GA 1K06A 1RCFA 3OG9A 1ZAKA 2DPGA 5HCIA 3KL2A 5E4YA 1DHTA 3W9SA 3A28A 5JYBA 3UKDA 2K5UA 5L3SA 1BHSA 1XEXA 2ZEJA 3B82A 3Q10A 3WRWA 4DRXA 1U11A 2Z9BA 1R6AA 4QUGA 2A78A 4R7GA 5BNFA 3VBEA 4FB5A 1HF3A 5FEMA 5ITVA 5KEIA 4F86A 1DNPA 4AKSA 3U1VA 3DE0X 3I28A 3M8KA 3LHDA 5CEFA 2CKMA 4E07A 1H4QA 3C3DA 5IBQA 4YCBA 2X1LA 4GAEA 3TH5A 4C5BA 4ZYZA 1JEOA 2PQ2A 1USUA 2EZ8A 4FE4A 3R7FA 3W06A 1CB0A 1RAIA 1LWOA 2A1UB 2C4WA 3CGWA 3PGMA 4I8IA 4GBGA 1W0JD 2WUGA 4KRGA 2W2OA 3K6SB 5K03A 3I64A 5AOAA 2M6KA 4AVYA 3ASVA 5KQGA 1HLFA 3GLQA 3K9GA 4I36A 5F9HA 1MABB 1RYMA 3NBFA 5FUYA 2JGFA 1F6DA 5ILQA 1F2UA 4EEKA 3HEMA 3L7JA 4X41A 1NUSA 4J8PA 5JQWA 5L3SB 3V4OA 1SZPA 1UC8A 4RW0A 4DRXB 5JSQA 1DJLA 4WXMA 4ID3A 4C7MA 1GZ5A 4FZRA 3RFUA 5BSUA 3E84A 3NAMA 3SPXA 3OFVA 3QENA 4I7EA 5E6SA 3AYXB 4PSAA 2JJMA 4C4TA 3OT4A 2BJWA 2XOEA 3PQCA 5EINA 1HNXB 1Q57A 4F5WA 1G4HA 3CH4B 3OLWA 1E9DA 4KYUA 5FULA 3WQQA 1XA4A 2Y0EA 4EB6A 1JAZA 3CZAA 4X95A 2I4MA 3KSMA 3M89A 5SZIA 5A0TA 4EO4A 2D0DA 1H6DA 1Y5MA 3E58A 5JADA 1PP4A 4TYPA 3AEUB 4DA7A 1L7BA 1U31A 3ZVNA 1GAWA 3D0QA 2BZ1A 3L8CA 3RBXA 3AILA 1GZUA 2C4MA 2RHTA 1XHFA 4ZDJA 2A9JA 1A9PA 5D84A 2BFFA 3DYBA 4KSCA 4ARCA 2OZPA 4TTVA 2EF1A 2QI9F 3OFJA 5I4CA 1YFKA 2G71A 1E2FA 4UMEA 2F59A 4CNQA 2IUYA 1OF1A 1C1DA 2J1LA 2ZSUA 3AFMA 5E6SB 3LP6A 4E5MA 4F2GA 4QHYA 5C1BA 2Q6KA 3AEZA 1M6VA 3KHTA 4LRYA 4R1SA 5LWHA 1BSVA 4JP1A 1XHEA 2A0KA 2APJA 3DFKA 4EB6B 2GMWA 2OBBA 4MVJF 4MI6A 4PRKA 4RL6A 2F1JA 4UE3S 2OFPA 5KTPA 4XWWA 1FYXA 1DQZA 1Z2EA 4FYJA 4BFVA 1CCWA 1JU4A 3C3CA 4K9SA 1OLXA 1ZHHA 2D8MA 1GUDA 5ANRB 1V11A 4PRLA 2YYAA 3VU1A 2IDJA 3A9VA 3RSGA 3GJTA 3G5TA 4AJJA 4O4IA 2JLVA 1KS2A 4YECA 2QM0A 3I0ZA 5A2GA 3L4EA 4RXMA 1C4XA 4N8DA 5B37A 1C1DB 1SCKA 4P2GA 4DQKA 3IL2A 4AN1A 1ZRHA 3ICPA 2QE6A 4B74A 3KOMA 4AROA 4PLYA 1DJMA 3G2LA 3MT8A 2AG6A 2DHEA 1U2QA 1UPAA 4EEXA 3QFTA 4MXDA 3TZCA 5BSEA 3PEVA 4B76A 4ZTZB 4YMUA 4JQYA 3R8CA 2P9YA 3QVTA 3NBAA 1HDZA 3LLMA 1Q0ZA 3N2EA 4JMLA 3IC5A 1BO6A 3ZDZB 4L8VA 4EJ0A 4EWLA 1OBVA 4G0YA 1Z7GA 2W22A 4DLZA 1OLXB 3FN4A 4DSUA 4L85A 2X5JO 5CEJA 5EYPB 3OWOA 5BXYA 5U9CA 1T25A 4FGUA 5IDVA 3RTEA 3IQIX 1GUBA 3SHQA 4OLBA 2WPNA 3LHKA 5EXEA 2CYAA 4V0KA 2LXNA 2JLYA 3IUQA 4XLZA 4PZ0A 3Q2OA 2O23A 3GLHB 5IZCC 1VFNA 3TKAA 4B1FA 4Q9AA 3T3DA 1XI2A 4AZ0B 1UZNA 2Q7DA 4BQIA 3QE9Y 3KQUA 2FE1A 4HMOA 1GJRA 4AMYA 1H5UA 3ZHVA 4DCTA 3M5DA 5A6SA 3FLEA 2GAFA 5ICMA 3FCUB 4N76A 1UT6A 2VJPA 1OHHD 4FFOA 4C4OA 4PZZA 4IJ6A 1L7OA 2MU1A 2Y9MB 1RFLA 2LKCA 4GWGA 4GF5A 1A82A 3CX4A 3W05A 2V1XA 2FDCA 3GRYA 1CEQA 2JA1A 2I3AA 2M9MA 3MD9A 4MV6A 4BJHB 2LVBA 1H9CA 1A9RA 1MB0A 1TAHA 2GAAA 3RC7A 4DCNA 1TECE 5TMPA 3NHPA 4MKIA 1QVZA 5BT8A 5JH7F 3THYA 4CM6A 2G28A 3T4UA 1H0SA 3HYRA 4EGJA 1QRRA 4D80A 4DT1B 4PLFA 4R69A 3H9JA 2ZRGA 2YKGA 6LDHA 3NBZC 2JIOA 1AKWA 3EFEA 1LFDB 3WNDA 3GCXA 3KR2A 4AQDA 2A1IA 5A6SB 2X5KO 3DM9B 2PRKA 2WVJA 1ONBA 2PNJA 5L9AA 4LJRA 2JGDA 2F43B 2YHSA 2WF5A 1FSSA 2AZ4A 4ZU3A 4DSZA 1H6BA 2F3TA 1EH5A 1P80A 5EKXA 2GN1A 2R4UA 1NMQA 5IARA 1YZUA 1PF7E 3VSDA 5BN5A 5KTYA 2XCIA 5HIMA 4F3NA 3GELA 3COYA 1SR8A 5CCDA 4D57A 2RC6A 3E7WA 1A50B 1W581 4PWZA 4TV8A 3ZLJA 1MIOB 1JR3A 3QTBA 3HCEA 2G5CA 3KBOA 3KYDA 4HADA 4J0GA 4BFUA 3DOCA 2GPAA 2V55B 4CL8A 4PYRA 2GEBA 4MMYB 4O2BB 1ZRMA 1NONA 2QNBA 3N8HA 2ANCA 4HN9A 4LXHA 4M1ZA 5JMTA 1NNEA 4Q1CA 3WKCA 4IIUA 4Y1GA 2WFMA 4IWXA 3VBCA 1SMKA 4NF2A 4F6CA 4QBHA 4E6PA 4CBVA 4P83A 1KOFA 2P9GA 5EIFA 1BH2A 2FPXA 2OILA 3S29A 4A5SA 1P73A 4EUHA 1D09A 3EGVA 3QPUA 4BRWA 5JHHB 3W9UA 2QT1A 3JYHA 4GIBA 4UBMA 5FHRA 2DPYA 5BN5B 1CWUA 3LT2A 4XVHA 3S1SA 2VJOA 2YQ5A 5KIAA 2EW2A 1D6NA 2HYDA 2P9FA 1UPBA 3BQ9A 2DR0A 4U0KA 3G0OA 2AS0A 1SCIA 4TV8B 4Y6QA 5B2FA 4LF7B 1JNYA 3VV3A 2RSLA 2R6GA 2WNHA 1ZXXA 4MVJA 5CH8A 5FV4A 1HKUA 2DE0X 3JTEA 4G8JA 4NEHB 3S5UA 5EUQB 1B8VA 3LX5A 4YH1A 1J8MF 4II2A 3GFGA 2VUSA 4KBGA 2OV2A 3HI6A 5KMGA 3F73A 3AEYA 3P2JA 1DO8A 3WC4A 5KNBH 4JJZA 2UVDA 4U7TB 3Q7IA 1T3ZA 1Z6AA 3H9CA 3G23A 3IAS1 3DQZA 3DXYA 3MW8A 2W4IA 2XZLA 4MV3A 4TYMA 5FNZA 1TCCA 5HKBA 3RFFA 1XFDA 1H66A 2JANA 4JKOA 2IEDA 1Y1LA 4MWTA 1R4ZA 1RKQA 3ZI0A 2TRSB 1JEYA 4HZGA 2OQVA 3FCCA 3KXKA 3WSVA 3P45A 4XWKA 4E2WA 1VKJA 4WT7A 4OXRA 1MV5A 1S2MA 2DWOA 4MW9A 1BRTA 4BV2A 4L7VA 4X6XA 1U8ZA 4GC5A 2BLNA 4LWZA 5CJPA 3EG9B 3ORHA 2QX4A 2JEZA 4HBZA 1OXSC 3H8VA 3I3SR 5BPHA 1KI6A 2C04A 2KB0A 3PFHA 2HWXA 5D00A 3TVYA 3FYCA 1A8SA 3U13A 3EDCA 1Y8ZA 2XWJI 3HO8A 2C84A 1E2IA 2HF9A 1RRGA 4IQ4A 2C1ZA 2NO7A 1CJTC 3RADC 1S2OA 1U99A 3IS3A 8ATCA 1OZGA 1VLZA 1ADGA 3PDJA 2QTNA 2FQYA 4RY8A 4M89A 1JEYB 4HI0E 2IL1A 4MUEA 1PYGA 1A9SA 1XCLA 2FPUA 2VQFB 5C1PA 3M5PA 3V1UA 2VKTA 1NFRA 4LF9B 3MQ4A 2IOQA 1VA5A 2OCKA 2GRAA 3H0KA 3KSAC 4BNGA 4QGGA 1CY4A 4FS3A 4CL2A 3NC1C 3GFOA 1KI6B 2R5NA 3S44A 4AF8A 1ONNA 4LYEA 4M76B 3IKTA 3P4XA 4OK6A 4YRRA 5H7XA 3HSYA 1K89A 1EE9A 1HLGA 3LGAA 5F51A 3DG9A 5LMCA 1VP3A 2CCKA 3HVUA 4RJLA 1FRVA 1X38A 3NHLA 3G1TA 3KVOA 4IDAA 2Z6UA 1QH1A 1MP0A 1YAJA 2YZGA 4TL7A 3WZ2A 4B0OA 4BN5A 1Y89A 4MYTA 3VO2A 1AS2A 1Q3HA 5HKOA 2BF4A 1BFDA 2XODA 4WZ6A 1JQAA 1QIEA 1M0WA 3GYBA 2OYRA 3EX7C 4QGFA 5A4IS 5IU6A 2PLNA 3NM4A 4K3VA 4RHXA 5CYOA 1PEYA 2YRXA 3TL6A 5F1YA 4R05A 5FTWA 3ND7A 5DLYA 3PUVA 1EZZA 1P4SA 2R8XA 2ZB7A 3OE4A 4UFPA 5EIEA 3HWSA 4ZQHA 2YNMD 3GNSA 4LX8A 2BKLA 4AY6A 1PLLA 2REQB 1Y9EA 2QWXA 4XFDA 5DM4A 1CW2B 3UFXA 2EKBA 2P9EA 2ZSDA 1P2FA 2R62A 3N5KA 3GR6A 1BRMA 4UJ5A 2UZ0A 5TT0A 3SXJA 1JALA 5J9FA 4URVR 1ZCJA 3OJFA 4AQYB 1LA2A 4L3WA 2XKJE 3GEMA 1Z0ZA 5COQA 1V8OA 5AVKA 3V4RA 3LPCA 2HMTA 4EKIA 4HS9A 1RJEA 4A0QA 3C4QA 4AXXA 2ZTMA 4DUGD 3MFYA 3BD6A 2GASA 5LMUB 1RZUA 3S27A 3WBBA 1D2RA 2VZ0A 2OV4A 3AP3A 2QQEA 3B5JA 3TSCA 1F8GA 1M2VB 1NZFA 3JCZA 1KQOA 4EI8A 1O2DA 4OFZA 3LCMA 4I8XA 4K3UA 2OHIA 1NRJB 3BE4A 4U2GA 5EMMA 1M8GA 2QSYA 4KP7A 3T5TA 4CODB 1UBGA 4AL4A 1MN6A 3PIDA 5LQUA 1L8XA 1FVOA 1VKOA 3RVOA 2WIJA 2H4JA 2VWQA 1T36A 3SYNA 3ZCVA 3QX3A 1BE1A 1S8OA 5CXSA 3TNYA 4IINA 4DLRA 3O4IA 4NPAA 3ZXSA 2PNFA 2I5PO 4YQEA 1RKBA 1SVUA 1PAUA 2VQSA 3UWOA 2JRCA 1JYFA 2VAWA 3INGA 2FRDA 3NDPA 4MH0R 3W8FA 3TZHA 4CXMA 3CLHA 1FQOA 2EJCA 1P6UA 3SJBA 4WCFC 3F97A 3L8HA 1KZHA 3OUZA 2Q1XA 4ER0A 4XQGA 1GCUA 4HDCA 3GAAA 4IF4A 3E1SA 4RIGA 3NGMA 4R1UA 1H42A 2RGYA 1FFEA 3EEIA 4NZZA 3NHJA 4E12A 2WHXA 3MWFA 4LWOA 2FWAA 3ZU3A 3GH3A 2C4KA 3BJIC 1CUHA 1Z9BA 5ALWA 1YS4A 3BRSA 1T1JA 5I4KA 1G2IA 4F3YA 2W6ZA 1W88A 1SBTA 2FEKA 2ZUSA 3HJTA 3OU6A 5H0IA 1WSAA 1P6XA 1RLOA 2FMFA 5IFLA 3HTXA 4JEHA 1N8TA 1O9GA 1H1TA 1KY4A 3C7CB 3D3KA 1HFJA 3ZDDA 2QPOA 5BW5A 4PSCA 2GTPA 2J3LA 4QXQA 4C0JA 3TTSA 4F1KA 1CQZA 1KNXA 1F2TB 3BTOA 3K1JA 3T3HA 1VBFA 2VDOB 4ARBA 1NT4A 1IUNA 1DX4A 2AMLA 2WD7A 1EFTA 5DHRA 1YIAA 1M2HA 4CCSA 3W3ZB 2I7VA 4LXQA 4EZIA 1TEVA 4B7UA 1DC5A 2C29D 4C2BA 5J4KA 1JSXA 2Y1XA 1ZGHA 4DQVA 2IS2A 1EBBA 2YVUA 5J1TB 1LPAB 1WY7A 2R1UA 3ZCUA 1KYXA 4PPGA 1W88B 2ACEA 1PQWA 5JNUA 2IYYA 4ANFA 3I4CA 2Q3CA 5HF6A 1WSBA 4FW8A 4DXHA 4S1NA 1E8NA 4F0JA 1X1RA 4M6WA 1NOJA 2E21A 3KTOA 2NO9A 1G6Q1 2H4XA 2WD7B 3MWGA 1VE1A 4XR9A 5LU8A 4QWWA 4RTSA 1ZH6A 2CF6A 5AIBA 3PGXA 5LOVF 4E2YA 5BSHA 2UXDB 3Q2IA 4F3CA 4C06A 1SRRA 2ZPTX 4UW9A 4XTRA 3DZIA 3EQ8A 3LO5A 3BXPA 3HJCA 3AB3A 4P84A 4CRWB 4HQOA 4ZVTA 3EF0A 2BGJA 3Q3EA 2R4QA 1GLGA 1GT6A 4V0ME 3GPBA 5DV9A 2V74B 2WT4A 2G6BA 3LBAA 4L15A 5EI5A 4G36A 5FRDA 4EARA 2CHEA 4UM8B 4CJXA 3GGJA 4GOND 4O8CA 3VNQA 1AQJA 4A0FA 1OI4A 5CVDA 4G5XA 4QTTB 4BQQA 3DVLA 1JR6A 4RANA 2A0FA 1GZVA 5IC6A 4XQEA 1L4NA 4A1FA 3F46A 3B8EA 4CDGA 4C7XA 2BMJA 1PJRA 3X2SA 4UNQA 3VNSA 1SUWA 3AVTA 2EIHA 3Q7EA 5EHGA 3ZU6A 3I9KA 4JC8A 3S1AB 5CB4F 2C9OA 1E59A 3H86A 2VH5R 1YA6A 3EZ6A 2ONJA 5B12A 1VTKA 3OEEA 3PE4A 5A9RA 3VZBA 4W99A 2HA4A 2DP4E 2YN2A 3HGMA 4Y0NA 4ZCPA 2C54A 5IAEA 2M1XA 4H18A 5JXGA 4L8YA 4Y7CA 2D4AA 1KH2A 3VU9A 5D2CA 5AVWA 3IP8A 4IIYA 2YV5A 4KAAA 1MNQA 3P9NA 3BB4A 1CF4A 2R8BA 4WOJA 4FQ7A 3G2HA 1BXRA 1CT9A 2CWDA 3GU3A 1EAYA 3IAS6 1R0CA 4H0CA 5HCUA 4QLBA 5KHLB 5JXHA 3H5VA 1HZJA 4F4FA 5JEDA 2HDWA 3WV5A 1XZIA 4E03A 3I12A 1ZKDA 5ETJA 4IMIB 4MUHA 5AKZA 421PA 3LYHA 4EMUA 2HDNB 4ZALA 3GVHA 1YU6A 4XLLA 1QOZA 4J75A 3L9XA 3OQ1A 2B0CA 1R0XA 5IG2A 3KQKA 4LZOA 4CEIA 1E6LA 3SYRA 3N2YA 4L1KA 1WF3A 1YO6A 2M1ZA 4O2AF 3VU9B 1SQ0A 3I4FA 1PL6A 3BRQA 2Q46A 1M8PA 1VMIA 4N5NA 3CUYA 3UWMA 4CMAA 2P68A 1JQ3A 1LRLA 2JI8A 2SKDA 2ZR7A 2WT9A 4GFDA 3WLAA 4GP6A 2WU3A 3VU0A 3W5AA 1PN3A 3O84A 2VSNA 3ZZ1A 1XD9A 2IYXA 1YDEA 4CM5A 1HNZB 2PPLA 5PGMA 1FRNA 1Y8QA 5C3MA 3W5CA 3PXEA 4HC4A 1T0UA 4N03A 4CEIB 2FAXA 2XA2A 4TTQA 2O8VA 4M9UA 2AKYA 2VBGA 4AJOA 2PGOA 3UAXA 5IM4A 1T2NA 1X77A 4OFWA 4IIJF 5CCXA 2B6NA 2I29A 2ORED 3AI3A 3LBIA 1NAHA 4DQLA 3H2YA 1ZK3A 3Q7PA 3EZNA 1H8HD 3GEGA 1RWNA 5WRFA 1B6RA 2AIRA 4L0QA 4WGGA 1J2JA 1WUIS 3TG2A 1MOZA 2BUBA 4CF5A 1E0SA 2GWRA 1FLAA 2PYZA 1QU2A 4TQ9A 5LDGA 2YC4C 3LNCA 3OJEA 4LF5B 1ZD2P 1Y8QB 3B13B 3RUFA 1IEXA 3SHTA 4EKYA 1S0UA 4E4RA 3CBQA 3T3IA 5GIPE 4AKHA 1R0BA 5FH9A 5CHEA 2QW8A 1FEZA 1WW2A 4DJJA 3GRAA 4WCFA 1CP3A 4Y6PA 4LTNA 4TV9F 3EFOA 5HCNA 1EXMA 3QWAA 5EC8A 3IPYA 3R74A 5HOQA 3ER9A 4G1BA 4C78A 4D4JA 3CZPA 3EVTA 1RAHA 3VR0A 4IF6A 1QUEA 1I3OA 5ESRA 2XDWA 1E64A 2EATA 3C87A 5ELMA 2IYSA 3SOPA 3LDHA 5L95A 3FDZA 4NZMA 2TMGA 4D6YA 2ECOA 1SXGA 3H5TA 4I5IA 1EDBA 4A8TA 3HQ4O 2ZUTA 1XVVA 4JLKA 4MWZA 4CZ2A 4N7BA 2BDTA 2R8OA 2W6MA 3B9BA 4NCIA 4S1VA 4EY7A 3IJPA 1T4GA 4BX8A 4RPGA 3B51X 3Q8LA 4WCFB 4PYKA 4YUWA 3A8TA 1L3IA 2DKFA 3EFOB 1JQJC 1T9CA 2IDMA 2NUAA 2V8OA 2WMNB 3M9LA 4WK6A 4A0GA 1I3MA 2E48A 5HK9A 4MQEA 4Q0MA 1NRIA 3S2UA 4AZTA 3TOCA 1F1JA 4RZ2A 3HN2A 3USES 2X2OA 2OVFA 2VPPA 2V4MA 3ICQB 1PS8A 4F3RA 3FDZB 1BVRA 2G1KA 2RARA 2V03A 3ZBUA 3W77A 4DYHA 4LJ5A 4OLHA 1VB5A 2JNWA 1DIGA 1ZIDA 4JJAA 4UE6A 3CKMA 4ERXA 5EJAA 2ZI5A 3LUJA 4GX0A 4RU1A 2RHDA 2ZPUA 4X3OA 4ACBA 1NQXA 1SK9A 4A91A 4DCPA 5JSKA 1Q74A 4QXOA 4UBKA 5JD3A 4HEQA 3EAFA 1KTIA 4JBYA 4MGKR 2ON6A 5HA5A 4EG6A 2AXPA 2RAFA 1AKNA 4RX1A 1Y1TA 3E82A 3JS5A 4YUVA 2NUAB 4INAA 1N9GA 4YGYA 2AD1A 4MQEB 4KSYA 2R7LA 3NPMA 3DR3A 3O8CA 4D9BA 4D5GA 3PEUA 4LKRA 2Q3BA 1ZZEA 2JJ2D 3PQ4A 5FP0A 3VOBA 4YN3A 5HBGA 2UVPB 1G16A 2I6FA 4TMWA 3AUJB 5TSDA 3K70D 1IVSA 1MUUA 3MHPA 2LBPA 3ZLUA 3LHIA 1IZ9A 1V39A 2F9FA 1EI9A 1GEEA 2H7YA 3CH7A 3HKBA 3I9LA 3KVRA 4N65A 5CDSA 3AM4A 5ADWA 3INTA 1CR2A 2UYCA 3G9QA 1U5BB 4QUBA 5DXFA 4NMMA 3BORA 1JZTA 2VJLA 4Q4JB 1N75A 3WLTA 2HT1A 4I6EA 5F73A 3FHOA 1AURA 1T5IA 1U9CA 4JIGA 4GMDA 1L8OA 3T7JA 4UTNA 5DWDA 2RK6A 3N7UA 1UBLS 3MPOA 1F6BA 3FPBA 3G82C 3LWZA 5HFJA 5CBPA 3G2NA 4FLEA 1ZX1A 2I2BA 721PA 3DCJA 2ATIA 5CVCA 5KNBD 2C98A 3NTXA 1UF9A 1PZHA 4I9UA 3OSUA 4W5HA 2H1HA 1S7CA 4HX5A 3FGNA 5G0UA 4HQ0A 4F38A 1EFAA 3DWGA 3WLLA 1JP7A 4KQIA 3NYWA 4WFKA 1DTWA 3JTMA 3K70B 1C0EA 3HKBB 1QH8A 1JEQB 2IK8A 3ZGOA 4OHUA 4OJKA 4I6JA 2QAGC 1M6YA 1X3LA 2Q3MA 3IEMA 5FNVF 3CEHA 3ZX5A 2BGMA 3LBNA 2QTVA 3MBOA 2Y1KA 4UPVA 3HH8A 2ZRJA 3ND9A 3O75A 5FADA 2J45A 4J43A 1RYYA 1WJGA 1B41A 1ZAYA 2HIHA 2RGDA 2W6CX 3P5SA 4PSUA 4TXHA 3C3XA 2GBFA 2X7JA 1R6VA 4GXRA 1AQIA 2IXAA 4WH0A 5CBPB 3TCKA 3C8HA 4KYTA 1X3SA 3GJRA 3PSAA 1B7GO 5DSTA 3WOVA 4LZZA 4D4IA 4EVRA 1HDGO 1KE2A 3ONFA 2OBNA 5LN1A 4LG1A 1OASA 3G1UA 3ND5A 1QVRA 4P34A 3ZDQA 1R66A 4M99A 1OVMA 3TS1A 1ZJ5A 4IO0A 2C83A 4AULA 2HRRA 4Z86A 1YBMA 5AVUA 3GT4A 1NVMB 3L2OB 3W1WA 4WKCA 1UMBA 2HLDD 2JIRA 2W4QA 5DI9A 1GAJA 3RWBA 3UUGA 2OHHA 2QTVB 5B5SA 3DT6A 1DAFA 1DKMA 4OQLA 1E1RD 1UBTS 2HSDA 2CXUA 2VK4A 1RHKA 1UJCA 2JCSA 1VRCA 2RB5A 4IX9A 4I8DA 5AVQA 1R0YA 2RKBA 4TMFA 3GMDA 1N0VC 1NXSA 2I65A 4DV6B 1XV5A 3C7AA 3ORQA 3R4VA 1NC3A 5BSMA 3LDFA 2PEYA 3RKRA 4CHGA 2JVIA 4RQAA 1XDGA 2CJPA 5KKAA 1G5HA 2B9EA 2NU6B 3KFVA 3LPLA 4LYYA 5D5QA 2QL5A 1BE6A 1UFOA 3RS4A 4R4JA 4P86A 1Z2OX 3LUCA 1NXOA 3DWEX 4ZMSA 1UMBB 4NZ9A 3VU3A 1QKIA 5KCMA 1TRHA 2NT4A 3S7TA 5IDWA 1RDFA 2H0QA 5CURA 3A4NA 4YAGA 3OPNA 3FUUA 4P3KA 1ZMRA 1C30B 1USWA 3K0CC 2XE4A 3PJFA 1OFTA 2BEVA 1DKOA 3PKZA 5GP1A 3DEIA 5K5EA 5CNJA 3VX3A 2CJXA 2PTHA 2DPMA 3A1WA 2C5LA 3HU3A 3HYSA 4Z9FA 2FN9A 3A1VA 3HCFA 3VMMA 4UPDA 2M6SA 5JNLA 1K5GA 5CDGA 1G55A 3RTCA 3GO4A 4FD3A 3DDUA 4K9RA 2ZI7A 3QVOA 3LZ6A 3K2IA 2O2IA 2VP6A 2R5WA 3RLFA 4EYSA 5IXJA 2YHIB 1RTKA 4FCWA 5FR2A 1M1XB 3E9MA 5KNLA 1BJKA 3ELWA 2VS1A 1QO0A 1OZFA 1PJAA 3GJ8A 2XLBA 3OPYI 4XAQA 3B6IA 1KMMA 3T1VA 1K92A 2ATXA 1WUTA 4BE4A 4I9FA 5LWQA 1AV6A 2CHFA 1VI5A 3CZQA 3MTQA 3I2KA 3NWJA 3VOTA 2JFYA 2H3EA 3F6SA 5JMPA 1J6UA 2XD9A 4YLYA 6YASA 2RH4A 4D4MA 3BXOA 2GERA 2BEVB 2ISCA 4YPFA 1ATIA 1IY8A 1ZU5A 3CZ9A 3RG2A 5IXSA 1XQ9A 4V0MA 3R9KA 1JLHA 3JASB 4KK3A 2RC5A 4P33A 3ZE9A 2V0NA 5KDDA 5KYWA 1LY1A 5HEKA 4G85A 4RKQA 5K3SA 1T8WA 1ZN9A 1CUWA 1XMXA 3JVUA 2DTXA 1QBGA 4U0JA 4YAFA 3CRQA 4BIMA 4RTKA 1I32A 2IBTA 1AHNA 1FSFA 4JL5A 3UMVA 3ADDA 1PYDA 2GF0A 4LXYA 5KSZA 2VXCA 2BSXA 1KAOA 1NP6A 2P2NA 3H05A 1LI4A 4ODIA 1TFUA 2GHQA 5FQOA 3KM0A 3L8YA 3ISJA 3QYJA 2GKGA 2W93A 4FCCA 1W5FA 4GXTA 4QHTA 2F3PA 2RGNC 1DX6A 1E79D 3NEAA 5D3KA 1S01A 2G9NA 1K0UA 1RKVA 5F4BA 3VO9A 1YONA 1PV1A 4FGSA 4GNKA 1ARZA 4LOKA 4U5QA 1S89A 3TIGA 2QM7A 1HOXA 3C24A 3D64A 1CY8A 2YNMA 3T7TA 3RVDA 3T5MA 4B47A 1DO0A 5BMVA 1AB5A 1IHXA 4G9EA 3G8DA 3PXGA 5KNDH 1Y4UA 4XEUA 3VPGA 2PT9A 1DTEA 2C58A 2C88A 2VBFA 5BV8A 5JASA 1OI3A 4WLVA 5ABPA 2HF7A 2GZDA 1O9HA 3D6VA 3AHHA 3HC7A 4RACA 3L0IB 2EL7A 1P1JA 3CEAA 3UMBA 3RRZA 4DV0B 2A57A 3TZLA 3F67A 3ZD9A 4ZT2A 2XRMA 1IBRA 4F2DA 2EGHA 2RB4A 2V3WA 5AXBA 5HX7A 3VA7A 3IYLW 3S5JA 1JXAA 2Y6UA 2ZAMA 1F5NA 1K5HA 4OP1A 3VRHA 2Z8ZA 3AXTA 3E18A 3EZ2A 4MRMA 1OTYA 3LY8A 2Q9CA 4OB8A 4PQEA 2X5OA 3LKVA 3E9ZA 2AL7A 5K3FA 5SY6A 4QDTA 9LDBA 3RNLA 4UKDA 5BMVB 4QLOA 2UXCB 4OQDA 2W2LD 3TRIA 4OHZA 3CWCA 4Q4LA 1P19A 1GT91 1OAAA 4ARSA 3L6EA 5FUMA 2XTZA 4RPCA 1UBJS 4PGFA 3BDAA 1C3JA 1TIKA 1TKBA 2H48A 2OGWA 1RM0A 2CK3A 2N9UA 5KBYA 3RI3A 1JDUA 2ZVQX 1X1DA 1OXBB 2L69A 2WA2A 3LCVB 4HFMA 4LOHA 4PW0A 4B45A 4DLPA 1BD3A 1NR7A 5JZVA 2W11A 5IPFA 1E92A 1U4SA 1JSLA 2ONCA 3UQYS 2H5LA 5KQPA 2EP5A 1DJQA 3CYFA 2EHJA 5IX8A 3G0CA 1SKUA 3UBTA 3G0IA 4LF6B 1D8AA 4MRMB 4AW9A 1L4EA 3FAKA 2QW0X 1YU9A 3IVGA 5LFAA 2F55A 1BEZA 3L1IA 3I1JA 5K3FB 1O0CA 2QV0A 1DKQA 2ZRAA 2M6RA 3M0EA 4JN6B 3T5CA 4KG7A 4V03A 2C2OA 5AXAA 3T99A 1WETA 1HV8A 3GFVA 2XMZA 3PC3A 2WWVD 3C45A 5IF9A 2QYOA 2X8LA 3L8MA 3NIBA 4M1TA 4MSUA 2R00A 4MMZB 5DLDA 2AQKA 1DCMA 1SUBA 1R5NA 1AIPA 1WPXA 4N3CA 1BQEA 4G1FA 3I8SA 3RV3A 4RA9B 1JMVA 2XQIA 3WHKA 2ZS7A 5FI3A 4NZYA 3RYCA 3THWA 2FQQA 3GEEA 3MGKA 3KVVA 4LBWA 2XVAA 2SKEA 4TS1A 4EYEA 1S2DA 2BEKA 1P44A 4AO8A 3EPHA 3B3AA 2O2XA 1DBVO 4KVAA 4L5CA 3C3AA 4KZKA 3D43A 4W63A 4W4TA 1NN5A 2Z83A 1USIA 3UJDA 3R0QA 5EQJB 4X8MA 1Z4NA 2WZDA 4HWOA 5GJWC 1LI5A 1ZCFA 5G0SA 1N1DA 3O94A 3Q3GE 4I5EA 5C1OA 4DMCA 2H17A 1P61B 4MP3A 4OREX 4TTIA 1KR5A 4IJMA 1V71A 1YTUA 1H93A 2YN0A 3KJHA 4KQWA 2X15A 2JVJA 1I5RA 2QAGB 3U4AA 3K32A 2F1RA 1UBMS 4IHJB 1G0NA 1OAOA 1JBEA 2ILTA 2LKDA 2FW8A 2XE7A 1SD1A 2AFRA 3RSOA 3THWB 3W2GA 4CMIA 1QE0A 1N5RA 2Z5LA 2E4WA 3DLTA 3L02A 1PZFA 2JCXA 2CNKA 5CDTA 3QOXA 5T41A 4GOKA 5CD9A 4ZAGA 3LY9A 4D9HA 4K0KB 5AW0A 3UPUA 3FE2A 4FX2A 2B5OA 3NR2A 1TFRA 4BECA 4GDFA 4TN1A 2ADFA 2X0NA 3ZG6A 3VSEA 1TU3A 1OV6A 2GM4A 3ANYB 5HIKA 1YDGA 1G2OA 4BO3A 3T35A 5AJHA 2ZM6B 1U0GA 4LXIA 4YRGA 1E96A 4EJ2A 2PUBA 1G63A 5E1BA 4HDRA 5IT9A 1JVBA 3H1GA 3ORFA 5EIWA 2GPJA 3ID6C 4E0BA 1N34B 1ZISA 3K70C 2XZPA 4XIFA 4MINA 1GPNA 4IWNA 1OH6A 1Y37A 1DC7A 4KN6A 1HEIA 2G82A 4EFDA 2RGUA 4RV9A 1BHQ1 1AKEA 2YZ2A 3K0CA 4CMIB 3ANNA 4DZTA 4QNMA 1G9SA 4FZ3A 1EWTA 2X3UA 2X8AA 3HJBA 3O4RA 1YVUA 4KKXB 1U0JA 1W85A 2DQ4A 2N42A 1LK0A 1FX1A 1Q11A 4YC7A 3KDPA 1G3UA 4OXXA 3LPAA 1YL5A 1G8AA 1A98A 2NXJA 4G9GA 4BPBA 3TXXA 4JLNA 3EEBA 4YMLA 2OO5A 2Q0HA 4UUPA 3A1TA 3JYPA 4DZRA 2WTAA 2YJ3A 3FDXA 4PO3X 4HDRB 2GN9A 5CTJA 4MARA 1JAYA 4PTZA 4M1MA 2HPAA 3UA4A 4D3XA 1KP2A 1WUKS 2IYRA 4UREA 3MJ4A 4GLJA 3TSAA 3VZDA 3V8NA 5JJBA 5DHPA 3N39C 5IAGA 3RTDA 2Q4DA 3A11A 3CRMA 2HZBA 3KLPX 3NPAA 4ITUA 5B64A 1GFWA 2WI8A 2FVYA 3HRKA 3H2KA 3L0PA 4XOIA 1XRSB 4UNRA 3O9VA 4XQCA 3NTOA 4LY3A 3ZGVA 1N6IA 4HQFA 3ZWKA 4TLEA 4Y7DA 3RVQA 4ZJUA 1F8YA 1W85B 1JIVA 1PEDA 1LDMA 3PHBE 4KEAA 1VIYA 1Z2DA 1XNHA 2WWXA 4REOA 4MJ7A 2GN4A 2ID9A 4N0EA 3U17A 3U4GA 4Q16A 1ZA2A 3UY4A 4BO9A 4BDTA 4DV2B 4YP1A 1FRQA 1JMKC 1K7CA 2FHPA 4OXNA 4Q9KA 3LH5A 5JO9A 3TM4A 3TXYA 4RMJA 5JBNA 4PVCA 2QNRA 4B40A 2VF5X 3P0RA 3KJEA 2W5UA 2G6TA 4IQFA 4LZNA 1RTTA 1SQ5A 1Q15A 4HG2A 3TNLA 2Y2VA 5AM0A 3UMMA 5A3VA 2WHRA 3PWKA 3FIUA 4U7PB 4M46A 2LD4A 3G5MA 3GMTA 2JLBA 7MHTA 1YJCA 4I55B 5E9JA 3AKZA 4Q4HB 4R2JA 1PCXA 3UPDA 4QYTA 4L0CA 3EZ9A 3O2NA 3G79A 3LRTA 3OZAA 1E9EA 4JL8A 2WU4A 5EP2A 4YP6A 3WNVA 3UUEA 5IWCA 4M8LA 2A88A 4TM7A 1ZH2A 3M2PA 1RWQA 4JB3A 4KQ1A 3SE7A 2IUFA 2RG7A 3U7RA 2D8AA 5GY7A 2IUSA 4X90A 2C57A 4HCJA 1K7YA 3D3NA 2QSJA 5E9WA 3GZTB 5FI5A 2F3SA 3QYAA 3CLRD 1JAXA 3DEKA 2AC2A 3QX7A 5FJJA 2NU8A 4TMXA 3F96A 2CCGA 3ETJA 3KR9A 3O90A 5G53C 4ZVVA 3G5UA 5CFPA 2PSDA 2I6UA 4IX1A 2QNIA 2VDPB 2WWTA 4KI7A 1KIFA 4KOAA 3GLUA 4UOQA 3UGJA 1PO7A 4JC4A 1SEVA 2W37A 3MWEA 5F77A 1CUXA 3DDHA 3EVEA 3FSEA 1MQ9A 4QBGB 4DNXA 3IE0A 4IJWA 4E33A 3NUZA 4G0XA 4GWLA 1U2ZA 2FWMX 5JAMA 1CVLA 3KYIB 4J9UE 1ADFA 3WGYA 3ZUPA 4CTJA 4PFJA 5I8PA 1WMSA 2HN9A 2HDOA 1PL0A 4BVAA 4EOGA 1KI1A 1KIAA 4M8KA 4OMUA 4YRAA 2Q3LA 5FXMA 3TSOA 4BWFB 4TWRA 2O48X 4LOIA 2JDIA 2JKYA 3C14C 4LWQA 2BVNA 4G0QA 4O4HF 3D1VA 4K03A 3R40A 4YAEA 2WKSA 2XMPA 1FXUA 5J4HA 1WBDA 4JT8A 1VQ1A 5EJ9A 4EBBA 3D2AA 4RD3A 2VRNA 4XPZA 4YTEA 1K88A 3T9AA 3HA2A 5BSRA 3SK0A 5D3ZA 2EYQA 4FX5A 2G5PA 4PQYA 1PGJA 2H1SA 1PFKA 4GL4A 5DXJA 2OGZA 4LC0A 4EG3A 1R4AA 1ZGZA 4PG6A 1A8HA 1HDCA 2QXUA 3FLBA 3C5HA 3V8EA 4A15A 2GB4A 4D7AA 2AJLI 3L8EA 2HMUA 2I2AA 3FTEA 2VHQA 3PQ7A 3LW7A 4L4YA 5AUQA 3L84A 1SC9A 3CIFA 1OA1A 2PZFA 1QYRA 4JU8A 1PDOA 3NDBB 3WDLA 3WICA 2PX3A 3LG2A 3C3KA 3V8PA 1RAFA 1AKUA 2V45A 3RYIA 3D4PA 4NONA 3R7BA 2ATVA 3M4JA 1VSVA 3LVQE 3IVRA 5GJVC 3FLMA 1JLLA 2IYZA 4JT2A 4BS9A 1MX3A 1O57A 4Q3CA 4DA9A 4KK4A 2VIIA 5KYYB 4FFMA 3OZWA 1UBFA 1J9ZA 3OQIB 5H9VA 5FLXA 3WR5A 4S2UA 1NNLA 3WGKA 3H2SA 3KB6A 3TDKA 4H6XA 4CMHA 2ZT5A 3JAWA 3ZXXA 1W4BA 3VYTB 3CSUA 2VHZA 1ZFNA 2WTUA 4UMDA 1UOPA 2IQIA 3K9FC 3WGGA 2NTVA 4WCVA 2AMVA 2C00A 5HS4A 1ZI9A 3TWOA 4G8BA 1EFCA 1G5FA 2VG8A 3EY4A 4CE6A 4HB0A 5L4NA 3J7AC 1SQGA 3U7QA 2C96A 3QM1A 2DY0A 3RASA 2JFZA 1MC8A 3KUUA 1LDBA 1JLLB 3FFXA 1J1IA 3HXTA 5DRTA 4BJ1A 1FDSA 2W6PA 4OATA 4KTTE 4PGMA 4TWAA 4B7AA 5FPKA 1KJ8A 4J6EA 3VYRB 4DMKA 4EPRA 3WQRA 4BMYA 3H65A 1ZG3A 3VH1A 5EE1A 2YUIA 2ZJZA 2IPOA 3M6XA 4PXSA 4X20A 1EP9A 4Z49A 1R88A 3DPUA 2A5YB 2WWWA 3KT8A 1P60A 1DUSA 3UV7A 3M49A 4ZRNA 3FPFA 3WHLA 4D1YA 3R2JA 3NU1A 4I9HA 1EWVA 4DUYB 2A94A 1SIUA 2XB9A 4MRNA 4KCGA 4DLNA 4MI3A 3H5OA 4GNRA 4MITA 4NG5A 4BO1A 3HK2A 3IBGA 3HVIA 4QYMA 4IDHA 4HATA 5ALHA 2C82A 4JUBA 3DUFB 4LYJA 3SLKA 2MSLA 4DIEA 1C9NA 4NARA 3K1TA 1WLSA 4HLQB 1WHTB 4GPEA 4ZODA 1E6MA 2KLHA 5HJEA 1NJ5A 2Y77A 1SB8A 1SXJD 1IIBA 2QMQA 5KNBA 1FPQA 4X20B 5KZMB 1JSCA 1Z75A 1LBIA 1MRNA 3HJHA 3MRTA 2QTHA 4U00A 1I10A 3OC0A 2O2CA 4WMLA 2GN2A 1SBHA 3Q40A 3REFA 4OCZA 5J2TA 3R5SA 3MWJA 3R3WA