4A0SA

Structure of the 2-octenoyl-coa carboxylase reductase cinf in complex with nadp and 2-octenoyl-coa
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
445
structure length
445
Chain Sequence
SSLSRAVLDGASAAEIEAAPVPDTYLALHLRAEDADMFKGVADKDVRKSLRLGEVPMPELAPDEVLVAVMASSINYNTVWSAMFEPIPTFHFLKQNARQGGWATRHDQPYHVLGSDCSGVVVRTGIGVRRWKPGDHVIVHPAHVDEQEPATHGDGMLGTEQRAWGFETNFGGLAEYGVVRASQLLPKPAHLTWEEAAVSPLCAGTAYRMLVSDRGAQMKQGDIVLIWGASGGLGSYAIQFVKNGGGIPVAVVSSAQKEAAVRALGCDLVINRAELGITDDIADDPRRVVETGRKLAKLVVEKAGREPDIVFEHTGRVTFGLSVIVARRGGTVVTCGSSSGYLHTFDNRYLWMKLKKIVGSHGANHEEQQATNRLFESGAVVPAMSAVYPLAEAAEACRVVQTSRQVGKVAVLCMAPEQGLGVTDPDLRARLGEDRLNPLRGLTAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords OCTENOYL-COA REDUCTASE/CARBOXYLASE
publication title Unusual carbon fixation gives rise to diverse polyketide extender units.
pubmed doi rcsb
source organism Streptomyces sp.
total genus 162
structure length 445
sequence length 445
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4a0sA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4a0sA01
1DRUA 1R37A 1HDYA 1BMDA 1PS8A 2VHXA 3UXYA 1P31A 1U8XX 4AJEA 3S2EA 4JIGA 3C8MA 1A7AA 1K2WA 2VHVA 4PLTA 3BMOA 4CM8B 1SEPA 3JD2A 3ZWAA 4K1LA 4XZ3A 4RPLA 3DMTA 3KLMX 4RVUA 2J5RA 3OFSA 5MDHA 3GRPA 4WNCA 4M49A 4GKBA 3INGA 5DNAA 2NU8A 3WICA 5A9RA 1P33A 1X1EA 4LSMA 1O8CA 3CZRA 4E5MA 1QSGA 2GSDA 3PEFA 3OJ0A 4CV2A 3GT0A 4X54A 3WQSB 2BFOA 4M8SA 4QX6A 3FF4A 2HRBA 3B70A 4A73A 5H82A 1B26A 3HDHA 4JJGA 1DFGA 4NFYA 1BWSA 3GN1A 2Y93A 3H3JA 3OHSX 3DHEA 3UCEA 5ES3A 4OO3A 2GR9A 5G4KB 5T8KC 1SCUA 1NAIA 4MVJD 4HY3A 5TSDA 2PD4A 2X5KO 1NASA 1CWUA 3LYLA 4D41A 5C7IO 3NGLA 1DIRA 5C5IA 3KRTA 1X1TA 1XWFA 2Q3EA 4FN4A 4QT0A 2AEJA 5AVOA 5A9SA 4EJMA 5B12A 4L4XA 1A9YA 3WGIA 1M76A 1Q2XA 2XXJA 2B4RO 1EQ2A 5BSHA 5HRUA 3LF2A 3RU9A 4CR8A 1YE3A 1EFLA 3ZU2A 3I1JA 4K6FA 4CMCA 1HE3A 4FOOA 4PLYA 1PJSA 2E4AA 3SJ7A 4ALLA 4DGSA 5A02A 1Q0LA 3PJEA 1R0LA 5DCWA 4K28A 3I9JA 1PGNA 5KVQA 1X13A 3P2OA 3RJ5A 1PTJA 3EMKA 3RC7A 1HTBA 1IHXA 3ON5A 5JNLA 1XDWA 4DBZA 1VJTA 3QP9A 4PRKA 1ZXLA 3G3EA 3AUTA 1U2DA 1Z45A 1EDZA 2OBNA 2GN8A 4B8WA 4CL3A 1YRLA 1KVUA 3WS7A 1G0OA 4GPD1 4GKVA 3WMWA 1P1KA 1UUFA 4TRJA 1MP0A 2X9NA 4JJIA 3RIHA 4WE3A 1T24A 3UOGA 3ROMA 3JQ7A 5L7YA 2ZB4A 1R4NB 1YH3A 3FTPA 4ALMA 5ITWA 2EV9A 1X7GA 5A5FA 1GUZA 3D3WA 1UXGA 2CF6A 2OHXA 2UYYA 3FSRA 3OJOA 4IXTA 2EJVA 4R3WA 1U4OA 6ADHA 2OO5A 2NU7A 1N8KA 4BMVA 2PA3A 4Y6PA 1U2GA 2E48A 4N7RA 4MVJP 2J6IA 1V3TA 1I3KA 3ANLA 2QRJA 1WPQA 3VH1A 2NWQA 4TVOA 4EEZA 5IF3A 2EKQA 3TJRA 4IMRA 1HDGO 1XYGA 1WAMA 2J5KA 5JAIA 2EW2A 4O63O 3DAFA 3OMLA 4CMHA 3H65A 1LUAA 2WEKA 3EYWA 1DC5A 4LVCA 3W8DA 1EK6A 1B8PA 1DBVO 3I6QA 4I5FA 4CUZA 3H5NA 2YV3A 2ZCVA 4WPGA 1P44A 3PYLA 3VZPA 3PP8A 3NDIA 4XR4A 3SBOA 5TRTA 4A27A 1PGPA 1R16A 2Q49A 2EG9A 1P45A 4YPOA 4OKNA 3DBRB 3C1OA 2PNFA 4LSWA 1PZHA 2G76A 3NT2A 3RUDA 4TKMA 1Z75A 1IZ9A 4YRDA 3KEOA 4EITA 4EI2A 4JLWA 4CMIB 1U5CA 1PJ2A 3E5RA 1HWYA 1CEQA 1K6JA 4PG4A 4UEJA 3K2BA 5DOZA 3EY4A 1CQIA 1WDKA 3ZWBA 1E3IA 4FR5A 5TT0A 2C54A 1ZFNA 3TFOA 3I9NA 3ZH2A 1DLIA 1AXGA 1HZJA 4IPTA 2A94A 1Q7BA 4XQEA 1QLJA 2ZB3A 3JYPA 2DBZA 1SAYA 3A06A 4LRSB 1MA0A 4JP3A 4R51A 2WTBA 2JD1A 2YFHA 1GYQA 4NR0A 1B3BA 5EINA 4J9VA 1EE9A 1CDOA 5TGDA 3NJ8A 1NP3A 3CKYA 1F12A 2W4QA 1LDYA 1H6AA 3UN1A 1DHRA 4W82A 1FF9A 2C2XA 4MO2A 2Y0EA 4EW6A 3CPSA 1M66A 4D3SA 2BI8A 4OQYA 2W8ZA 3VVCA 4Q3BA 4G2NA 3QW2A 4PG5A 3ZU4A 4YTEA 4XJSA 3ZWCA 4UVIA 2W2KA 3HDQA 3PLRA 1ISHA 4ZA2A 2XXBA 3AOEC 3OICA 2AXQA 4YAEA 4YBZA 1NYTA 2Q1WA 2VYVA 4I5DA 3E03A 4FC7A 1WVGA 4M55A 1NQOA 4PLPA 3I5MA 1DC6A 2Z1NA 3GF4A 4J2HA 4NJMA 1NPYA 1NWHA 5F21A 1MFPA 4R16A 4KDEA 4R1TA 2I5PO 4PLCA 1Q7GA 1JQBA 2OP0A 4XD2A 3EZYA 3W4JA 1ADCA 3QE3A 4BO1A 4RO0A 3Q1LA 4Q3NA 4BNTA 4BKQA 5JYEA 1PZEA 4ID9A 3GEMA 2C59A 4HP8A 3OIGA 3WGZA 4OM8A 4KZPA 2DAPA 3ICCA 4DLLA 3LLSA 3IUPA 2OZPA 3GZ4A 4CMGA 3I6IA 2Q50A 1FDUA 3BXXA 3ZHXA 4Q3AA 5TJHA 1EUZA 3QWIA 3ONDA 1E1NA 1X0XA 1B15A 1SPXA 1V9LA 2EXXA 3PQFA 5DCUA 3SXPA 3VPFA 4E30A 5KVVA 1NPTO 1KOLA 4EJ0A 3QQPA 1HSOA 4PLHA 4CQMA 1J4AA 3RBXA 2IRWA 4B3IA 1BVRA 2G17A 3AUSA 4FOSA 2HK9A 1R0SA 4J4TA 2PGLA 3HB5X 3WYCA 4J2OA 3N74A 2Z95A 2PFGA 4OKIA 4Q3DA 2DTXA 2AE2A 4J7CA 1GYPA 1C0PA 2DTEA 4XRRA 1E7MA 3WBFA 3WGTA 5TLSA 2GDZA 4J90A 5K6AC 1LX6A 3X2FA 2YQ4A 3FBTA 4HWKA 1MUUA 4ALKA 1NFQA 1Z7BA 3GN2A 3S2IA 4E21A 1ENPA 3EDMA 5DCYA 1JU9A 4MIEA 4XKJA 5HS4A 1ENYA 4XQ9A 4PVDA 1J6UA 3RFXA 4BNZA 1HE4A 1OAAA 3RVDA 4HNHA 1QMGA 5BSFA 4S1VA 1HDRA 2PR2A 2RIRA 1PL8A 5HA5A 3TQHA 2JCXA 1SNYA 2FPPA 4NFSA 4RQTA 3RD5A 4RF3A 4UULA 1HSZA 2HJSA 5F1KA 2FR0A 4TRMA 5A03A 2EW8A 3C24A 1RYDA 2ZK7A 1SBYA 3BHMA 3T7CA 3W6UA 4RL6A 2LDXA 2Y66A 1JAXA 4AICA 3MOIA 1N2SA 4PLFA 2IZ1A 3KV3O 1XU9A 4UREA 1PWZA 5CP8A 4Z9YA 3OJFA 4AJIA 2CFCA 1GPDG 4L4SA 4BGEA 3EVNA 3PK0A 5EJ2A 1IPFA 2X22A 2P9EA 3D3WB 3D5QA 1A4IA 1P0CA 4B4WA 2YW9A 1B3RA 1B16A 4FFPA 4XDZA 3TFQA 3JYNA 4PG8A 4GX5A 3MEQA 3L4BA 4CQMD 4MP6A 4GSKA 4WCFC 1LEHA 1HRDA 2WYVA 2Q1SA 1YJQA 2EWMA 1EFKA 3ETGA 3TRIA 5COBA 3ASUA 1KEPA 5L7WA 5I8ZA 2EIHA 1HYHA 3O4RA 3JQ9A 1IPEA 5JDCA 3CZMA 2EP5A 3D1LA 4XQCA 4B7UA 5JS6A 3T4XA 3JYOA 4KUHA 2VOEA 4MDHA 2G5CA 4LCJA 2WDZA 2ZJ1A 5BNFA 4TZTA 2OL4A 2CMDA 4NQZA 1YOVB 4C7JA 2VT2A 1KVRA 2DU8A 3JQAA 3GRKA 3UF0A 1C1DA 3H9EO 2HO5A 3N7UA 3ADPA 1E7WA 4DWVA 1PX0A 1MGOA 1PJQA 3DOJA 3Q9NA 3H3FA 3JQEA 4A0SA 3OA0A 3E8XA 3RUCA 2J5QA 3TWOA 1ULSA 3PGJA 5AXAA 3B1JA 3GZNB 5EPOA 3DBLB 3KOUA 4DIBA 1SMKA 4B8ZA 3GVHA 4D44A 2X0NA 3NDJA 4FW8A 1KEWA 1DAPA 3BMQA 3INTA 4XYLA 2QG4A 3OP4A 4DYDA 4GX2A 2Y05A 3H9QA 1OFGA 3DMYA 3ZDFA 3BTVA 4ZJUA 1D3AA 1EBUA 3ABIA 3KLPX 5T8KA 4TQGA 3B1KA 1MXHA 1QP8A 3FCOA 1WWKA 1H5QA 1DHTA 4G81A 2VHZA 3ZWXA 4HUJA 3OQ1A 3MJVA 2RH4A 1UR5A 4D3DA 2ZTVA 1UZLA 4MIYA 1PEDA 3COSA 4C4OA 3ZHZA 1CERA 3ZNNA 2R00C 2ZTLA 2Q4BA 3NX4A 4YAIA 3TOXA 5L9AA 2DM6A 1SO8A 4NBTA 2J3HA 1YB1A 1WMBA 3S55A 3W4IA 1QR6A 2V6MA 3CE6A 4UVGA 3ZWVA 5HTOA 1SC6A 1KC1A 1YO6A 5COQA 4BKRA 4DQXA 3VKVA 3LT0A 1I8TA 1PQWA 1H6DA 3QVXA 4JCOA 5JY6A 5T57A 3E18A 2CF5A 3IAHA 1I3NA 4RLHA 2B37A 2Q2WA 2JAPA 2PGJA 2WWRA 3JQAD 3WSWA 1Q0QA 1L7DA 1F06A 2V6FA 5TS3A 3ZNPA 4OHUA 2FR8A 2PD3A 3P19A 5C7LO 4CM3A 4YT4A 1EDOA 1BXZA 2JFFA 4NJMB 4JJFA 4B3JA 3IS3A 4WLEA 4AJLA 1G0NA 4BUCA 2BGKA 2CD9A 1UXIA 1GR0A 2Q4EA 4FQ8A 1ZMTA 3JTMA 3G79A 4BO8A 4CMKA 5C37A 1N92A 2VWPA 4A2CA 3JQGA 5B1YA 3IL2A 1XGKA 1GUFA 2BHLA 2GUGA 4U6QA 1LTHR 2IZZA 5JCXA 3KHUA 1TT7A 1WZIA 2FRDA 3DBHA 3OH8A 2GZ1A 5FEUA 1DXYA 1K6XA 1MG5A 1DIBA 1NBOA 2NVUA 4R9SA 5G4LA 1KERA 1FJHA 4D0SA 3GG9A 1GZ4A 2RBEA 3AK4A 2CDBA 4YA6A 5G0SA 5U9CA 4MVJM 5IXSA 1JLLA 3HJAA 4TMFA 3PJGA 4FFMA 2GRAA 1MFZA 1OC4A 1E1LA 2VYND 4Y6RA 3IUSA 3F1KA 4RVFA 4YACA 2OMEA 1R4MB 3AUUA 5EMHA 1RYEA 3TN7A 1HDXA 3L07A 4J1QA 4XB1A 3WX0A 4Z9FA 3VDRA 3ETEA 3E5MA 4HFJA 2B5VA 4PCVA 1E92A 1UDAA 4FFOA 3T4EA 3DAPA 3TZ6A 5T5QA 4L73A 4CUKA 1LDMA 1PJ3A 5FI5A 5G0WA 1I10A 1CYDA 3HDJA 3QWHA 1ZMOA 5I9MA 3LZ6A 1DFIA 2ZATA 5CEEA 2PK3A 2IXBA 8LDHA 4CLRB 4R1SA 4YYZA 3QJ5A 1WNTA 1O94A 3OJLA 4OH1A 5BSEA 1FXSA 3I23A 5KVCA 4J4HA 4RF5A 1IE3A 1IHYA 1KEVA 1Y5RA 2Y1EA 4OXYA 2NV6A 5GZ6A 1T25A 3L6EA 2B0JA 4QFCA 1ZO8A 3ZWWA 5G2OA 2J8ZA 3AM3A 4BO2A 4E5KA 1HDOA 3ULKA 4PLGA 4BB5A 1GTMA 2FR1A 4MOWA 3OECA 4R54A 4AFNA 3I9LA 4UVDA 4BNMA 4W99A 1UAGA 3WWZA 2Y67A 3GNSA 3LQFA 1RM0A 4A5OA 1O6ZA 1A9ZA 2PZKA 4MVJE 3AI2A 1KC3A 4MVJA 4IQGA 5KJCA 1YL7A 4Y9DA 4B4UA 4YRAA 4OGWA 3B1FA 1MC4A 3ZHYA 1M6WA 4J1NA 2ZB7A 4KTVE 4KDFA 1MC5A 3DTTA 2HCTA 3DR3A 3LK7A 4Q39A 3WTBA 4AJ1A 4DQVA 2O3QA 4WGGA 2QQ5A 3F5SA 1DSSG 4NNJA 1DLJA 4A26A 1UP6A 2BF7A 1ONOA 1H0KA 1KIFA 1OI7A 4MJLA 1PQUA 3ETDA 4KUEA 4IS3A 4BVAA 2DLDA 3K92A 1I2ZA 3OF2A 2IEDA 2O7SA 5FF9A 2H6EA 3AU8A 5K0ZA 1HLDA 3PI7A 5JSFA 4E3ZA 3RUIA 1NXQA 3PGXA 4QECA 2YHUA 1P1IA 4ZQHA 1ADBA 3SX2A 4L4RA 4ZGWA 1VJ1A 3ICPA 4K26A 3U49A 1LLUA 3LU1A 4S3MA 2JL1A 4XQGA 4BNGA 3AOEA 4NDNE 2HDHA 4W6ZA 2AMFA 2Q46A 4R68A 3GVPA 4GL4A 1R12A 1YQDA 4TRRA 3DXFA 4E2ZA 1ZKMA 5BT9A 1PU2A 1HF3A 3WLFA 3TSCA 3P7MA 3P5SA 1IUKA 3GEDA 4YJHA 2P9GA 4NBRA 3WWYA 3AFMA 4BGVA 3I9OA 1LRKA 3C7DB 3GDOA 4NK4A 1Y8RA 4PGFA 4J4BA 2PTGA 1ENZA 3V2GA 4IZIA 4CMBA 2G0TA 4IJWA 4QO7A 3GR6A 4CPDA 4LN1A 4IJUA 3L6OO 3OM9A 3A28A 4UUNA 3WNVA 1T1RA 5AXDA 5DBFA 1BXGB 3I4CA 4IJVA 4HBGA 3RSHA 1LSUA 1LC0A 3OBBA 3IIEA 3EW7A 5A04A 3OIFA 4KMSA 3KBOA 3ONEA 2ZQYA 2I6TA 4BOYA 1T2DA 1I30A 3PHHA 3QVWA 4ILKA 4E2XA 1E5LA 3DWFA 3JD0A 3KB6A 3PTZA 4IS2A 1VSUA 3NT4A 4GWGA 1Q1NA 4J6FA 2D5CA 2ZTMA 3H8VA 2D0IA 3JD3A 2FSSA 3PHIA 1V8BA 3PZBA 5DBIA 3GGPA 3OEWA 3PWKA 3MCVA 4D45A 4ZQFA 3KYDA 4GLLA 2IE0A 5THQA 3ZU3A 3JD1A 3MZ0A 3KXDA 5K6AA 1U8FO 4RZIA 1YQXA 2X6TA 4XYBA 3KYCB 1U3UA 5F5NA 3WBBA 4ZICA 4BV8A 3QSGA 5B4UA 1V3UA 1PL7A 3FR7A 1NNUA 2WD7A 3QA9A 4BO5A 3TNLA 4BB6A 1HETA 1SOVA 3S8MA 1LDBA 3IJRA 3F4LA 1I33A 1NQ5A 3ZV6A 1PGQA 4F46A 4KOAA 4N54A 3I9KA 2O7QA 3UUWA 4CV0A 3VPHA 1NHWA 1K5HA 1ML3A 1WLYA 2O48X 2WMDA 2NVBA 1LSJA 4AG3A 2AG5A 1LQUA 2LDBA 4MVJH 2ZYGA 1O95A 1LI4A 4JX8A 4TWRA 1QORA 4WEQA 4R1UA 1K89A 1PR3A 4BKUA 4CL8A 3OIDA 4I8XA 4KUGA 2YYYA 4BKPA 4YT2A 2C5EA 1JWAB 1FDSA 3L9WA 4J3FA 1GCUA 2D5AA 4EJ6A 1KEUA 1K0UA 2E37A 3BTUA 4JXKA 3UFXA 4R69A 1G6KA 1BHSA 1CQJA 1I2BA 1N9GA 1NHGA 3ZNQA 4AJ4A 3JQGB 2HK7A 2C2YA 4E33A 4IINA 3RJ9A 1Y1PA 4P4NA 3U4CA 5CAEA 1U5AA 1H9BA 1Y9AA 3ROQA 2X4GA 4CLEA 1H6CA 4MINA 4NBVA 2AEMA 1YGYA 3DBHB 3ORFA 3U3XA 3GLQA 4Z3KA 4CQLA 3CMCO 2VZ9A 2NVUB 5TNXA 1I32A 2FN7A 5FYDA 3ZW8A 1ISMA 3GDFA 4QEDA 4WCFA 5JYDA 2X0JA 1T4DA 4E32A 2BFMA 4ROSA 1BW9A 4HFMA 4W7IA 2AQ8A 3PQEA 2CZCA 4LGVA 4G65A 2EKPA 1C1XB 5DDIP 1E3WA 1DOHA 3STHA 2O50A 1KETA 1M67A 4BNXA 3ZV3A 4WLFA 3KSZO 2Q1UA 3Q3CA 1YXMA 2W90A 1MX3A 2HMTA 4YT8A 2GN9A 1OZAA 1GFSA 1ZK4A 1GDHA 1DFHA 2D3TA 2NLOA 4XWYA 1IB6A 1PWXA 1NWCA 1YBVA 1D1SA 1YDEA 4XGIA 5KKAA 1RM5A 3WQQA 2PKQO 1D8AA 3DZIA 4IGEA 4I08A 4NU6A 5GMOA 4ND5A 4A03A 5ILOA 3D5TA 1D1TA 1GCOA 1LDEA 3LVFO 4KQWA 1AXEA 3F9IA 4DC1A 4U5QA 3ENNA 1WP4A 2Y1DA 3U09A 2PV7A 1E3JA 1SZJG 3C1AA 4RF4A 4WLOA 1HKUA 3JQBC 3NAQA 1GV1A 2X86A 3FNHA 2GCGA 4YCAA 3V1YA 9LDTA 4R5HA 5IJZA 2VNAA 1GD1O 1JKJA 5JMPA 4BO3A 1H6BA 1ZJYA 4E2WA 1H9AA 4UAGA 3W1VA 2V6BA 3NDRA 2PGDA 4R9RA 3IP1A 1N1EA 4IXWA 1UP7A 4J7UA 1GZ6A 1O9BA 3QVSA 1BTOA 4YQYA 3VVBA 4GVLA 1Y5MA 5JAMA 2O2YA 2BD0A 3DAGA 4I5EA 4O5OA 5THKA 3WMXA 1F8GA 1I24A 4YJGA 3NKLA 1QV7A 1RKXA 5KVSA 2RH8A 2X7HA 1XKQA 2I67A 3DHNA 1DPGA 3SLGA 1JKFA 3DB2A 2ET6A 2NUAA 1LLQA 5FFFA 4U8GA 2A4KA 4WCDA 2X23A 2VT3A 3UW3A 5IZ4A 4IDGA 4YWJA 1P3DA 2X8LA 4KWIA 4ZQGA 3SLKA 3RCBA 2R00A 3OETA 1ISFA 4AJPA 1DJQA 3WXBA 3PDJA 1M6HA 3FN4A 2V7PA 4GBJA 5H83A 3UAGA 4FSHA 4E2YA 2NU9A 3JYLA 2ZYDA 4Z0PA 5JAQA 4DUPA 1WW8A 1B8UA 1TXGA 1BVUA 4YVFA 4GGOA 4GMFA 3P2YA 3BMNA 4HX5A 3OSUA 3LLVA 2F00A 4M86A 3HQ4O 4RPKA 1EMDA 1XQ6A 1JW9B 1Y6JA 2WYUA 4HV4A 5IAAA 2D4AA 3AM4A 4IM7A 1WZEA 3BTOA 1YBMA 4E13A 3AY6A 5JMWA 1UDCA 1W8DA 3B20A 3ITDA 3GAZA 2UVDA 1HDZA 2VUTA 4N18A 1ONNA 2VNSA 3ZWNA 5C3MA 3BMOB 2NVWA 3UCFA 5CDTA 1DO8A 3R3JA 1Z73A 4MP3A 4RDHA 3ZWOA 4PLWA 5L45A 3WR5A 1XIVA 2E6UX 4UVHA 3V2UA 3DQPA 3I3OA 1QXSA 3UCXA 2PWZA 5K1SA 1Y8RB 1XHLA 2QIOA 1DIHA 4PVCA 3DMTC 4QUKA 1IYZA 4JN6B 5KIAA 3O03A 3ST7A 3DZFA 1KVSA 1AHIA 2UUOA 1ORRA 5JC1A 1YQGA 1ZBQA 1JN0A 3M1LA 2DUUA 2YDXA 3ZV4A 5I9LA 2EGHA 3RC9A 1MG0A 4E5NA 2CVQA 4DPKA 5AXCA 3EHEA 5IXYA 3PIIA 3AUAA 2BMAA 5KOIA 1ZUD1 3HUDA 3JQFC 3RWBA 3TL3A 2OXIA 4D3FA 1AGNA 3PHJA 7ADHA 1CETA 3N58A 4FD3A 4FJ0A 4O1MA 1E3EA 5A9SB 4OAQA 4TVBA 4BNHA 4IDAA 1XG5A 4BO4A 2IODA 1P1JA 1TT5A 3EZLA 3ZV5A 3A1NA 3VH4A 3GGOA 4TROA 1C0IA 3ZWMA 5COAA 3AY7A 5IDWA 1ID1A 3WYEA 4DPMA 3U0BA 4R01A 1SB9A 3DEYX 3Q11A 4ESOA 3HE3A 4RDIA 4RVDA 3HFGA 4U0KA 1ARZA 4L0QA 3RC1A 5IN5A 4B79A 5I7VA 1EUDA 5L40A 2V65A 4MVJF 2O3RA 3VPSA 1PSDA 3D0OA 4ZQBA 5EN4A 1GU7A 4CMJA 2HU2A 4OOFA 4NU5A 5A1TA 4LRTB 4ALNA 3AFNA 1S7CA 2VRCA 2Y1FA 3X2EA 1TI7A 1IY8A 1LDGA 5CDYA 1QYCA 2X1HA 2DTDA 1SEVA 1MB4A 4NJOA 2OP1A 2PH5A 2E49A 1W0CA 2ZCUA 3GFGA 1HT0A 4J16A 2AQKA 4PLVA 4OYRA 1YB5A 2DC1A 1PR9A 3EK2A 2AHRA 4GVXA 4R3NA 4W4TA 4B3HA 1AN9A 5CDUA 1XU7A 3PLNA 4ND2A 2HRZA 4YQZA 3JQ7B 4YJFA 3PFFA 1WMAA 5CG2A 3FD8A 1UAYA 5TX7A 3WQRA 3V1TC 1PJTA 3O8QA 4XEHA 1YWGO 3HADA 1JA9A 3NTRA 3LSYA 3QRWA 1AE1A 2NU6A 3ZZNA 5A9TA 2B4QA 4CM9A 4WLVA 3WTCA 5DN9A 1DIGA 2DPGA 4QTZA 2Y99A 3DDNA 2GASA 2BGMA 4OMUA 4AJKA 1H2BA 1FDWA 4DVJA 2FPIA 1EK5A 4CQLB 1U3TA 1M2WA 3NUGA 4RV9A 5EESA 1PJ4A 3PJFA 1NFRA 2BH9A 1BW9B 1XEAA 1F8FA 2ZB8A 3WOHA 4BGUA 3K96A 2PLAA 4WOJA 1YDWA 3IMFA 1E3WB 4NI5A 1DEHA 5DBGA 3IKTA 4K9DA 2NNLD 1K3TA 3C3XA 3FI9A 3H2SA 4NHEA 3RU7A 2DFDA 5HM8A 3E82A 3PWZA 2VZ0A 3OQ6A 2ZKLA 2C7VA 2NTVA 1P1HA 1VPDA 4CR6A 2TMDA 2EGGA 3PFWO 2J3IA 4IMPA 1E3SA 3W6ZA 4UUPA 4R4JA 3AI1A 3PRJA 2AQIA 1HE2A 3FR8A 4CM8A 2VRCD 4DQUA 3QHAA 2Q99A 5A3JA 2VRBA 4OXKA 4PZDA 2HMVA 4FC6A 3KZVA 5BQFA 1V0JA 4LMPA 1T26A 3TZQA 3KSUA 4ZN6A 3GUCA 1JDJA 4EZBA 4RJTA 2QW8A 4Z6KA 1W6UA 3K8ZA 4ALJA 1MLDA 4FFNA 4RVHA 1VE9A 2HMWA 1ADGA 1JVBA 1P77A 4J9UE 4EUEA 1U28A 3WFIA 1Q7CA 4BNVA 4M1QA 1EVYA 2I3GA 5JE8A 2NQTA 3ZI0A 4DLBA 2W98A 4IDCA 1K6IA 1QYDA 1PQPA 3GHHA 2FY8A 4JK3A 1E1MA 1LRLA 4NIMA 2VYNA 4YJGB 4PLZA 2VZ8A 3Q6IA 4IY1A 4UEKA 5G4KA 4CM9D 5J23A 1E6UA 1LA2A 1Y9EA 3VDQA 5BNTA 1I2CA 2Q2VA 4PZEA 3CXRA 4BL5A 1ZW1A 3WGOA 3L0DA 2OFPA 2Y0DA 2J3JA 3E9MA 2ILTA 2WD8A 3CSDA 4Q3CA 4FGSA 2JHFA 4OL9A 1GY8A 2P4HX 2DQ4A 1BXKA 1I36A 2X5JO 3OJEA 4AJ2A 1NFFA 2OORA 3NYWA 1VC2A 1UZMA 4ALIA 1XLTA 3ZW9A 5I7SA 5L4LA 1PJLA 4RVGA 1DC3A 3AWDA 2W2KB 3I52A 4D43A 1I01A 3QWFA 2FZWA 2YDYA 3DC2A 1VLLA 2JKVA 3DO5A 1EVZA 3EGOA 4NG5A 4P8RA 4AJJA 2NACA 1UP4A 4XYGA 2D8AA 3HWRA 3GDGA 4RCVA 2Q2QA 5JAZA 2GPTA 1X0VA 2VCYA 5LDGA 4DPLA 1UXJA 1XA0A 4JNKA 1UDBA 3HN2A 3GVIA 3GPIA 1X7DA 1UH5A 3ZWYA 3WLEA 4A7PA 1ZNQO 4W7HA 4M89A 4FIZA 5IN4A 3D4PA 1VI2A 3LF1A 4DYVA 2DBVO 4DMMA 1ZVMA 3DZBA 2C82A 1Z7EA 3AY3A 4M87A 4YXFA 2YY7A 3ZHBA 5TQVA 5K9ZA 1SB8A 1NX6A 2AW5A 2JD0A 1R4NA 3CMMA 4RZHA 1ZXBA 5ILGA 3T7EA 1VL6A 3H2ZA 4O59O 5G0UA 1GAEO 3D4OA 3RUAA 2JJYA 3R3SA 4MP8A 6LDHA 1VM6A 1WDMA 3E6AA 3MOGA 2AA3A 2GZ3A 3IC5A 5U4QA 1A71A 3QV1A 4IQ8A 3HZZA 5CEFA 4GX0A 4RORA 4CQMB 2XOXA 4FB5A 3H6KA 3ANMA 4D46A 1VSVA 3G0OA 3W4KA 5CPFA 3TZCA 2CVOA 4CMAA 3FHLA 4QQRA 2SCUA 4E31A 1TEHA 4U7WA 1PJBA 3DFUA 2CDAA 4B7CA 1NPDA 3AU9A 1L1FA 1W4ZA 1JWBB 2GN4A 2YHIA 5CFZA 5JY1A 1LNQA 1TT5B 1U4SA 1PJCA 3K5PA 1XR3A 1OOEA 2H63A 1B14A 1NVMB 2TMGA 1QYXA 3M2PA 2FP4A 2FZEA 1T2CA 2HAEA 5JPIA 1B8VA 1GUYA 1PS9A 3F4BA 3GMDA 1E0DA 3TF5A 3JQBA 3KM0A 3QVTA 2GGSA 3PHGA 3TL2A 5ADHA 4DA9A 3DBRA 1JTVA 1HLPA 3VZRA 4CV1A 2C20A 1DRVA 2JCYA 2WM3A 3BZUA 3DBVO 4MVJI 2A35A 3H7AA 5DF1A 4CMIA 3R6DA 1H94A 3UKOA 3S2FA 4DIFA 2POQX 4R41A 4AL4A 2CY0A 3HDYA 4DBVO 4N5NA 1LXCA 5CG1A 3LC2O 2XF8A 1FMCA 5ER9A 1A7KA 5ITVA 2F1KA 3BAZA 1GYRA 2R6JA 2QYSA 2BGLA 4YJFB 3UICA 3OQBA 4I9NA 4NZ9A 1GZ3A 3EC7A 4QO8A 5L3ZA 3U9LA 5EQFA 1PIWA 1YONA 3KO8A 5U1PA 1ZSNA 1C0LA 4J1SA 4TZKA 5BR7A 4DC0A 2ZIZA 5I9NA 3GY0A 1BGVA 3K73O 3KTDA 4GGPA 3RC2A 1V3VA 4XA8A 3E9QA 1VL0A 1CRWG 2JFHA 2DUWA 4XIYA 3DZHA 4BNNA 1HXHA 3A9WA 3C1TA 3PIDA 1A5ZA 1V35A 1KY5A 3TZHA 4NH4A 2HSDA 4B7XA 1R15A 1NR7A 3WNQA 1FDVA 1EBFA 4RVSA 3UGKA 1ISJA 2O3JA 2P4QA 2JD2A 4IDDA 3QLJA 4J49A 3GPDG 3F1LA 5ICMA 4YJDA 3KYBA 3JQAB 1C1DB 1AUPA 4EGFA 1YBAA 2VWQA 3LC7O 1DC4A 2VHYA 4JGBA 3SVTA 2YZ7A 2DBQA 3GOHA 4F45A 5GY7A 1ZK3A 1ZK2A 3CTMA 3PPIA 1CF2O 2FOIA 5KJ6A 1NVTA 9LDBA 1C0KA 4WKGA 3Q2KA 2RHCA 4H3VA 4XJTA 1Z6ZA 2I76A 1UJMA 4I9HA 3VOSA 1Y8QA 5DP1A 4CLXA 2WJPA 5FI3A 2WYWA 1T1SA 2EHDA 4AJNA 4ZU3A 4DMLA 2O3SA 3BMQB 4QFDA 4R5MA 3ZNOA 4M54A 3BTSA 4KTTE 2EJWA 3VC7A 3VKUA 1ZK1A 1NM5A 2AQHA 1S6YA 3F3SA 3GVCA 2X0RA 1DRWA 3GVXA 3JCZA 4DLAA 1M75A 3ROKA 3JQFA 5JDIC 2HK8A 2FSVA 1F17A 2PKQP 3O9ZA 5EIOA 1IZ0A 1U3VA 2Q45A 2NTNA 1RPNA 3O26A 4B4OA 1RM3A 2J3KA 1B0AA 1U3WA 4GH5A 4ND1A 1ULUA 5DULA 4W9NC 3E1KA 4Q3EA 3PVZA 4XYMA 4Z0HO 1UXHA 3SC4A 4BS9A 1D7OA 1ZJZA 4RPHA 4YB8A 2A9FA 1N5DA 5AXBA 3MTJA 5AYVA 5B4VA 2GYYA 1OMOA 1SOWA 4BNKA 1VKNA 1ISGA 4CM7A 1H2HA 4FFLA 2VUSA 5KJFA 4HADA 1YVEI 2FMUA 4DXHA 2EF1A 3EAGA 3Q0EA 5B37A 3WYBA 1TLTA 2D59A 3NV9A 3I83A 5DOVA 1ZEJA 3GA0A 4OXNA 2ZQZA 4EUHA 1RM4A 4E12A 1NQTA 3K6JA 4XX0A 2Q1TA 2X0IA 2WSBA 2YV1A 1O89A 4I9UA 2NSDA 3GEGA 5A3VA 1L7EA 5IZCC 2ZYAA 4H15A 4XIJA 3PYXA 3C7AA 3SJUA 1X15A 3U5TA 5L51A 4DTIA 5TF4A 4LK3A 1GEEA 2PKRA 3H9JA 3K30A 1ZSYA 2Z1MA 1KVQA 4Y6SA 1JVSA 2P68A 3DZJA 4GX1A 1F14A 3AOGA 5KCZA 4CJXA 4PRLA 3V5NA 4HFRA 3FWNA 4KP7A 1VRWA 5L95A 4WJZA 4BMNA 3HG7A 3MJSA 3M1AA 5TC4A 4WOKA 4RGBA 3JYQA 4N5LA 3DFZA 2AE1A 2E82A 3RQSA 3F6YA 4JBIA 4MKRA 2EEZA 4H7PA 3HN7A 5EERA 5HWSA 4ZVVA 3TDKA 2X9VA 1NTOA 1J49A 4FPXA 4ITUA 1OC2A 3U4DA 4P38A 2JAHA 1CJCA 4BGIA 4WEOA 4IDFA 5EL0A 4YR9A 3KEQA 4CR7A 3MWEB 1A72A 4CLHA 4MIOA 3EUWA 1RJWA 2WE8A 4PFJA 4Z3DA 4BMSA 4CMEC 3KSDO 1TA4A 1YOVA 2YHIB 2HKIA 1PZGA 3UHAA 4A10A 4CLDA 2HQ1A 5ER6A 2GF2A 4XGKA 2JHGA 3BHJA 3UH1A 4BNJA 4CM5A 2P9CA 4OIMA 4IZHA 3JQ6A 2EKLA 3D3EA 4IDBA 2PZMA 2VQ3A 4K6CA 4DL9A 1QYVA 3IP3A 5AQ1A 2O4UX 4E0BA 2GLXA 3L4SO 4GSLA 4IJKA 1YS4A 1E1KA 3GAFA 3GZNA 2C07A 3BA1A 3PQDA 4LVUA 3QWBA 3FRJA 3RUHA 4AVYA 3DBLA 1C14A 1LRJA 5BSGA 2X58A 2C5AA 3TZKA 5DT9A 3CINA 1LC3A 1E5QA 4TKLA 2BKAA 4BNYA 3MJ4A 2HMSA 2NADA 2PY6A 5I8WA 2OUIA 2DFVA 3JSAA 5JC8A 4NPCA 5JBIA 1BDMA 2VWGA 2I66A 3MWDB 3DOOA 2BRUA 3PDUA 2EP7A 1ZK0A 3M2TA 1VL8A 1V6AA 5TIIA 1LSSA 1ZZEA 3PXXA 4FCCA 4UVEA 2R2GA 3LDHA 2UUPA 2V6GA 1E77A 1R6DA 3MJEA 3ZWPA 4WLUA 2PZLA 1GL3A 5A4DA 3MJTA 1HL3A 4L75A 3IJPA 2VWHA 2YJZA 2GERA 3PJDA 3PWSA 3RUEA 1Z82A 5AOVA 4PG6A 5L4NA 3V8BA 3ZGYA 1KVTA 3EVTA 2I99A 4ZQEA 1BG6A 1Q0HA 3NJ4A 3HNPA 3H4VA 3D7LA 1GQ2A 5CDGA 2XAAA 1HE5A 2XPCA 3QIVA 2FPGA 4BQPA 4OQZA 1F0YA 2CUKA 4P4LA 3BIOA 1IULA 1HZZA 3U4HA 3GK3A 4Z0TA 4O6VA 4J43A 3FNGA 4J7XA 1ZCJA 4L74A 1LJ8A 4BQRA 1T2AA 3F47A 5F5LA 1Z74A 1GQQA 3G49A 2NQ8A 2H1SA 3DZKA 4CUJA 4QXMA 5I7FA 2Y1CA 3ADOA 4YJHB 1NQAO 5IFLA 4FJ1A 1EE2A 4CV3A 1NVGA 1DIAA 3DOCA 1QV6A 3AW9A 2RHRA 5CHEA 1U1IA 4R1NA 4FFRA 1EVJA 1GADO 2P2SA 4FS3A 3VAZA 1NR1A 1HDCA 1B7GO 4I5GA 1ENOA 3L9XA 2OBYA 4BNWA 3BHIA 1P9LA 3QWAA 3JQ8A 3VZSA 1Y8QB 1QLHA 3BMCA 4JP2A 2BFAA 4EUFA 4IDEA 2B69A 1BRMA 5A06A 3S1LA 1I5RA 2OGUA 2DPHA 3FWZA 1A27A 3GNTA 3W8FA 3CH6A 3GUYA 4JBGA 5KJEA 4MKZA 3G17A 4OSPA 3GH3A 1W73A 3DTYA 3ANNA 3RASA 5I7EA 3ROPA 1G1AA 4H16A 1A4UA 1XCBA 1P74A 5F1OA 5F3RA 4CLOA 1EZ4A 4EBFA 3PYMA 3H5RA 4Y8VA 3VH3A 5G0VA 3I9MA 1DB3A 2O2SA 1U7HA 4FJ2A 1R4MA 4IGFA 4LW8A 2IEBA 4MPDA 5L7TA 4U0JA 3KYDB 5EQDA 4DREA 2FHSA 2QZ9A 2EERA 5L53A 2W2LA 3LT4A 4XYEA 1BSVA 3ASVA 5C7OO 4ZD6A 2AEFA 3U4IA 2WD7B 4L76A 4GAEA 4FDAA 2CDCA 1YL5A 2YFQA 4NK5A 2VHWA 4CLRA 4TRNA 2HUNA 2I3AA 5HS6A 3QVOA 2DBRA 2Y0CA 4D42A 4DRYA 1U9JA 4HNGA 3HSKA 3HHPA 1ZSVA 3ZCXA 3JQCA 1DJNA 4UUOA 3V2HA 3V1UA 2IZ0A 4UEOA 4CM1A 1E7SA 1LLDA 2VYVD 1E7QA 1PGJA 1MXFA 2Y1OA 4L8VA 3VZQA 2UDPA 5H81A 4OJNA 2VOJA 1KYQA 1U7TA 4BO6A 2CNBA 1J0XO 2GD1O 3NEPX 2IXAA 4WECA 4AJOA 3IOYA 3JD4A 5KKCA 1RWBA 2D2IA 3NT5A 2QRLA 1DAOA 1N9GB 4II2A 1EEHA 4BO7A 1E6WA 4CM6A 3HFSA 1FDTA 4XDYA 4WLNA 4XRGA 3C85A 2YUTA 3AM5A 4DIOA 5LCXA 3HB4X 1WXDA 4HXYA 4WNIA 3DZGA 4JROA 1H93A 3ZN2A 1CIVA 4CM4A 4PN3A 3RBVA 3NRCA 4U6SA 2O23A 4WCFB 2PZJA 1KY4A 4YAGA 2P5YA 4J0FA 3H9UA 4J0EA 5T6BA 5L4SA 2C7GA 2FWMX 3M6IA 5KNLA 1TB4A 3L6DA 4BO9A 4YT5A 3RKRA 2OOSA 3GHYA 5IDYA 1AHHA 1C3VA 3TOZA 4PG7A 4MVJG 2W2LD 4IUYA 3WB9A 3FNEA 1I3LA 2ZJ0A 4RPGA 5JCJA 1DDOA 5JXWA 3KUXA 1IL0A 2VTDA 3O38A 4Y98A 2H5LA 3E9NA 5MGBA 2RCYA 3RFVA 4I1IA 2RAFA 4YAKA 4EDFA 1KBZA 2O3TA 4BNLA 2I65A 4GI2A 3PZRA 1BDBA 4BNFA 2PD6A 4D79A 3B6ZA 2BFPA 2PH3A 4F6LA 2JFGA 4BNIA 3KETA 4BHTA 2B5WA 4GLOA 4LMRA 3QY9A 3WIDA 4E4YA 1ZH8A 4IIVA 3DL2A 3SC6A 1X7HA 3WGGA 3RBZA 4D0RA 1P1RA 3WG9A 5BNIA 4YDRA 2UV8A 3GG2A 1PGOA 3IKVA 5JO9A 5GZ1A 4JQCA 1BXGA 5CDSA 1ONPA 5KTKA 1T2EA 4BKOA 4O0LA 5JDIA 3R0IA 3FNFA 1YL6A 1D4FA 1PS0A 5IDXA 3FPLA 2AG8A 3CEAA 2X9GA 4FGWA 4XB2A 1FK8A 5JFOA 3I4FA 1N7HA 3ENKA 5A5EA 5JW6A 4W9NA 4EEXA 4RQUA 4L9RA 3ITKA 1EQUA 3VPXA 3BMNB 1YJ8A 2Z5LA 3H9GA 1E7YA 1QYWA 4D7AA 4WK6A 1NAHA 4ZHSA 1P1FA 1E7RA 4PZCA 3KYCA 5KJ1A 5CPBA 1T4BA 1O5IA 3FTNA 4ONEA 1LQTA 3H5AA 1XSEA 4GWKA 5JCJD 1YB4A 2YV2A 4BIIA 2GNAA 5B4TA 1B2LA 4IQ0A 3KVOA 3W8EA 1GV0A 2QRKA 4ND4A 3D64A 3DHYA 1WDLA 3R1IA 4KQXA 3VH2A 1OBFO 4B4VA 5TJ9A 2B35A 3LC1O 2P5UA 7MDHA 3G1UA 3A4VA 4NMHA 4LCEA 1P0FA 3IQDB 5IZCA 5G0TA 4G5HA 1ZEMA 3WJAA 2UAGA 4MKXA 5F1PA 3MTGA 3IDSA 2HLPA 1QRRA 2NTJA 2BELA 3Q9UA 4P22A 3RFTA 1ISIA 3U62A 3JV7A 3WSVA 2WE7A 1TVEA 2BI7A 3K2EA 2Y68A 3Q2IA 2VN8A 2D1YA 4INAA 4BV9A 4AJHA 5JLAA 3OA2A 3L77A 3JQ8B 3NTOA 4ZRMA 1HYGA 1LDNA 1UXKA 3GC6A 1GPJA 3BMCB 4Q9NA 4J1TA 3F46A 1GEGA 4NBWA 1LBEA 1YKFA 1R66A 3VTZA 1VKOA 2DT5A 3RROA 5LC1A 3VTFA 4BO0A 1JAYA 8ADHA 1ADFA 3GQVA 4XR9A 5IDQA 4PIVA 3WIEA 3WGHA 5CEJA 3SEFA 3TPCA 4IIUA 2QHXA 1LU9A 1XELA 2QZZA 4WUVA 4CLOB 5JO0A 2X5OA 2DVMA 2IYOA 2I9PA 5DZSA 1XQ1A 1MV8A 2BLLA 2B83A 1E3LA 2IYPA 3CIFA 1C1XA 4F6CA 3K31A 4GMGA 2CSUA 4XGNA 4RF2A 4WASA 4LISA 1HEUA 4HFNA 4CMEA 4NBUA 1N7GA 2DKNA 3A14A 1VJ0A 3NTQA 3DONA 4J91A 4Z9XA 2C0CA 4EYEA 3RKUA 4URFA 3VHRA 5KWEA 4UUMA 4N5MA 4BNUA 4YEDA 4IBOA 2O3UA 4ZRNA 4P4GA 4TSKA 1J5PA 2VTEA 3AI3A 2H9IA 2YQ5A 3JQDA 3INRA 2G82A 3MJCA 1GQYA 1I3MA 1X14A 2HJRA 2JCVA 5HBRA 3UVEA 4GQAA 3WDSA 4Y67A 2GN6A 1LLCA 1Y7TA 1LSOA 4QSMA 4RPJA 2CVZA 1Y81A 3AJRA 3FPCA 3RUFA 3CUKA 4NFHA 5GZ3A 1PZFA 1QKIA 2IDZA 5T64A 1UZNA 1JKIA 4OSOA 5DP2A 5FWNA 2VUUA 2B4TO 2GZ2A 3OEYA 4YAJA 3WJ7A 1EVIA 1N1GA 1O0SA 3GMSA 3O8QB 3PHLA 3WGYA 1PL6A 3WGQA 5A05A 4F3YA 1KS9A 3VPGA 4II3A 1ZIDA 1R0KA 3K9QO 3D4NA 3NGXA 3LT2A 4OOEA 4HKTA 2A92A 3C7CB 2NM0A 5LDHA 5IG2A 5ENDA 4E5PA 3GFBA 3RAJA 4CM4B 1EUCA 5TT1A 4ND3A 2HMUA 2G1UA 4XCVA 4E5YA 2Y1GA 5T67A 2C29D 2GO1A 3L4BC 3WFJA 2P91A 2QYTA 4C7KA 1T2FA 3F5QA 5ICSA 3E48A 3ZU5A 3LT1A 4KWHA 2B36A 4E6PA 4FBGA 3FBGA 4RLSA 1E6EA 1QG6A 2O4CA 3GGGA 3JQ9C 3ONFA 5JDCC 3S2GA 1HYEA 1I0ZA 3G1TA 5ENVA 4JBHA 3BYZA 2QX7A 2ZTUA 3RI3A 4CODB 4YRBA 3GNQA 1IOLA
chains in the Genus database with same CATH superfamily
3LUHA 1R37A 2YJGA 4UDOA 3F73A 1C8KA 2AD5A 1RI4A 3FYCA 2P9QA 3OBIA 3PQ8A 3QOYA 4AJEA 2O5CA 2I55A 1B1AA 2OT3B 3U3JA 3PL5A 4LNUA 4FZJA 4KN8A 4WA8A 2JGDA 4W9MC 4BDSA 3DLBA 2ZUBA 4FKMA 3CEPB 2FW1A 4I1UA 1NMEA 1QJCA 2VHVA 1J9GA 1G21E 4PAGA 4Q9AA 1JFRA 1EESA 4TTQA 4AAYA 1QAOA 1JXQA 2E85A 5C8DA 2XXAB 4LE2A 2AJDA 4NZYA 4UBIA 3RAFC 2J5RA 3FX2A 5KTSA 2AUTA 1CZHA 1VHTA 3AZQA 2WHXA 3DYIA 2W6JD 4FSXA 4MUJA 5A9RA 1P33A 4JI2B 1W9MA 3EMBA 4LOKA 3L8YA 3QFTA 1ZYUA 4E5MA 2GSDA 2QVCA 4X54A 4GUAA 1R8XA 4M8SA 4XIFA 4QX6A 4IILA 4C4YA 2HRBA 4GHWA 3A2MA 1TQDA 4TTVA 5H82A 2QMQA 3RHSA 2VDPB 1DFGA 1RWQA 5BPHA 4ZZ3A 1T1JA 4P08A 2JFUA 3IPRA 4D3YA 5HUQA 3ZLVA 2Y93A 3OHSX 4QFMA 3DHEA 1NVUQ 3ZBUA 1JTEA 5G4KB 4B35A 1SCUA 1Y5IA 5JZ9A 2VSFA 2OGSA 3MB8A 3QX8A 1H2EA 4K9QA 5TSDA 5JI3E 4HRAA 2R1VA 4AY4A 3AVTA 4OYHA 1CWUA 3CH4B 2NNWB 5M3BA 4F7DA 5BOSB 1V4NA 1DIRA 4GDMA 5KNDD 1X1TA 1XAGA 2NSYA 1I9CA 4KXXA 3WZMA 1SIOA 3PNSA 4IFEA 2OCLA 5KBYA 1SXJC 2JFZA 2VCEA 4QD3A 3NHFA 4D3XA 4QZVA 5FLKA 5CM2Z 4EJMA 4M1EA 1T9HA 3H2JA 3AHEA 3H5VA 4L4XA 4HXEB 4B6GA 1XJQA 1M76A 1Q2XA 3EAQA 4OHBA 2B4RO 5HRUA 3BXOA 1MNAA 2UZ4A 5AJZA 2OZVA 5KC9A 1FE8A 1YE3A 4CR8A 3I6MA 1HE3A 4PLYA 4UOQA 4DGSA 3FDFA 2H5EA 3N6VA 1P17A 3U3KA 4EYSA 3AQIA 3AGPA 3PD0A 1P29A 2GHIA 1ECFA 5DCWA 4K87A 3M6LA 1VPVA 3I9JA 2VP6A 1PGNA 2ODQA 3P2OA 5AHWA 3TCKA 2PMFA 3EMKA 3ZPXA 1IHXA 3I9V1 1DE0A 2ZRJA 3B3FA 4JB2A 1STOA 1VJTA 2QLLA 1Y8CA 3AUTA 4F21A 1BMQA 2A14A 1REQB 1SXIA 2G36A 1EDZA 2OBNA 3WKAA 2W4MA 4EF5A 1KVUA 1RYHA 2ZDHA 2OGWA 1R0ZA 4PTZA 4WI1A 1RCFA 1DKPA 2KBEA 2I8LA 2JHPA 4W1RA 4GPD1 4TWBA 2VA9A 2WAMA 2J4DA 5F51A 3AW8A 3DMPA 3RNOA 1UUFA 5HCIA 1UMCA 3U7JA 2BJHA 4ZANA 2C92A 1EYZA 1XXHA 2NO9A 4X1YA 2GJ8A 2OZEA 3BF7A 5CLQA 4A82A 1FLDA 1VCHA 3G9TA 2ZJ2A 5FA5A 5L7YA 4BFCA 2EBFX 3WGMA 5KNBA 1ABFA 1W19A 2P9ZA 1YH3A 3QJGA 2I6GA 5A71A 4ESEA 3K6SA 4ALMA 1F2DA 3E4CA 3N2EA 3ZQKA 4TWAA 1UXGA 2CF6A 2FB9A 3WIOA 1MJFA 2OENG 3FSRA 3O7MA 2CLFB 3QV2A 2A59A 2NU7A 1U7WA 3EB9A 3MUFA 1PZMA 3NCHA 5DX0A 4EFMA 4PIPA 2FJUA 4QHTA 3ZDRA 2X1VA 1BAPA 5EXXA 3WLKX 1MPXA 1ZPDA 1R6TA 1V3TA 1G3RA 1JEQB 2J6IA 1FP2A 2AI3A 1NF3A 1YUBA 2AXNA 1XVIA 2QRJA 4IV5A 1EEXB 3FGNA 1DVRA 1SVKA 3F9RA 1RW4A 4FYIA 4MWBA 5CW2A 2ERCA 1U8ZA 1ZD2P 1P1BA 3ONWA 4WBNA 5EIBC 2YBDA 1KBOA 2SCUB 3EGWA 3PF9A 3GJ8A 1VE7A 1XYGA 5EC8A 4E4TA 1GTRA 3DAFA 3OMLA 2NZUG 4ZYZA 4KV7A 4UPVA 2WPDA 5FI1B 4YMHA 4DV7B 2XUOA 2FEKA 3H65A 1G42A 3F78A 3FNIA 1VHWA 2M9MA 4N41A 4DR7B 4F3TA 3DKIA 1XMXA 2IUTA 3I12A 2BUAA 5JG7A 2VJAA 3ZUPA 3DSRA 3W8DA 4TMYA 1NURA 3EH1A 3TBHA 2PRJA 4CUZA 5KPJA 4NARA 4EPRA 4XR4A 2RG1A 3ES9A 3VTKA 4ZOCA 4Z9AA 2E5LB 5KX5B 1JQEA 4A27A 1SUPA 2O2IA 1E5TA 1XWWA 4H77A 5FWDA 3DBRB 1A8QA 4FIDA 3TW0A 5CFLA 5CT5A 3V1KA 5FWAA 3EOBI 4F86A 2WT9A 3IEIA 2G76A 4EG8A 2BLNA 3RAEC 4RE6A 1N8SA 5IVKA 4JLWA 1MOQA 5GIPE 1PJ2A 4B45A 3E5RA 3EG9B 1CEQA 4PG4A 1CUUA 2QTAA 3K2BA 5LWHA 3EY4A 4FP9A 3SCZA 1RI2A 2IHUA 5TEWA 2ZRQA 3OQNA 1OPRA 3EEIA 3MC1A 4EZIA 1A8IA 4IEEA 1UWKA 1RADA 1QJ4A 3SQDA 3KT3A 3TQSA 1O6BA 1TMKA 2PIDA 2HBYA 1X3SA 3A1EA 3L7CA 2ENUA 2OCPA 3HBFA 4I55B 4LOLA 4PNHA 4RABA 4RWEA 1GLVA 3X2SA 1DLIA 3C6BA 2EX0A 4RY8A 1NBIA 2A33A 3CCFA 1J23A 3LY8A 2ZB3A 5AKHA 4ZU1X 4DDHA 2PU5A 5HF9A 4RD0A 4NCNA 3F5MA 1ZOIA 1Y6GA 4B3CA 1MA0A 2VA8A 4JP3A 4DA7A 1PDWA 5BYJA 3SLRA 4FW9A 4BBPA 1OF1A 2YFHA 1G4AE 3QFRA 5EINA 4RENA 2BL4A 1EXWA 1I80A 3C3YA 1RAIA 4Y2VA 2C4UA 1W5TA 2VO1A 2ZAIA 2E87A 3CSUA 3Q7EA 5DASA 3AZOA 2PE5A 2V7QD 1IJEA 1DHRA 1CRLA 1MRZA 1NP7A 2C2XA 4QU0A 1KYIA 4TSFA 3BWBA 4FR2A 4YX9A 3TOCA 3CPSA 3F5DA 5JAPA 2Q0SA 1H4QA 4GOND 4OQYA 3E2IA 3RSZA 1WA5A 3A3YA 3KKLA 4XM2A 3LCJA 4DIMA 3Q8MA 3ZU4A 4YRFA 3ZZUA 3ZWCA 1FNSA 2BGNA 2JFYA 2W2KA 1H22A 2B82A 2ST1A 5IC4A 2H9AA 4HYTA 3AEQB 1FL9A 4ZA2A 3R8FA 4F12A 2YX1A 3NFYA 4YBZA 1NYTA 1TM2A 2VYVA 1P0PA 3F90A 3OOSA 4I5DA 3E03A 5FA8A 1ZM2A 3D43A 3IQXA 4J2HA 4ZVUA 2ZS8A 3AIOA 4EJFA 3O95A 2VYCA 4QXAA 1CUFA 3TAHA 1LW6E 3H4TA 1BN6A 4MMYB 4NJEB 4UAUA 1QRUA 3H04A 1CLEA 3KD3A 4ENVA 3ZLBA 2OHFA 3A1FA 3VNAA 5IULC 4BO1A 2Z5FA 4PS0A 4BNTA 1E5XA 2VG8A 3OQJA 5IVDA 3ZKWA 4DLXA 5EHZA 1THGA 1E98A 2IITA 2NXNA 3N2NA 5BWOA 2N9UA 3OO0A 3G2JA 3LQ4A 3S29A 2ZYSA 3OIGA 3SSNA 4OM8A 3T7SA 3ENWA 3HJFA 1T5SA 4EMBA 1RVV1 1MJ5A 1PD1A 4W1QA 3LLSA 3TSWA 1PVDA 2QUIA 2XQIA 3A9SA 3L5KA 1XFDA 4UXIA 2H2GA 4JAVC 1Y7LA 1CFZA 2VQFB 1FDUA 1RC1A 4QTTB 4HN2A 3K9CA 4ABYA 1WHTB 3GP8A 5TJHA 2IEYA 1SA0A 2QD3A 3WRYC 1UOOA 1GGHA 1SPXA 3CG0A 3PQFA 3VPFA 5F33A 1MA3A 1T0PA 3FDZB 5KVVA 5KX5F 1C7QA 2FWIA 2YN2A 3P5BA 1HSOA 4BAUA 1AMUA 5BSRA 1QQAA 3DXYA 1EIWA 2PMBA 1DQRA 4PX9A 3RBXA 4OHOA 4C6TB 3B9RA 4YDQA 5BSVA 5IXJA 1RLOA 3EXHC 2DCUA 2WF9A 2GPAA 3AUSA 3DM5A 3JZFA 3THSA 4F5ZA 5IU6A 4MKIA 3KOXA 5I7AA 2JFWA 3MTBA 1M0EA 3MSCA 3D2LA 3BIFA 1WVIA 1W36D 3CYFA 1YZFA 2P0YA 2GN0A 1GYPA 1C0PA 4MUEA 1JKMA 1MQ9A 2OXRA 1WDWB 5CK4A 3WBFA 2GDZA 5ARBA 5IMSA 4HQKA 3C98A 1YZ3A 4B31A 4F60A 3FFXA 3K0HA 3SHVA 3CFYA 3I2FA 1ZMBA 3ORHA 1MUUA 4ALKA 3HB9A 4EVRA 1ZA2A 3S2IA 2Y3IA 3SU8A 1ML4A 3R20A 1RQXA 4I55F 5TXGA 1ZD5A 3IAFA 3UQZA 4G2TA 4CT0A 3SQWA 4AP5A 1U0JA 2BZ0A 4MIEA 2FETA 4I5IA 1L6IA 2PRZA 4IYJA 5JZBA 5IJXA 1AZWA 4JJ7A 4XQ9A 3Q85A 3RS0A 1IBLB 4QYWA 1PQYA 3FG9A 1AZSC 4BVLA 1TZBA 4FONA 4TL8A 1MOZA 5C8YF 4X62B 2RGRA 1USKA 1HDRA 2RIRA 4ND8A 2H1VA 2GKGA 1E63A 2VDMB 2FPPA 1JDVA 5CXUA 4HLCA 3GYBA 3EAFA 1JG6A 5BN3B 2O6LA 4A92A 4DMRA 2PJUA 1HSZA 1NUSA 1EGAA 2Y27A 1Y3FE 5E2AA 1ZNZA 3TQCA 4BVHA 5MGNA 2WWTA 4ESVA 2YW2A 3G0CA 4INJA 3KKKA 1J39A 3AR6A 2RGEA 1SBYA 2ZK7A 4IOJA 4ZOBA 3T7CA 3T1HB 3AJDA 4GQBA 1QPGA 5HNKA 2BKVA 4R1QA 3VPCA 2IZ1A 4LE0A 1NI4A 2O52A 4RD3A 4TT3D 4UREA 3DXZA 1X80B 1CZOA 1F60A 2AOTB 3ED5A 4AU1A 2WIBA 4ER0A 4IJMA 3OJFA 4Z9YA 3ER8A 2WP0A 4E2FA 4L4SA 3U1BA 4BGEA 1E0SA 1SVLA 3IV9A 3GA5A 1YCFA 1HT3A 2R96A 4JI7B 2X22A 1Q7EA 3DLCA 1GAXA 4KBFA 1CZUA 5EIHA 4Q01A 1HNWB 4RD4A 5JS8A 4CIVA 4B17A 2ZYIA 2YW9A 3TVYA 1ZXXA 4BMXA 2HYIC 3U6BA 4KGDA 1QHIA 3QMPA 4PG8A 2AG0A 4TLEA 5DSTA 9GPBA 5LOVA 2AZ4A 2ZAMA 2JI4A 2PS3A 4Q1DA 3OZXA 4LDZA 1NONA 3VYUB 2I4RA 3ETGA 3Q3EA 5COBA 3TQTA 2PXAA 2YH2A 4OAOA 1VYUA 2B8NA 1DJPA 5D85A 4BX3A 1IPEA 1R8SA 2AYXA 4YJ3A 4U7DA 2O57A 3CZMA 3PR1A 3EA5A 1JYSA 2VOEA 3KQPA 4EO4A 2Y76A 2WJYA 4HQ6A 4NQZA 4TX1A 2HEGA 2J7PA 2VH5R 3IGFA 1CUVA 3M4ZA 3MINA 3I4LA 5LQUA 3UV6A 1XZEA 4TV9A 1EFVB 2HO5A 1WM1A 3GA7A 2QGFA 1XZAA 4HR7A 1XTIA 4EK9A 1RKVA 1NXSA 2EZ8A 5HE8A 1I6MA 1KAQA 3JQEA 2BR5A 4A1FA 4IJQA 1IZ8A 1PEYA 3E8XA 4JBXA 3RUCA 3WE7A 3KAJA 1VB5A 4UTXA 5AJWA 3W2TA 4WK0B 4DM3A 2ZBRA 2VT7A 5CXQA 2BCGY 4ADSG 4Y2JA 3ZXXA 1NUPA 4M9QA 4MWGA 3S5JA 1HEYA 1UBCA 2GI4A 5LMCA 4DXDA 3EZ6A 2BFCB 2UVQA 3GFPA 1T0UA 5TMBA 3ND7A 1MABB 5B3JA 1F1JA 3DO6A 4M8NE 5ARDA 4B8ZA 4MUFA 1GZVA 2YWDA 3BMQA 1QRAA 5DM60 1FRQA 4A91A 1P2DA 4IDQA 3ZDXB 3WYAA 1ZD4A 2Y05A 4G9EA 3BJIC 3ZDFA 5D7NA 1UOEA 3KLPX 5T8KA 1X77A 1L4YA 2JK1A 1XO1A 4YIKA 4GECA 5DI3A 5DLDA 1MXHA 3FCOA 3CJRA 3PA6A 4WFIA 2NYUA 2X76A 1H5QA 2YBEA 3IAS1 4LYGA 4NCAA 3ZWXA 3ZS9A 4Z4CA 3C5HA 3BXHA 3KTAB 3K16A 1UZLA 4K8OA 1JLKA 3COSA 3E7PA 4MIYA 4WVLA 5EKTA 4C4OA 4MI3A 3K70B 1XZKA 2Q4BA 4YAIA 3FOEC 4G41A 5I9TA 2H59A 2DM6A 2AN3A 3IJ5A 1XDZA 4E14A 2IOFK 1Y9JA 5L9AA 2P3OA 1OXUA 4YCSA 1PWYE 3MWYW 1WMBA 1MN6A 3S55A 1O1YA 5HTOA 3CN9A 1NW8A 4UVGA 4LDJA 4C89A 1SC6A 1OIXA 2G4CA 3N07A 4DUZB 1XTBA 2Z5VA 3LT0A 1WXIA 4Z8YA 4H6PA 5LA6A 1QIIA 2QN9A 5A0FA 1VBKA 2GPNA 3ZJ5A 3AINA 1QONA 2RGWA 3E9ZA 3EGXA 2OHJA 1DOZA 1N2HA 4JCOA 4JL6A 3TUIC 3ZKAA 3NBYC 3ZBQA 2CF5A 4PQGA 4Z53A 5DE3A 4RULA 3WA7A 2ZSUA 4A6PA 2ERXA 1N5JA 1BC5A 4G1VA 3WSWA 2H2FA 4ZO8A 1Q17A 2CFRA 4FBLA 1L7DA 2FHPA 4NOKA 3X1WA 3MVEA 3QE0A 2OCYC 5IAGA 1FNNA 1WXXA 3ZNPA 2H85A 4RIHA 2PD3A 3QXXA 4D4KA 4Y2SA 4CQJA 1ZISA 2FNAA 1FTQA 5TMEA 3KZMA 1G5PA 1HT1E 1P4GA 1VJCA 1YB7A 3RS7A 1D6NA 3IS3A 4AJLA 3RVNA 3NTXA 5EWLA 5LUAA 2HT6A 4MS4A 5IK2A 5JNSA 2CD9A 1E9AA 1YUMA 2H0QA 1PHRA 3W34A 1UXIA 3JTMA 3DP7A 4X90A 5AJYA 5IKPA 1U8AA 1PAUA 4A2CA 4DLSA 1W85B 1E1RA 5B1YA 2JH8A 5EZYF 4EBBA 1XGKA 3O2QB 4GPEA 3X1DA 4LY6A 2GUGA 1D5CA 2YHAA 3KDAA 2G08A 4U6QA 4URYR 2IYNA 5JCXA 1M2VB 2EX1A 2GZ1A 2J9YB 1DXYA 4GVPA 4AIRA 5JCPA 1NBOA 2ZBQA 1TK3A 3R9WA 3H0CA 1TM4E 4RADA 3OF3A 4O4IB 5HIAA 1I1NA 4KSYA 1TW3A 3NKFA 4FBMA 4UHEA 4YA6A 4K40A 3WLPA 5U9CA 3DT8A 5TQ2A 1BVYF 2JLSA 3VAAA 4ENSA 2QQ0A 3HJAA 3PJGA 2GRAA 1MFZA 2VYND 2Z09A 3FMFA 4BGDA 1FSZA 1YFJA 2UZIR 3F1KA 3GO4A 3IUSA 3M5PA 4YACA 2W70A 2CCKA 1B6TA 1VQ1A 5EMHA 3O73A 4QEKA 1V41E 1A88A 3E0XA 3WX0A 2CYAA 4ZT7A 3VDRA 3ETEA 1YQ9A 1DIOB 2EFDB 3OJWA 1Q12A 5D8DA 1KK1A 1UDAA 2NO0A 4FFOA 3DAPA 1YT5A 4QVKA 5F73A 3G5UA 3OZRA 5T5QA 1LDMA 3BDIA 4X93A 3TZ6A 1I10A 3HDJA 3KSBC 3QWHA 3W9UA 3VC2A 3B8HA 5E7QA 5GGXA 5ETJA 2HXSA 2JLCA 3R09A 2ZATA 2PK3A 4GFDA 4Q1BA 4HAUA 3ID6C 3QPCA 8LDHA 4CLRB 4Q4JB 2GBFA 3IQFA 5BMVF 1IUOA 2BR3A 2CVHA 1OXMA 2FWJA 4DDTA 4RF5A 2Q7XA 1AQIA 4IWXA 1R4AA 5F1YA 1JA0A 1TIPA 2DWUA 3MMNA 4JA2A 4TTRA 2VHUA 1KEVA 5CX4A 2JGKA 2YC2C 5I9SA 2B0JA 4J3NA 3JWPA 1ZO8A 1TCVA 2DJIA 3FB4A 2J8ZA 3AM3A 3NWBA 4IRUB 3TEFA 1LBTA 3PDIB 1HDOA 2DR3A 2IQIA 2ZBPA 5JH7F 3RSQA 2XV1A 4BB5A 3ESRA 3L1JA 4X44A 4RTLA 4E5UA 4J16C 1V1RB 5E9AA 2OSVA 3JZIA 5K3DA 4AFNA 4UVDA 3NM4A 5E8RA 4CKWB 4DC9A 3GJ7A 5IC6A 1GO2A 4YAUA 2AJBA 3PGLA 1FZQA 1GNTA 2A30A 3GNSA 4M9RA 1RM0A 1OU0A 1O6ZA 3OCYA 3PUYA 4HS9A 4OQQA 4RACA 1XUOA 5LZ4A 3AI2A 1KC3A 4CVNA 1IB0A 1FTWA 3W5IA 3QYAA 1W5AA 1W0KD 2C5LA 4LXYA 4OGWA 3KDSE 1GNRA 1ZHOA 1CDDA 3VUFA 3P9QA 4KTVE 4KDFA 1QGAA 1EK0A 4TSRA 3ZYCA 2P6MA 4K8RB 1GU1A 3R77A 3WTBA 1HFEL 3K09A 2QI9F 3ZQJA 2PTHA 3ML1A 4PYIA 2EQAA 3OLYA 3KCQA 2BC9A 4A26A 2XGMA 4EUNA 1ZINA 5FULA 3EPKA 2GM9A 2IW1A 1XDDA 1L4UA 3ETDA 4KUEA 4MJLA 3V80A 5JYCA 2Q2OA 2RB4A 4MW6A 2FPOA 2AK3A 4BZXA 1GGFA 1YKSA 2IEDA 3BMXA 4Z1OA 3VM6A 1Z6QA 2O7SA 3DOIA 2HYDA 3AVYA 1D0IA 4C0HA 1FP7A 2B92A 3ECAA 2IP2A 3FVTA 4MS1B 4HGYA 1DEXA 2C8JA 2CEAA 2DUMA 3DE4X 4KRFA 3LH5A 3O8DA 1M5TA 4BNIA 4V1CI 1P1IA 3LX6A 3C5CA 1FNMA 5EZSA 1Y4DE 1W44A 3F6EX 4L4RA 1QHHA 4V24A 2ORED 3HB7A 1H66A 3VYSB 4REMA 4K26A 4KGZA 2WAAA 4F93B 4LF5B 4S3MA 4KLRA 3CY6A 4F04A 4W6ZA 5KYYA 1O77A 2Q46A 1EVKA 3FLBA 4MWZA 1K6MA 3GVPA 5AUOB 4GL4A 3NALA 1YQDA 4BJ5A 1QYRA 3I58A 3GLGB 4GW3A 5B1HA 4L16A 5FHRA 4J07A 1W87A 2XKKA 4UMFA 1SKYE 5DW0A 3TSCA 1QTNA 1M2NA 2GJ9A 4FCWA 4QYMA 4YJHA 2P9GA 4BGVA 4W63A 1SRRA 3I9OA 2PLNA 4TTSA 2UZ1A 1WBBA 1ORTA 2ZVQX 2XSZD 1MQSA 1Y8RA 2XNJA 2YXEA 4TYQA 3VBCA 3MRSA 4JLBA 3GR6A 1KXJA 2XA2A 1C1YA 4U9HS 3TB6A 3VZDA 4FR0A 4RWZA 4JQOA 3L6OO 5E2IA 5FBWB 4ZT3A 1KI7A 1UKZA 4KE8A 3U3ZA 4CF4A 4UUNA 1TLLA 1GCAA 1X7XA 1JEJA 5AW9A 4ZI3A 5H9WA 5H02A 4QYTA 4G97A 1PHPA 5AXDA 2HWKA 3DMGA 1G20E 4TVKA 3RTGA 1EXVA 1J8MF 1TK2A 4HBGA 4IJVA 1E3TA 1LSUA 4ZQCB 1OWMA 5JAHA 3R41A 3IIEA 2A88A 3CNNA 3EW7A 4KMSA 3KBOA 1FFXA 2ZQYA 4P33A 3L79A 5KAPA 5IW8A 2CEKA 4INZA 4BOYA 4P54A 1KGSA 1E5LA 2QD5A 8MHTA 5CNIA 1LVUA 1DKUA 5HF8A 3WBKA 3B13B 4B2PA 1PFWA 3LDAA 3NANA 3GX1A 1JE0A 2C7QA 1G1MA 2C8KA 3AG6A 4LHYA 4BCCA 1NLYA 2FI1A 3TYXA 4E7PA 3DR5A 3JD3A 4KR7A 3LCCA 4Z86A 2D74A 4JV5B 1UWVA 3AHJA 3PZBA 3GGPA 4P0TA 2DOKA 2WINI 5I8PA 5GPBA 5KWIA 3K9GA 2WPNA 4HN4B 3W5HA 4OI0A 4KGVA 3CO5A 5LP6B 5K6AA 3KXDA 4C14A 1U8FO 4RZIA 1K97A 4B71A 3L0PA 1E58A 1U2TA 3K9WA 4FYKA 4GO1A 4ZICA 5IVHA 8ABPA 4B8YA 2AMYA 1BCRB 1XYYA 2JGLA 3Q3VA 1X92A 1NVBA 4CIYA 4HXGA 4QNMA 1F6BA 4TLCA 2FUEA 3TNLA 4B76A 1SOVA 4M53A 3S8MA 3AEUB 3WMEA 2PL3A 3JVDA 4KB5A 3F4LA 5DU2A 3WDMA 1NQ5A 4S05A 1PGQA 1E9SA 1JHAA 1QVRA 3FLMA 3RAGA 3DVLA 1AF7A 1NHWA 3G23A 3L6CA 4TQAA 2FCRA 1K5HA 2FFHA 2QN8A 2NVBA 5IFKA 3U7QA 1CLUA 2AG5A 3DOFA 1Z8FA 2GETA 4CYMA 3HBMA 1LI4A 3OMWA 4JX8A 5CM9C 1QORA 2WT4A 3K35A 4QXRA 5HFJA 4DCTA 1NSYA 1QGZA 4KNWA 2KMLA 3AC0A 1PR3A 1YR3A 1N6NA 4YT2A 2C5EA 1L8XA 1VIDA 2Q8PA 3UUFA 5B7NA 2D5AA 4TMKA 3UWKA 5JSZB 2QBYB 3QENA 5IS2A 1JGTA 3QPWA 1BN7A 1G60A 5FLXA 1MAAA 5H5JA 3JS5A 3BTUA 5K20A 5J5AA 1G6KA 3HZOA 4LMAA 1N9GA 4UXHA 4HAXA 2Y9MB 5DYGA 1G8KA 4BN5A 2QRZA 5DH9A 3FPEA 3QXCA 2H1HA 4CLEA 2X4GA 1N4DA 2F62A 4NBVA 1UBJS 4HNUA 4N39A 1KO1A 2CNWD 1RLUA 4KXUA 3VU8A 3ORFA 1C4KA 4DANA 3RV3A 5CA1F 5LB2A 3T5AA 3RVLA 1A8PA 4KKXB 5FYDA 1HX7A 3W5JA 4B6QA 5L3QB 4QM7A 2ZBVA 3K72B 1KJNA 3L0ZA 1T4DA 4LWZA 3ZGOA 1ZNYA 2WTXA 3FTQA 2BFMA 2HA0A 4E32A 1V48A 4ROSA 1C29B 5TPWA 4ECAA 1W25A 2CLHB 1BW9A 1RI1A 1Z2EA 1AKTA 4ZC1A 3V4LA 2EKPA 2HWWA 1C1XB 1L8LA 3D3NA 2JBHA 5ALQA 1CP2A 1KETA 2PZGA 2P2CA 2JLWA 5T6MA 4YCBA 4BNXA 3GDHA 1RRMA 4XWWA 2Q1UA 2LRHA 1YXMA 1ZIOA 3QI7A 4NX2A 1NG1A 4L1KA 4EGJA 2ZBFA 1B6SA 1EWRA 1U3DA 2R87A 1GDHA 4XWYA 3BGWA 4DZZA 1YBVA 3NOVA 4IUCS 5EIAA 4TS4A 1IY1A 5KKAA 2PKQO 1WPRA 1R5JA 1WKCA 3I1IA 2V1XA 3NVAA 5GMOA 421PA 1B23P 2CV1A 1GCOA 4KXMA 3IXLA 4ZT4A 5AVSA 1AXEA 2TMKA 2XRYA 3NH9A 4BVJA 3LW7A 1IXRC 4KE7A 1KSHA 3ENNA 1WP4A 1LB1B 2ZANA 2PV7A 4H6XA 4PQYA 4YRNA 3FSJX 1GZSA 2ZJBA 2ZTHA 4LJ8A 2UKDA 1QKJA 4YRTA 5KSPA 3RS3A 2H8GA 1KQPA 4L02A 3V1YA 1OFUA 3ESCA 3PXBA 4FUQA 1UC4B 2VNAA 1GD1O 4R5HA 3RHTA 3WNBA 5CFPA 2A9QA 3KE9A 4ZDIA 1RJ9A 4PC1A 4UXJA 1JPUA 4KC0A 4F38A 4ZYVA 1H9AA 2J3QA 4UAGA 1E9VA 1OA0A 4XI9A 3GUZA 2QUBA 1XJCA 2DLCX 4JI3B 1N1EA 2FK8A 2QVZX 4J6EA 4NU0A 3T9CA 3F67A 2PMCA 3ZE7A 2YYZA 4J7UA 4YQYA 1O9BA 5JEEA 2L2QA 5AM2A 3BILA 3DAGA 2BD0A 3C5WP 3K4QA 3Q87B 4I5EA 3WMXA 3VOAA 1C41A 4YJGA 1VG1A 1RWMA 1RKXA 2HHCA 3NKLA 5EKSA 2RH8A 2IBMA 1G7SA 5BSKA 1DPGA 1DDIA 3SLGA 3WLIA 2C03A 1S4QA 4WCDA 3AJ8A 3IUEA 1WUHS 5IZ4A 2ZAGA 1KJQA 3SIWA 2O2JA 2NN3C 3LHIA 3V8NA 3SLKA 4MUBA 2J9FB 2R00A 1C7ZA 4PC2A 5JNVA 3WXBA 5DPMA 3FN4A 3UAGA 8AT1A 4EPWA 1K7EB 3MRTA 5F52A 1E3QA 3S70A 3UMSA 1GTVA 2ZYDA 4QGBA 2GPSA 3CA8A 3NNSA 1OE0A 1GNVA 5JAQA 1WW8A 5ALFA 1TXGA 3P27A 2M98A 2C9BA 3RFUA 2BKLA 2CNKA 1N6OA 2XDYA 3P2YA 3BMNA 1YFLA 2XGSA 1VFPA 1E4EA 1MZVA 3CNBA 5SV2A 1N3BA 2BWJA 3M1IA 4DMKA 1N0WA 3HQ4O 4X6UA 3DFFA 1BDIA 1VOTA 2CBZA 3ZTWA 1XTVA 2IOYA 3QKWA 2P2DA 2C2GA 2ZRMA 4HV4A 3RYFB 2PL1A 2D4AA 5C1PA 2ZI6A 1JR4A 3DZCA 4A8JA 1YBMA 3IIMA 4RFLA 4E13A 4Q9KA 4QDXA 3N2IA 1J9ZA 1RE0A 4TN5A 4D4MA 2H1OA 1ZBDA 2H4HA 1W8DA 2RBGA 4FYYA 1AMOA 2B30A 3RSLA 1NQVA 1P2VA 1PG5A 3EVZA 2UVDA 4MA0A 1HDZA 2OHOA 4LZZA 3P9PA 3A9TA 4QEZA 4Z4IA 1H2AS 5EIEA 2VUTA 2VNSA 5I47A 3UCFA 1DO8A 4HNQA 1U8YA 2JIQA 4MP3A 4RDHA 4BX2A 4C08A 1YS2X 2UYHA 1WMDA 1GZ7A 1JU3A 3H1TA 2PZBA 4YECA 2CDNA 3VI3B 4C2BA 2E6UX 5BURA 1CE8A 3DQPA 4ZT6A 4X8HA 1B41A 4V39A 2QNRA 1I1OA 2X3UA 2ZLBA 3GFOA 3I3OA 3VR4H 4YCDA 1A2BA 1ICIA 4OHWA 4TT3A 4HQOA 2PS9A 5BQ5A 3UCXA 3ZHUA 5IHPA 1NXVA 4X1IB 2QL5A 1NW6A 1DIHA 3TLKA 3DMTC 5BP7A 3C43A 4KPUB 5BN1A 3CLSD 3ZVKA 5KTTA 4JLDA 1DAMA 5DJ5A 5LMNB 1IN6A 1KVSA 1QO0A 4DSNA 1ORRA 3UWOA 1IHUA 1ZBQA 1K08A 2QV0A 3FOWA 1CUHA 5D1HA 1T5BA 1E2GA 3M1LA 2YDXA 2O7VA 1IM2A 3BE8A 5IKOA 3MCAA 3SBDA 2N46A 3LMKA 2EGHA 3HM2A 3ZJYA 5ALVA 4DPKA 4QPDA 1KHHA 2G7ZA 1RLJA 2ID8A 2JATA 1K92A 1OJLA 3OLQA 2GYWA 1JDBB 2BV3A 4G1UC 1J0AA 1OYYA 5LU8A 3VI4B 4NH0A 4YDSA 2VBCA 1CETA 1FSFA 2OAEA 2ZI5A 2WJHA 3N58A 4O1MA 1YQUA 1M7HA 2I54A 3HCRA 1RHJA 1F2UA 4IDAA 1XG5A 4R3UC 4YRLA 2B2CA 3A9RA 4BO4A 4EPTA 1FYEA 4FD2A 1XX6A 3H84A 1C5KA 1MH1A 1U02A 3PCTA 4MCJA 3RIXA 2VPYA 5IDWA 4UKDA 4GC9A 1KZHA 3U0BA 3OU7A 1ABBA 3AKYA 1RU3A 3DEYX 3Q11A 2I33A 4HCJA 4CIAA 2ZDQA 5HK9A 1EWTA 2G63A 2JFNA 5KMGA 2D8MA 3BJEA 4H7EA 3RC1A 3W8RA 3OPVA 1WRBA 2WIKA 5CYGA 3PB3A 4PHFA 4GKJB 5TARA 2O3RA 1QPBA 4XE5A 4Q0MA 1R0RE 4F5DA 4Q7LA 4N7JA 5EN4A 2HU2A 4EPYA 3PFIA 5A1TA 4LRTB 3AFNA 4X7PA 3OCVA 4KN6A 1D2EA 3X2EA 1IY8A 3TD9A 3AHCA 1SD2A 2RGBA 3DPIA 1PJRA 3O3CA 5FTLA 3R0ZA 2DTDA 4NJOA 4XX1A 1KSGA 2OP1A 3FCEA 3GFGA 1E2PA 5IARA 3V8EA 2QUAA 1CNEA 1K0FA 3N39C 4CWAA 4DREA 4EO7A 4EW3A 4U8HA 2AHRA 5KU7A 2DP4E 3ONNA 3RSCA 3T0FA 2BBTA 5CDUA 5LLTA 1M0SA 3S7TA 2AC2A 1QHNA 1WMAA 4COOA 4G8DA 3EZ2A 3SI7A 1OPXA 3QQ5A 3O4VA 3GLFB 1Q95A 1T8PA 1YOBA 2GM3A 5IBRA 1O9GA 3LJKA 4H4EA 2C98A 1O0BA 4JSTA 1JA9A 1E8NA 3G8DA 3LSYA 3QOXA 1KZGB 2FPRA 3QRWA 2B4QA 3HJHA 4WLVA 2WWVD 4KIWA 1OGIA 1KJ8A 3DTNA 3T1VA 4ER6A 2B6HA 7REQA 5AVYA 4DA4A 2IS6A 1PFGA 2BGMA 2GASA 2GILA 3BFPA 3CF0A 4NBNA 4WA7A 4AJKA 3EOAI 3H1PA 3TTXA 1SC3A 1SU6A 3NYRA 2UXDB 5DWDA 2FPIA 1EK5A 2IW3A 4CQLB 4EY3A 2NV2B 3SZOA 4NXNB 4UM5A 4TMTA 4D4HA 4EUKA 1XZBA 3KPUA 1M2WA 5MHTA 4DCMA 1PJ4A 2MT9A 1E20A 3LQ1A 4HLUA 4OHXA 4UHCA 5AMXA 3T7KA 1JJAA 4M1WA 4B0PA 3QU7A 2FSHA 4JENA 1XEAA 5BWCA 1RRCA 3HCEA 1D2RA 2PLAA 2W7TA 3IMFA 5E6RA 4NI5A 1DEHA 3MMPA 3PSAA 1TAUA 1QGUB 4B9EA 4BC1A 5GIOE 2QN3A 2X6QA 3SJCA 1VPTA 3BJMA 3HUFA 1FFSA 1FXWA 1ZMXA 2ECKA 3KJXA 2HGZA 1K8XB 4G26A 4HPXB 4WIAA 3CB4A 3HCOA 5ICFA 3AF2A 2DSTA 4UDXX 3BXEA 3VPBA 2PZFA 1SUCA 2PIAA 2ZKLA 4B74A 1P1HA 1XZPA 1GGKA 3DF7A 1YZYA 4CR6A 2DMRA 5AKGA 4OEHA 1LPMA 1ITZA 2M32A 4IMPA 1E3SA 3AUYA 3IT1A 3L0IB 1A0OA 3LD9A 4XPIA 2AQIA 5A3JA 1KKMA 3LZCA 2VRCD 2ZIVB 4CM8A 2Q99A 1JFLA 7AT1A 2QTMA 4BMCA 4CTJA 5JNWA 2ZKIA 4K3UA 2LKDA 1S7GA 1F38A 5JEDA 5KSYA 1TJ3A 1ODFA 2G25A 2HL6A 3TZQA 1L1EA 3NQ41 4QTUB 2MSNA 1ZJ6A 3IAAA 1CQIB 4FX2A 5DLPA 5FXMA 4Z6KA 1JIIA 3CBGA 2YTZA 4ALJA 1MB2A 4RVHA 2HADA 3Q3IA 4KGXA 1VE9A 3P9NA 4TV8F 1Z6YA 4U2DA 1KOGA 2YZ2A 1N2OA 4HO1X 5E8JA 4AD8A 5BVHB 4V0LA 3ZI0A 5CJPA 4FKZA 3U19A 2V7VA 4RA6A 1SBIA 2DCMA 2TSYB 1QYDA 3VR6H 1US8A 1YS6A 2FY8A 3D4IA 4EA7A 3AESA 2VYNA 1WVMA 2HHLA 4QBHA 2AR9A 3HXPA 3U7RA 4CM9D 1A50B 1R8JA 2CB9A 1JDSA 3VDQA 2NUAB 4TKVA 1P7YA 2IFTA 3WGOA 5E9QA 2CXSA 4F0JA 1PL0A 4IIJA 5IM5A 2ENWA 2V7WA 2FMFA 4HTFB 2Z6AA 1AQNA 1XZFA 5CUQA 1B1CA 2UZ0A 4BMDA 2JHFA 1DC7A 1BXKA 5LUBA 3KJEA 1Z8DA 3WWPA 1GSOA 3OJEA 5HIMA 4CT4B 2YZGA 4F85A 1ISSA 4CG1A 4BQIA 5ULLA 2JLBA 4BQOA 4PAQA 4ALIA 4WSOA 2CMGA 5L4LA 4MRNA 2F7SA 3PQ5A 3TPZA 4PSCA 3ZXYA 4LTMA 3AWDA 1HL7A 3UTCA 2AW3A 3NR2A 3INYA 2Z5GA 3T4PA 4D43A 3E5HA 1RWWA 3EPPA 3EXG1 3DKRA 3MBIA 1HV8A 5KYXA 4F1WA 4G9BA 1EP1B 2VQDA 3I6ZA 2XUFA 2VJMB 5KU1A 4NG5A 2PWPA 3B7GA 3DHVA 3DMFA 3EGOA 3LIPA 4MW4A 4P8RA 1UP4A 2ZSHA 2YS7A 3OZWA 4PZCA 2D8AA 4RCVA 3VU1A 3A2KA 4KJXA 3LX5A 2GPTA 1PZXA 2FE4A 2VCYA 1IN8A 1UXJA 3FY4A 1XA0A 2BFDA 3W7VA 4JNKA 2ROQA 3G5AA 3G6WA 2HN9A 2QNBA 5CTAA 1OTXA 4V0ME 1XCGB 1W7AA 1ZNQO 4UTVA 5IN4A 4YGYA 4MTCA 4DLNA 3EULA 3JWGA 1MJNA 1ZUNA 3IULA 4POAA 4QDJA 5CHYA 1A5BB 1UZUA 2YWEA 4IVPA 2C82A 2BGTA 3LYAA 4M1KA 1P2SA 4UBOA 1UPUA 1W0KA 2VJKA 4YXFA 1ABEA 2Q28A 2YY7A 3ZHBA 5K8TA 4BJ3A 1KTIA 4JHLA 5TQVA 1X7WB 5BUQA 1SB8A 2HB6A 1Q1GA 3VHQA 4CKBB 2JD0A 1OREA 4QELA 4RZHA 4DV1B 2AIRA 5HF5A 5ALTA 4EJSA 3CS3A 4XGRA 3NXSA 3UJ9A 1GAEO 3D4OA 3RUAA 2Q8NA 6LDHA 3R3SA 1WDMA 4EY7A 1FUEA 4XVQA 3MT7A 1L5RA 2YL2A 1A71A 3FSGD 2WKWA 3QV1A 3ZI4A 3QLVA 2V55B 3VHLB 5CEFA 3SWWA 4RORA 1HDEA 1AK2A 3WLRA 2F2TA 4KIGA 5JVDF 4J3JA 3HDVA 4KQIA 3WO1A 4M1TA 2FWPA 3ANMA 1VSVA 1JHPA 5AM1A 2OZLB 4EF6A 1BEUB 1TF5A 2R66A 3O8CA 4Z7NB 2QTRA 2OY0A 3AR8A 3RVPA 1NY6A 4CMAA 5IM4F 2XRZA 1R5BA 2WTAA 4E31A 4RC9A 4XH9B 1KYVA 4QLAA 5A0VA 1PT9A 1NT4A 5DGCA 3AU9A 1OFVA 4O2AA 4B43A 4JI8B 4QARA 4HATA 5LZ5A 2VBGA 2GN4A 3QOFA 4ZU6X 4JU8A 5CFZA 5GJWC 3B2QA 1IY0A 4KDRA 4LNHA 1OOEA 3SN6A 2F9MA 3TXXA 2W6ID 2C2ZA 2TMGA 4BV3A 5AW1A 2FP4A 3PCXA 4F4UA 5BV2P 4QOSA 2Z4RA 2UVPA 4MQUA 1N4AA 5AK5A 1D4ZA 1J21A 5JPIA 3RHZA 1GUYA 1PS9A 3FA2A 2R86A 4XVRA 4CTNA 4HRXA 4MA5A 1DMSA 3IP5A 1IBSA 2XSZA 1CHDA 4Y2RA 3JQBA 1GFWA 4J03A 3PHGA 2BPOA 2A57A 2FF5A 4C0JA 3FHOA 1HLPA 3CW9A 2ESRA 2E4XA 3DEZA 1IJBA 1DRVA 2WM3A 3CKLA 3OT1B 3BZUA 1M3SA 4XCXA 4NAHA 4ZVMA 1VGQA 3UK7A 2A35A