4A2CA

Crystal structure of galactitol-1-phosphate dehydrogenase from escherichia coli
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
346
structure length
346
Chain Sequence
MKSVVNDTDGIVRVAESVIPEIKHQDEVRVKIASSGLCGSDLPRIFKNGAHYYPITLGHEFSGYIDAVGSGVDDLHPGDAVACVPLLPCFTCPECLKGFYSQCAKYDFIGSRRDGGFAEYIVVKRKNVFALPTDMPIEDGAFIEPITVGLHAFHLAQGCENKNVIIIGAGTIGLLAIQCAVALGAKSVTAIDISSEKLALAKSFGAMQTFNSSEMSAPQMQSVLRELRFNQLILETAGVPQTVELAVEIAGPHAQLALVGTLHQDLHLTSATFGKILRKELTVIGSWMNYSSPWPGQEWETASRLLTERKLSLEPLIAHRGSFESFAQAVRDIARNAMPGKVLLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords GALACTITOL-1-PHOSPHATE 5-DEHYDROGENASE
publication title The Crystal Structure of Galactitol-1-Phosphate 5-Dehydrogenase from Escherichia Coli K12 Provides Insights Into its Anomalous Behavior on Imac Processes
pubmed doi rcsb
source organism Escherichia coli
total genus 112
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 1.1.1.251: Galactitol-1-phosphate 5-dehydrogenase.
pdb deposition date 2011-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4a2cA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4a2cA01
3OFSA 1RPNA 1JKFA 4A2CA 5CEEA 3H9EO 5I7VA 4FJ1A 4NK5A 4CMGA 3FBGA 4UVEA 3COSA 1ZCJA 1R4NB 3DDNA 5BT9A 1XU7A 4PLCA 4XQGA 3C3XA 1F17A 1Y6JA 5CPFA 3GDFA 3D0OA 4ALJA 2GPTA 4NMHA 3RBVA 2EW2A 2VHXA 3HSKA 4RGBA 3RROA 2GYYA 5DBFA 3BTVA 3TPCA 4IZIA 1I3MA 1HE5A 1DAPA 3G79A 4WCFA 1PR9A 3BMNB 4MO2A 2JD0A 4MVJH 3OBBA 2QIOA 2IE0A 2FOIA 4CM8B 3ULKA 4J2HA 4O59O 1ZK4A 3KYCB 4BS9A 2YQ4A 2XOXA 4TMFA 4BGUA 2R00A 4PLVA 1QYVA 3FPCA 1V0JA 1EDOA 1H2BA 1SB8A 3JTMA 2R6JA 3PDJA 1BXGA 5HM8A 2P5UA 4UEOA 2C2YA 1IE3A 5DDIP 5K6AA 1F14A 2RH4A 1C3VA 3QV1A 5JAZA 1YL5A 4UUNA 2O3UA 4RQUA 1BVRA 5IN4A 4CLDA 1AUPA 3DBRB 3KUXA 4BO1A 2OBNA 1AGNA 1YH3A 4XJSA 4GVLA 3A9WA 3PJFA 3DBHB 4BKQA 1LQUA 1QSGA 4CV1A 1MFPA 1VM6A 4ND4A 1HLDA 4YYZA 1GZ6A 4FGSA 1R6DA 4WLNA 2PR2A 2TMGA 4NR0A 1SPXA 2PLAA 5HWSA 4KUHA 4CLOA 4WNCA 3WYEA 4E6PA 5CEJA 3NTOA 4Q9NA 5GZ1A 1O95A 3QHAA 3RBXA 4M86A 2OZPA 4RDIA 3I23A 3TFOA 3MWEB 1HSOA 1IL0A 1KY4A 5KJFA 3PQEA 4F46A 3DC2A 5G0SA 4JJFA 1KOLA 4I08A 5A9SA 4QXMA 1T2DA 5B1YA 1PJ2A 3H9QA 4GMFA 5CG1A 2GGSA 2C0CA 1EUCA 3ZW8A 4CPDA 3KSDO 2H5LA 1NAIA 1N92A 3V2UA 1OAAA 3PIDA 2X8LA 3UUWA 3PHIA 4BKUA 5LCXA 2P9EA 3F1KA 4ZA2A 4BNYA 3RJ9A 2O4UX 3EYWA 5L4NA 3GRPA 1LDBA 4BUCA 1L1FA 5H82A 3WNQA 4E13A 1I24A 4BNKA 2AE1A 5ITVA 2EWMA 4RVSA 4GSKA 4Q3DA 5EIOA 1E5LA 4Q3CA 3FRJA 4WUVA 1B0AA 4O0LA 2X9VA 5H81A 4R68A 4CMIA 4UVGA 4TRNA 5K0ZA 3NYWA 5L95A 4XWYA 1NWCA 3TRIA 2CDBA 2GNAA 3D3EA 4KUGA 4B7XA 4E2WA 1Y1PA 3EMKA 3I5MA 3VPGA 4RV9A 3GEGA 5F3RA 3KVOA 1UZLA 2CSUA 2Z95A 4FDAA 4L76A 1U2GA 3X2FA 3K8ZA 1P1KA 3NDRA 3GPIA 3JYQA 1PZFA 1QG6A 1QYXA 3DB2A 3DFUA 4HADA 4R1UA 3I3OA 4DL9A 3ASUA 3OQBA 2QQ5A 3ZHZA 3QWIA 3U4DA 1KS9A 4Y98A 2Y1FA 1ISHA 2A4KA 5KWEA 3LYLA 4L0QA 1D1SA 3G3EA 4TKMA 1LDYA 1EVYA 1T26A 1GR0A 5A4DA 4E32A 5L7YA 3HDHA 4BO9A 3D3WA 4D7AA 3FTNA 1PL8A 4FR5A 1S6YA 5L4LA 3L07A 1C0IA 4TKLA 2J8ZA 3DAPA 1XQ6A 3I9OA 3Q2KA 1NQAO 4I9NA 4JN6B 4XQ9A 5B4TA 2BELA 2GZ3A 1U4OA 5KKCA 2JFFA 3O38A 3AM3A 3A28A 1CETA 3F5QA 3JQEA 4QX6A 5THKA 4AJIA 2PH3A 5KVVA 3BTUA 5COQA 1ENZA 1X7DA 3WLEA 1UP7A 2FSVA 4AJPA 4DREA 1FF9A 4I5GA 3VKVA 4EUHA 5FFFA 1T2EA 1UXKA 2O48X 4DA9A 3L6DA 3Q3CA 3RU9A 5JXWA 1P3DA 3JYLA 3E03A 2DBRA 1ZK2A 3ZWMA 2I5PO 1Z7BA 4FD3A 2GLXA 3H6KA 2X23A 2GDZA 1LSUA 2Q99A 1ENYA 4XJTA 1Y81A 1EVIA 4ILKA 4B3JA 3DHEA 1PZGA 4E12A 3FPLA 1ISGA 1LLDA 3OM9A 4INAA 3PGJA 3V1UA 3WNVA 4DVJA 5L51A 3ZWYA 3FF4A 3WXBA 5G4KA 2Q1TA 3JQDA 4IMRA 1XELA 5ES3A 4BNHA 5JFOA 3T7CA 2Y66A 4AJKA 1NQTA 1QYCA 3DR3A 3HFGA 3OEWA 3WQSB 5BNTA 2NTJA 2ZK7A 2GCGA 4ZQGA 4IJVA 4LRSB 4MJLA 3TOZA 1CQJA 1PGJA 3ETDA 3PWZA 1E6EA 1PZEA 2Q4EA 2EKPA 3D7LA 1GDHA 2Q1SA 1DFIA 4YAEA 1N7HA 2B4RO 3H9GA 1AE1A 4OGWA 2Y0EA 2PY6A 5A06A 1IHYA 3WTCA 3OIFA 1R37A 4P4GA 1C1DA 3I52A 2W2LD 3IP1A 5CEFA 2CD9A 5LDGA 5DULA 2B83A 3LK7A 1OMOA 1BHSA 3TZQA 4YA6A 2QW8A 4XR4A 5KJEA 3FWNA 4MP3A 1PU2A 3FBTA 2AEJA 4OL9A 3S2GA 2DU8A 1ISIA 1PL6A 3ANMA 3GDGA 2IRWA 4DWVA 3RUIA 5IXYA 1IPFA 4DPKA 1UAGA 2E49A 2EW8A 1GUYA 1Z6ZA 3GG2A 4XYBA 1T4DA 3ST7A 3IC5A 4E5NA 2GUGA 2RHCA 3E9NA 5BNIA 1UDAA 1WMAA 1YQGA 2XAAA 4KMSA 3OECA 3WBBA 3WLFA 1HLPA 3R3SA 3ZWPA 5JSFA 2P5YA 5KVSA 3DBLA 4R1NA 3F46A 3QVTA 4LSMA 4Y6PA 1ZJZA 1E3EA 1K6JA 3H4VA 3RUEA 4JK3A 4LN1A 3QRWA 3HJAA 3S55A 3Q9UA 1ZZEA 1L7DA 3GGGA 1U3VA 3N7UA 1W6UA 3RC2A 1LBEA 1B15A 3DL2A 3H5AA 1EE9A 1GUZA 3LLVA 4NJMB 2ZYAA 3CSDA 4RDHA 3KSUA 1UXGA 4YT8A 5A05A 4BKPA 3HADA 4EZBA 1LLQA 3CEAA 2JCYA 4RPLA 5BNFA 4BNVA 1H2HA 4CM4B 2CF5A 1U4SA 3T4XA 3M1AA 4MVJP 5C7IO 3HDYA 1MA0A 5FI3A 1P45A 3K6JA 4CL3A 4K9DA 2XXJA 1H93A 1Z45A 5TNXA 2G76A 3AU8A 5CAEA 5JAMA 3L0DA 1A9ZA 1UR5A 3JQBC 3PEFA 1Y8QA 3W1VA 2Y0CA 3V8BA 3UF0A 2HQ1A 1PZHA 3G0OA 2J6IA 4J91A 2Z5LA 5A9TA 1YRLA 4DQUA 3H3JA 3M2TA 3DZGA 2DLDA 3UVEA 1ADGA 1R4MA 2ZYGA 2I99A 3S1LA 4BMSA 2R2GA 3PHGA 4WEQA 3S8MA 1B8PA 1PQUA 3PRJA 5DBGA 4NFHA 1ZJYA 3FI9A 2VWQA 1FDWA 5BSGA 4FJ0A 3WDSA 1MC4A 4ZQHA 4M87A 5ILGA 3K96A 4R9RA 1KVUA 2O50A 1LDGA 3I6IA 5JMPA 5TJHA 1GL3A 4Q3EA 2CUKA 4BB5A 2PNFA 4WCDA 1HE2A 1NBOA 4YACA 2X86A 1U5AA 3ZNPA 4R41A 3GVHA 3VH3A 5AXAA 4CQMA 4NU6A 4XIJA 4RPJA 1K6XA 4EI2A 2AEMA 3GN2A 4DMLA 3GFBA 3FN4A 1E3SA 3W4JA 1PJQA 5T8KC 3SLGA 4CM6A 4HWKA 3MOIA 4MIEA 4OO3A 3UICA 2RH8A 2X4GA 5ER6A 3WJAA 2VRCA 1U8FO 3U4HA 1BGVA 1TEHA 4J43A 4PRKA 1PGQA 2Q1WA 4BO6A 4RPHA 2I6TA 2VOEA 4YR9A 1G1AA 4BO0A 1DLJA 1RWBA 5C3MA 5A5FA 2OL4A 4FBGA 1O5IA 4HY3A 3HN7A 3E5MA 5KJ1A 4DQVA 2LDBA 2ZB8A 5JO0A 4ZQFA 3DHNA 3DZJA 1XDWA 1Z7EA 3P19A 4U0JA 5DN9A 3PK0A 1P1RA 2P4HX 1I36A 3TL2A 2DTDA 1KVSA 4AG3A 4MINA 4B3IA 3AWDA 3PI7A 1EBFA 4Q3NA 3KRTA 2O2SA 4EGFA 3BMCB 2Q2VA 1SOWA 2A9FA 3WSVA 2EIHA 4IJKA 1VI2A 1DRWA 4CMJA 1DAOA 3LF2A 1YBMA 3I9KA 1N2SA 2B69A 4LVCA 3GA0A 3AY3A 4WLOA 4AJLA 5A9RA 4E5PA 3ITKA 3ZV4A 4NDNE 1IY8A 2EERA 3F9IA 5JDCC 4D0RA 2DVMA 2EGGA 1QRRA 3FWZA 2O2YA 2IZ1A 3B1KA 3E82A 3NJ8A 3ZGYA 5JDIA 1YB5A 1AHIA 1HZZA 1HDOA 2ZKLA 3L6EA 4CM7A 1E7MA 1JKJA 2I76A 5TQVA 4WLUA 4HFMA 3WG9A 4CV2A 3AUAA 4TVBA 1JQBA 1JVSA 3GLQA 2ZTUA 1Y5MA 2HRBA 2AQHA 2BFOA 3VH4A 2YV1A 2NTVA 2BFPA 3TFQA 4KDEA 2D59A 1OBFO 1NR1A 4GWKA 4BO4A 3UW3A 5JW6A 1NQOA 3F5SA 3UH1A 4YAGA 3PDUA 4Y6RA 1NPDA 1IHXA 3ONDA 3GPDG 3WYBA 3A14A 3NGLA 4NIMA 2IZ0A 1N7GA 3RUHA 3JQBA 1WXDA 5EMHA 1NPYA 2HRZA 3U4CA 1SMKA 1HYEA 5IZ4A 1EEHA 1PJ4A 1IUKA 4MVJM 3L4BA 4P4LA 2AMFA 5AXCA 4J3FA 1Q0LA 2FN7A 3Q6IA 4YB8A 4CR7A 1TT5A 4PG5A 5KTKA 2GN9A 1NM5A 1MP0A 4M89A 4CMKA 1C1XB 2X9NA 3KYDB 4RF4A 1UZNA 4HNGA 1EZ4A 4WOKA 4ZQBA 1EVJA 1MB4A 5G0TA 2D1YA 3TZ6A 3W8DA 4J6FA 4JROA 1QLHA 5MDHA 2Y99A 3OJ0A 2WDZA 1BVUA 3LC2O 2IXBA 4GPD1 3TWOA 1NFFA 1BW9B 1H9BA 4L74A 3W8EA 1ADFA 4FFMA 3WGIA 1XQ1A 4EUEA 4FQ8A 4IDDA 1LI4A 3ROKA 4D3SA 1LRJA 1LUAA 1NP3A 4D44A 1GZ4A 4NHEA 3RFTA 3TOXA 1GQQA 2Q4BA 4NBRA 2Y1GA 2DC1A 2GZ2A 1VPDA 2PGDA 2ZIZA 4IDCA 1E5QA 3FHLA 2PFGA 1M66A 1Y9AA 4ROSA 4BO5A 3F1LA 4XRRA 1CIVA 1GYQA 1E7WA 1YJQA 1V8BA 3INGA 3BHIA 1GCOA 1Y8RB 5T64A 3VDQA 6ADHA 3U3XA 1U3TA 1ZEMA 4DBZA 2GZ1A 3VPXA 2O23A 3PLRA 1LSOA 3CIFA 3VZPA 5JY1A 3DTYA 1ORRA 2NVWA 1OZAA 4GLLA 2PZMA 2NTNA 4PLPA 4CMEA 1YQXA 1NFRA 1X15A 2OXIA 2P9CA 3SXPA 4YCAA 1HDYA 4OQYA 4BO2A 2BGMA 2ILTA 4M54A 3RVDA 3PYXA 4G2NA 3CZMA 5ICSA 3WR5A 1E0DA 4I8XA 2FPGA 5DCWA 3GNQA 1HYHA 1DFGA 5KJ6A 4NBTA 1VLLA 4UVDA 1U3UA 4YQZA 1XEAA 2QYTA 3R3JA 3RFVA 4M8SA 3RU7A 4GAEA 4O63O 5JDCA 5G2OA 2BMAA 3MJEA 1B8UA 3WGZA 3NV9A 2BRUA 4W7HA 4FC7A 2B37A 5A03A 4AJOA 4R3NA 2E6UX 3FNFA 4ND3A 4NK4A 3LDHA 4CJXA 5JBIA 1ONOA 3K5PA 3E1KA 4B7CA 3MJTA 4CMCA 3EZYA 2G17A 4R69A 2IXAA 3RC9A 3LT4A 4E4YA 1CDOA 1ULUA 3JQFC 3WYCA 1X7GA 2NVUA 4I5EA 4OYRA 3PHLA 2Y68A 5TC4A 1WAMA 4IXWA 3ZV5A 4BVAA 3UCEA 3QJ5A 2CVQA 3PFFA 4CR8A 4DC1A 3RKRA 3MJ4A 2PD4A 2DBVO 4WLVA 3DZIA 2FRDA 4KWIA 1VJ0A 2YHIA 5JMWA 5LDHA 4L4RA 3IL2A 4IDFA 4O1MA 1YGYA 5IFLA 1Q2XA 1Y9EA 1IYZA 1M75A 1XR3A 3H2SA 3WQRA 3JQ8B 2JAPA 4NQZA 3AOGA 2DPGA 3OA2A 4YJGB 3C7DB 2JFGA 4Z9FA 4GWGA 4NJOA 4PRLA 4RVFA 4A73A 1V35A 4GX5A 3OJEA 3RUAA 1X0XA 3DEYX 1MLDA 5EQFA 3AFNA 3C1AA 4URFA 2ZB7A 3ZV6A 5CDYA 1RM5A 1GYPA 4R51A 3HQ4O 4MVJG 1K6IA 4JLWA 1QMGA 1GY8A 3FD8A 4I5FA 4I9HA 4B8WA 3WS7A 2AQIA 3W6UA 2X0RA 4ZQEA 4ZGWA 2CF6A 4PLGA 5IN5A 2OO5A 4CUZA 3LU1A 1QYWA 3GUYA 4OOFA 2V6FA 3AM5A 4M1QA 2X7HA 5KIAA 3M1LA 1UAYA 1GV0A 2NVBA 4U6SA 4BV8A 9LDBA 1Z74A 2Y93A 3ZN2A 2OGUA 3O4RA 4DGSA 2VUSA 1YE3A 4MOWA 5CG2A 2Q49A 3IUPA 3QWFA 3JQAA 4YJHA 4DTIA 1A71A 2PKRA 1H6CA 1ZH8A 3TJRA 4J7UA 1ZKMA 4ONEA 4WLFA 1RKXA 3F4BA 3DMTC 3NT2A 2PA3A 4H7PA 5AVOA 2GERA 5C7LO 3UXYA 1G0OA 1WDMA 3C7AA 1U9JA 3DZFA 3L9XA 2PWZA 4W4TA 3WX0A 2H63A 4JCOA 5JPIA 2IYOA 4CV3A 4J4TA 1GTMA 3LVFO 4RO0A 3ZHXA 3BYZA 3DHYA 4E21A 1KBZA 5A02A 1V6AA 4QECA 4ZJUA 3GZNB 2YFHA 4CM9A 4DRYA 5L53A 3O8QB 4XRGA 2JD1A 3V2HA 2X22A 3VZQA 4YPOA 3GFGA 1EQUA 1MC5A 1Q7CA 2RIRA 3BHJA 2H6EA 4Z9XA 4TRMA 3OETA 3AOEC 2Q46A 2X0JA 3U0BA 4W7IA 1OC4A 1VJTA 3EUWA 3GQVA 4FOOA 4RVUA 7MDHA 4WLEA 2C82A 4BKRA 4BIIA 4FOSA 3BTSA 1H94A 3IQDB 3OICA 4E31A 2D3TA 2XPCA 1UDBA 4YJFB 4XYGA 4AJNA 3ZU3A 4UUMA 2W2KB 3GY0A 1ZUD1 2UUOA 2VZ9A 1HYGA 1MXFA 4GGOA 1ZK3A 5EPOA 4QEDA 4E2XA 1WPQA 4WEOA 3H9JA 4R1TA 4BNMA 2D2IA 3JQGB 4II2A 1DB3A 3PVZA 4H15A 1PGPA 3JQFA 3CINA 5CHEA 3EVNA 1BDMA 1BRMA 3JQ7B 2Z1NA 4FFPA 4FCCA 4FJ2A 4PLHA 3VH2A 5JE8A 4E2YA 1LA2A 4KQWA 4R9SA 2FHSA 3IIEA 5KVQA 2RBEA 4TWRA 3BZUA 2G5CA 2G0TA 3BXXA 1K89A 4G5HA 4YT2A 2PZKA 3W6ZA 5BSFA 1OC2A 2C54A 1B16A 1N9GB 1XCBA 4GI2A 3GRKA 3PTZA 2VN8A 3I4FA 2AG8A 5AXDA 4AL4A 1PX0A 3V1YA 2NACA 1JA9A 2UVDA 4IXTA 4R01A 1S7CA 1D3AA 1B7GO 4RLSA 3MWDB 1NFQA 5CP8A 4L9RA 2YDYA 4DYDA 4TVOA 3GUCA 3JD2A 5ICMA 1JDJA 2B4TO 3U5TA 3NKLA 2BKAA 2PKQP 4NU5A 1JWAB 2HO5A 4J9VA 4A10A 3DFZA 4AJHA 4YQYA 5DOVA 2VYNA 4IDGA 4NFYA 4QO7A 4TZKA 4DC0A 2WYVA 1U3WA 4YRDA 1EE2A 2CY0A 3IMFA 4IMPA 5GZ6A 4BGIA 2J5QA 5IAAA 2OFPA 2NU7A 4J4HA 1E1MA 4DPMA 3BMQB 4IDBA 1MUUA 4KDFA 2CNBA 4MVJA 2YYYA 3IKVA 1IB6A 1SCUA 1I3LA 3KETA 2I67A 3ANNA 1AXGA 1KVRA 1Z82A 1E3LA 1YKFA 2E37A 3CTMA 4J9UE 1DC6A 5JAQA 3C1OA 2VZ8A 4MDHA 5DCYA 1GADO 4LMRA 1DIAA 5HA5A 4EBFA 3RAJA 5CDTA 3MJCA 5TRTA 1BDBA 3A4VA 2Y1DA 4E5KA 2V6MA 2C29D 4B4OA 4PLTA 4R3WA 5IDXA 2E4AA 3NT4A 2EG9A 3GC6A 3PFWO 2PV7A 3LC7O 4CLRA 4AJ2A 1WNTA 4YAKA 3K31A 1H5QA 4TZTA 4B8ZA 4PFJA 3PXXA 4IINA 5JO9A 2AW5A 5KKAA 4S1VA 3UKOA 4FN4A 2EGHA 4JIGA 3TDKA 3I9MA 1NWHA 2O3JA 1IULA 1HDCA 4I5DA 2W2LA 4NH4A 1EK5A 1YWGO 1O9BA 2I3GA 2ZB3A 3ZWWA 2VWHA 3IJRA 4AJJA 3RUCA 3BMOB 1VRWA 1DDOA 4MP8A 5L45A 1LDNA 4BKOA 3GN1A 4WECA 2HU2A 2X0IA 1P1HA 4A26A 4KTVE 1GFSA 4IJWA 3ZHYA 1PL7A 2A92A 2WE8A 4XB2A 5KCZA 1F8GA 1HXHA 1WZIA 3OHSX 3OJOA 4A5OA 3NGXA 3KOUA 3WGYA 4UEJA 1YOVA 3VPHA 3GAFA 4BO8A 2QRLA 5HBRA 2VNAA 2QRJA 2CVZA 3GNSA 1X1TA 2NU8A 3F4LA 4AVYA 2JD2A 1UP4A 4JX8A 4Q3BA 1I33A 1NYTA 1PJSA 3I9LA 3OIGA 3FCOA 4Z3DA 2X5OA 4JQCA 3HDQA 4E30A 4FFNA 1KY5A 1VL8A 4IQGA 2D5CA 3E18A 1U7TA 1JKIA 2WE7A 3QVOA 4YT5A 5DNAA 5I8WA 5K9ZA 3JQCA 3G1UA 3PZBA 3NRCA 2CMDA 4ND5A 4PLFA 3WBFA 1JVBA 2Q45A 2YDXA 2O7SA 1TXGA 1E3WB 4J2OA 2VWPA 3ZWOA 4UVIA 5T5QA 3ASVA 1T25A 5BSEA 4E33A 1DJQA 4O6VA 3CZRA 1W8DA 1YONA 3OP4A 1E6WA 1JN0A 1PIWA 1NR7A 3D5TA 3O03A 1P44A 4DIBA 1DHRA 5BSHA 5C5IA 4DLAA 3QVSA 3HB5X 5F1KA 4Y6SA 5ILOA 2VHZA 3DOOA 1DPGA 2DFVA 4PZDA 2PD6A 4DIOA 3DOCA 4KZPA 1KYQA 4MKXA 4CMAA 4E5YA 3NTRA 3NX4A 4MVJE 3SEFA 5G0UA 2WD7A 1B8VA 3ONFA 1E7RA 2HMUA 2Q3EA 2UDPA 1RYEA 3ZNNA 4ALIA 3CKYA 4D45A 3EC7A 1U2DA 1K3TA 4OXYA 2P9GA 4ZHSA 2C20A 5L7WA 2I66A 4AJ1A 2TMDA 2ZTMA 2IDZA 3LLSA 3FR8A 3UAGA 3ANLA 4XYEA 1DRVA 3JQ9C 3LT2A 2UUPA 5TS3A 4CQLA 2FP4A 3PJGA 1QP8A 3MEQA 1C0PA 1TVEA 2V65A 3PHHA 1F12A 1SZJG 1N8KA 1B2LA 3LF1A 1L7EA 3RQSA 2BI7A 3A06A 3OSUA 1QR6A 5BQFA 5TX7A 4FW8A 4WCFB 3KZVA 1RJWA 4GSLA 1B26A 4IGEA 4RORA 1O89A 4E0BA 1ADBA 2I9PA 1GZ3A 3DQPA 1Y7TA 4IIUA 3VVBA 5FI5A 4FC6A 4XDZA 2J3JA 4BNWA 1R4NA 3B1JA 1N5DA 3RUFA 5DCUA 1BXGB 4CODB 2EKQA 1OOEA 1PJCA 4ITUA 3V2GA 3SJUA 1P31A 5JAIA 2QG4A 3R6DA 3PHJA 1R15A 3HZZA 4I1IA 2ZYDA 3BMNA 1DIGA 1FK8A 2WM3A 1GQYA 1LJ8A 4R54A 1FDSA 3ITDA 3M6IA 4CM8A 2DBQA 2DKNA 4PCVA 4TRRA 3PJEA 1UXHA 2E48A 5DZSA 3KYCA 1HE3A 2NADA 2DTXA 2P2SA 5GY7A 4B3HA 1ZO8A 4XZ3A 2A94A 1CRWG 1WDLA 3FNHA 4QT0A 3GAZA 3D64A 4Q39A 5EERA 3PJDA 3PWKA 3K2BA 2C5AA 1ENOA 4OXKA 2D8AA 4CLOB 1SBYA 5IJZA 4HFRA 3GEMA 3ZNQA 2ZB4A 1NX6A 5LC1A 4RVHA 1FXSA 3DBRA 4DYVA 1O94A 1UP6A 1H9AA 5DOZA 2Q2WA 3GZ4A 4K1LA 5U4QA 2B5WA 3AI3A 5A9SB 3DBHA 3UCXA 4E2ZA 3HDJA 2OORA 1E77A 4NBWA 4TSKA 1ZEJA 4OKNA 2Y67A 5ITWA 4EEZA 1Q7BA 1W0CA 3BIOA 4RLHA 4QFCA 1UUFA 1ULSA 4YEDA 2FMUA 5B37A 3TN7A 1SAYA 2V7PA 3ZCXA 1CQIA 2VYVA 1OI7A 4MKZA 4PVDA 1PEDA 1GAEO 1UXIA 4WKGA 2HJSA 2VTDA 2YY7A 3U62A 1PJLA 1LDEA 1EDZA 4DLBA 3E8XA 4PG7A 5JYDA 3IKTA 3ZH2A 2RAFA 2YQ5A 1VC2A 4IBOA 5JCJA 3C24A 2D4AA 2Y0DA 2EHDA 3QA9A 2BD0A 2GR9A 3BHMA 3I4CA 4LCJA 1HWYA 4YTEA 3KSZO 3GR6A 3HHPA 4BNXA 4IUYA 4CMIB 4J1SA 2DPHA 2I65A 3IAHA 1HEUA 3WJ7A 2G1UA 3SC6A 4NFSA 2HJRA 1JW9B 1FDUA 2BFAA 2DT5A 4ZRMA 1PS9A 4S3MA 3S2EA 3QWHA 4XYLA 4GKBA 1E3JA 4YBZA 4RPKA 2Q50A 5I9NA 1JAYA 3I83A 3ORFA 4B79A 1ZVMA 1A5ZA 3WIEA 1RYDA 3HB4X 3N74A 4HP8A 2VTEA 1R16A 3Q11A 5K1SA 2J3IA 4KUEA 1Q7GA 4U7WA 1GEGA 1XG5A 1PGNA 1SC6A 2BFMA 3GDOA 2YV3A 1TLTA 2F1KA 3AK4A 5I7SA 5L3ZA 1NAHA 3S2IA 1ZNQO 3GVIA 3JV7A 1PJ3A 2CFCA 1LLUA 1YJ8A 1D7OA 4A03A 1T1SA 2ZATA 2H1SA 3LZ6A 4RF3A 4M55A 3OJFA 3Q9NA 3RUDA 4IGFA 5IZCC 3WGOA 1UZMA 3D3WB 1A7AA 2VRCD 3G17A 4XGIA 4GX0A 1TB4A 2RCYA 1T4BA 2PGJA 5FEUA 2WYUA 3MJVA 2YW9A 4IS2A 3PZRA 1NASA 4MP6A 4D42A 4PG8A 4TRJA 1WVGA 2VUUA 2ZQZA 1PQPA 2X9GA 1R12A 3MJSA 1DLIA 3P7MA 1DFHA 2IEDA 5HS6A 2C7GA 4N5NA 2CDAA 3AY7A 2F00A 3BTOA 5DF1A 3QQPA 3PPIA 1BXKA 3HFSA 4D79A 3OJLA 5ENVA 3DONA 4FPXA 4EITA 1PWXA 3KLMX 1GU7A 1BXZA 3TQHA 3O26A 4OSPA 5B12A 1LRLA 1X1EA 5DBIA 4IZHA 1RM4A 3FSRA 2O4CA 4OOEA 4YT4A 3UN1A 1T2AA 5ADHA 4BMNA 3ZHBA 4PLYA 5IF3A 1A7KA 3GEDA 3HWRA 5L7TA 2HDHA 4H16A 1DIRA 3ZDFA 3ICPA 4X54A 4K28A 2BGLA 2HUNA 4HX5A 3I1JA 1HTBA 1KC1A 3RASA 5T8KA 4OKIA 4XDYA 1T24A 2P91A 4BNJA 5J23A 2B5VA 1A27A 1CERA 4WCFC 3K92A 5G4KB 1NPTO 4IIVA 2OOSA 3SC4A 1PWZA 2O7QA 4XQEA 4XQCA 1XU9A 1QORA 4GLOA 1H6BA 1JTVA 2BLLA 4IY1A 2H9IA 1M6WA 1Q0HA 2GD1O 2FWMX 3EK2A 2GRAA 3P2YA 4MVJI 1N1GA 1XSEA 3AUTA 5K6AC 1E1NA 2DQ4A 2VWGA 4N54A 1LC3A 2NQ8A 1W4ZA 4R16A 3U49A 1SEPA 4TROA 1X13A 1LX6A 4ALLA 1CEQA 3I9NA 4D46A 1P1JA 4XD2A 5JC1A 4R5HA 1C1DB 4J16A 1E7YA 2EJWA 3GVXA 4NZ9A 2JCVA 3CUKA 1ZXBA 4C7JA 5THQA 1YBVA 4B7UA 4GX2A 3ZW9A 2AEFA 1E6UA 4EJ6A 1DRUA 1HDGO 3PGXA 2JKVA 3H65A 2YHUA 2ET6A 2G82A 3ETGA 4J4BA 1P74A 1A72A 1GCUA 1P1IA 4R5MA 1ZK1A 5F1OA 3E5RA 1BWSA 2O3RA 4YVFA 4JBGA 1LC0A 4XA8A 1KEWA 4ALMA 1PTJA 1V3TA 5FWNA 5G0WA 1BMDA 3QW2A 1J49A 2Q1UA 4OXNA 1V3VA 4MPDA 5HRUA 2EP7A 4RVGA 2C07A 2FPPA 2PGLA 5L4SA 3DBLB 1EMDA 3DAFA 3G1TA 1KETA 2QRKA 4EW6A 3AI2A 3WFJA 3AW9A 3TZCA 4MKRA 3WB9A 3ZWVA 5L40A 4OQZA 4J7XA 4FFOA 2BI8A 2BHLA 2YUTA 2PD3A 4BNZA 3A1NA 5CDGA 1NHWA 4A0SA 4LCEA 4Z9YA 1I0ZA 1BSVA 1YO6A 3ZWCA 3TL3A 4CLEA 5G4LA 1TT7A 1DO8A 1U28A 2AG5A 1I32A 2NWQA 3QWBA 1MG5A 3WWZA 1WZEA 2WMDA 4GQAA 1VKNA 2FR0A 4ALNA 1M6HA 3RKUA 3GK3A 4B4VA 4K6CA 2AA3A 4W6ZA 4O5OA 2FY8A 4N7RA 5DT9A 3Q1LA 3KXDA 1KEPA 5HS4A 1U8XX 1GPDG 1XHLA 1NNUA 1P0CA 3HG7A 5GMOA 5TGDA 3CPSA 4RZIA 4BGVA 4YWJA 2VUTA 3Q2IA 2WSBA 1I2BA 2GO1A 1DOHA 4DLLA 2FZWA 1Y8QB 4NJMA 3GH3A 4WK6A 4XEHA 4XKJA 1YDEA 1EQ2A 5I9MA 4BOYA 4Z6KA 4I9UA 3C85A 3EGOA 3ZV3A 4FFLA 4WGGA 3AU9A 4DIFA 2DBZA 1O0SA 1XWFA 1H0KA 3OIDA 4CM4A 3RC1A 4PG6A 2D0IA 4LGVA 1V9LA 1R4MB 3ON5A 3F3SA 4LK3A 1J0XO 2JAHA 2Y05A 4R4JA 2E82A 1PJTA 4AFNA 2X0NA 4J1QA 4DPLA 2YFQA 1ZBQA 1CJCA 2JL1A 1I2CA 1ZK0A 1UJMA 1YVEI 3MTJA 3DAGA 4BNNA 4J0FA 1HF3A 1MV8A 2BF7A 2OHXA 4JXKA 4RF2A 1OFGA 5JC8A 1KERA 2ZCUA 4HKTA 1E7SA 3D5QA 1J4AA 1HDRA 4CQMB 3ZWNA 1YB4A 2HMTA 3IDSA 2B36A 1P9LA 3EDMA 2O3QA 3C1TA 2RHRA 3W4IA 2JHFA 4KTTE 3TZKA 3VDRA 1Q0QA 2AE2A 1QKIA 1J5PA 3CH6A 1MXHA 2PK3A 2J3HA 1AHHA 3D4NA 3GT0A 4DMMA 1JLLA 2NLOA 1EK6A 2PTGA 4BNUA 1NVTA 4R1SA 2O3TA 4BHTA 3GMDA 4UVHA 3KEOA 2DFDA 4HV4A 1C14A 5TT0A 3WGHA 4AJ4A 1LNQA 4D41A 4XB1A 1DBVO 1K0UA 3QVXA 3ROPA 3H5NA 1YL7A 2C5EA 3JQ6A 4W9NC 4L4XA 4PZCA 2ZTVA 2B35A 1ONPA 1VJ1A 2EF1A 8LDHA 2ZTLA 4BO3A 4GH5A 2UAGA 4OM8A 4JP2A 4EUFA 3F47A 1HSZA 3T7EA 4N5LA 4F6LA 4A7PA 1F0YA 1V3UA 3INRA 4JJGA 5GZ3A 3FNEA 1DJNA 3WSWA 2AQ8A 3JQAD 3LSYA 3MOGA 4GBJA 3LT1A 1XGKA 4LVUA 1QLJA 1DIBA 1VSUA 4BNIA 1FDVA 3HNPA 3DXFA 3PYMA 3PYLA 1YQDA 9LDTA 3QVWA 1WLYA 2HK9A 3KBOA 3QY9A 1LQTA 3R0IA 4XGNA 5JNLA 3V1TC 3BMCA 4UEKA 2X5KO 4J7CA 5F21A 2AXQA 2EJVA 2IODA 4BB6A 3GF4A 3OQ1A 3UOGA 1HE4A 3AUUA 4P38A 1FJHA 1X14A 4ALKA 4CM9D 1PS0A 2NSDA 3VHRA 1E3IA 4WE3A 5EJ2A 4XR9A 4CMBA 5G0VA 2OP1A 4DBVO 4N5MA 1I3NA 1X0VA 4EYEA 2DUWA 3OQ6A 1NHGA 3U4IA 4HBGA 4KQXA 4PG4A 2WTBA 2NU6A 3DO5A 5U9CA 1VKOA 5AQ1A 3TF5A 3KB6A 3VOSA 4WASA 1EFKA 2NUAA 1B14A 2PH5A 5ER9A 1BG6A 4PZEA 4Z3KA 1PJBA 4H3VA 6LDHA 1SEVA 1TT5B 2FR1A 1BTOA 1I01A 3TZHA 1WDKA 1XLTA 2FPIA 4TQGA 3OEYA 4P22A 3JSAA 3KO8A 3DMTA 5FYDA 1KEVA 3JD4A 2D5AA 5F1PA 1AN9A 2SCUA 4FSHA 4F6CA 1NXQA 4WPGA 2DUUA 5TSDA 4CLXA 3RWBA 2J5RA 4CUKA 1ISJA 1YDWA 4Z0PA 1IZ0A 3D4PA 3E9QA 3QLJA 5TJ9A 4CLHA 3QE3A 3X2EA 3QSGA 5CFZA 4GX1A 3DOJA 3W8FA 1MX3A 3B6ZA 1YBAA 4L75A 2UV8A 4OJNA 4BV9A 5JS6A 4BGEA 4QQRA 3TSCA 2WWRA 1ZMOA 4N18A 2GF2A 1C1XA 3RD5A 4LRTB 3KYDA 4QUKA 4A27A 1ZIDA 5A3JA 2X5JO 4IQ8A 4IS3A 2QZZA 4BNFA 1ADCA 1D8AA 3AOEA 3DMYA 3LT0A 4C7KA 4ZVVA 3LC1O 1TA4A 4ZU3A 2YJZA 4CR6A 2VHVA 1YS4A 1NVGA 2OMEA 4ND2A 2EP5A 4DXHA 3KLPX 1X7HA 3T4EA 5CDUA 1I10A 2VYND 5TF4A 1BW9A 1ISMA 5C7OO 3NJ4A 1YB1A 4HXYA 1HETA 1EFLA 2NM0A 3ZU5A 2IYPA 1GPJA 1D4FA 1ENPA 3B20A 3NTQA 3W4KA 2FSSA 3PP8A 1EBUA 1ARZA 1K5HA 4W9NA 1IZ9A 3WTBA 4IPTA 4RL6A 3RCBA 5FF9A 4MVJD 4JNKA 1NVMB 4BL5A 3WGTA 3L77A 3K2EA 1PS8A 1CF2O 1T1RA 4BNTA 4RF5A 3EHEA 1YXMA 1ISFA 4BMVA 2HK8A 4NG5A 1C0KA 1Y8RA 2Z1MA 1DIHA 3AJRA 1PGOA 1QV6A 2J5KA 4ZRNA 5HTOA 2ZJ0A 4Y9DA 1KVTA 5KNLA 2W90A 4D3FA 3Q0EA 5I8ZA 1NQ5A 1QYDA 1WWKA 1CYDA 3K30A 4RCVA 4J0EA 1GUFA 4PVCA 4Z0HO 4W99A 2HMVA 3V5NA 4WNIA 3WOHA 3SJ7A 4F3YA 4GGPA 1UDCA 2NVUB 5COAA 4RVDA 1PQWA 1HT0A 2HLPA 3KM0A 4NBUA 4NBVA 2A35A 2C7VA 3RBZA 1F8FA 4U0KA 3ZZNA 1C0LA 3H7AA 3H9UA 4PN3A 2EXXA 1KEUA 2YHIB 1O8CA 3GGPA 4GL4A 4HFNA 4BQRA 1I3KA 5EL0A 1R0SA 1DEHA 1EUZA 1J6UA 4C4OA 4YRAA 3GVPA 3OF2A 4XIYA 4KP7A 3ZWBA 1UH5A 2FR8A 3GGOA 5F5NA 3ZU4A 5IDYA 2V6BA 1Y5RA 1JWBB 2DAPA 4QSMA 1T2CA 5A3VA 5ENDA 5CPBA 2QX7A 2XXBA 3VKUA 4YRBA 3GMSA 4JBIA 1E1LA 3DTTA 3FR7A 4L73A 2B4QA 3VH1A 3SBOA 4BQPA 2VHWA 4ID9A 3INTA 5EESA 3ZWXA 3E6AA 3JQ8A 4RZHA 1VL0A 3SX2A 1HDXA 4YJGA 3MTGA 1A4IA 4U6QA 3CE6A 3EVTA 4RJTA 5I9LA 1HRDA 3FTPA 4LW8A 2VHYA 5JDIC 1LSSA 3I6QA 3RIHA 3B70A 3DWFA 1B3RA 4PLZA 4WJZA 1P1FA 4WOJA 5AXBA 4CM5A 4IM7A 1GEEA 1KIFA 1HZJA 1IOLA 4HUJA 3WGGA 4ESOA 4YJHB 3JQAB 3DZBA 2Q2QA 1IPEA 3CXRA 3ENNA 4HNHA 4OH1A 2HMWA 3RSHA 4XX0A 1N1EA 3ROMA 2LDXA 1JAXA 4OMUA 3WFIA 4XYMA 5T67A 4U8GA 3OH8A 3TNLA 2HCTA 5IG2A 2VRBA 3L9WA 3PWSA 1LRKA 4IQ0A 2P4QA 4UREA 3ADOA 3H8VA 1H6AA 1DC5A 4G81A 2NV6A 4IDAA 3HN2A 2EV9A 4KOAA 5EN4A 4ZICA 4PLWA 1FDTA 4BO7A 2GN8A 2NU9A 3VZRA 3I9JA 4MIOA 5MGBA 3L4BC 3JCZA 3SLKA 2VQ3A 1DHTA 3DZKA 3QWAA 5L9AA 3JD0A 2JFHA 1SNYA 1M76A 2NNLD 3IOYA 3U9LA 4OIMA 4QTZA 3UHAA 5JLAA 5KJCA 4Q3AA 3KV3O 3M2PA 2X58A 4QO8A 4E3ZA 4UUOA 5KVCA 1H6DA 2VT2A 3ZI0A 5T57A 5KOIA 4CV0A 3VTZA 4LISA 4OHUA 2W4QA 3VZSA 3P2OA 3BA1A 3ZNOA 1R0KA 5BR7A 3R1IA 1ZSYA 3JYPA 2W98A 2VZ0A 3GZNA 4M49A 4UULA 1U1IA 3WMXA 3O8QA 1WMBA 5EINA 3JYOA 1LXCA 3D4OA 1LSJA 3WGQA 2HKIA 1HDZA 5EQDA 1MFZA 1SOVA 3EZLA 3QIVA 2C2XA 1MGOA 5DP1A 3NUGA 1EUDA 4OAQA 3AY6A 2Y1EA 3BAZA 5A5EA 5JY6A 1JU9A 1G6KA 5CDSA 4PIVA 4QFDA 8ADHA 4YJFA 5A1TA 3K9QO 1LTHR 3GVCA 1ID1A 1M67A 2BGKA 2X1HA 2O3SA 3ENKA 2W2KA 3L4SO 3JYNA 5B4VA 2OP0A 4L4SA 4FB5A 4D0SA 1U7HA 3JQGA 3JQ9A 4AJEA 4B4UA 3SVTA 1SO8A 1MG0A 1I2ZA 4U5QA 4CMEC 2DM6A 3ROQA 1XIVA 5COBA 3IUSA 3JQ7A 4IDEA 3STHA 1M2WA 2X6TA 1DSSG 1LU9A 2FZEA 2P68A 4Y8VA 3VTFA 4RQTA 1LDMA 1XKQA 4XCVA 2GSDA 1QXSA 3GHYA 4P8RA 1W73A 3VAZA 1ZMTA 4JGBA 3JD3A 4J90A 2YV2A 1NTOA 2ZJ1A 4L8VA 4PGFA 2CVOA 2YZ7A 4ZD6A 2WYWA 2AQKA 4EDFA 4CQMD 1GV1A 2HAEA 2Y1OA 1N9GA 2JCXA 5C37A 2OBYA 3NEPX 5JCXA 1AXEA 5H83A 3MCVA 4ZN6A 3PQDA 2VT3A 1PSDA 3EAGA 2IEBA 1GD1O 4GMGA 1U5CA 1XYGA 2EKLA 1Z75A 1DXYA 2DTEA 3IS3A 4YJDA 3GNTA 5I7FA 3ZWAA 3UGKA 2CDCA 3DBVO 3DZHA 2B0JA 2HMSA 4FGWA 1CWUA 2VYVD 1F06A 4J49A 4FIZA 4E5MA 4YAJA 1VSVA 1E1KA 3B1FA 1R0LA 2WEKA 1KVQA 2ZCVA 2QHXA 2JJYA 3RC7A 4EEXA 3BMQA 4CM3A 3EW7A 5JCJD 3U09A 2NQTA 5TT1A 4II3A 4CLRB 5JYEA 4AICA 4YXFA 2J3KA 1P0FA 2VOJA 1E7QA 3VVCA 3E9MA 1T2FA 3H5RA 2GN4A 3PIIA 2IZZA 5AYVA 4FS3A 3ONEA 1DC3A 3OMLA 3HUDA 1ML3A 4NPCA 2C59A 2AHRA 2BH9A 5B4UA 3H2ZA 4GVXA 4G65A 3O9ZA 4YAIA 1R66A 3N58A 5T6BA 3C7CB 3AUSA 4K26A 1YL6A 5IDWA 3S2FA 1LEHA 1PR3A 2EEZA 3NDIA 3ABIA 1ZFNA 2POQX 4XGKA 5DP2A 3WIDA 1RM0A 4CM1A 2ZQYA 4D3DA 1YOVB 3E48A 3AFMA 1SB9A 4CMHA 1LLCA 1D1TA 2OUIA 1Z73A 1EVZA 3GOHA 3WWYA 2R00C 4W82A 1WW8A 3WQQA 4BNLA 4J1TA 3BMOA 4JBHA 1TI7A 5U1PA 2HK7A 3IP3A 3ADPA 5A04A 4IJUA 4GKVA 3PQFA 2PZJA 3KYBA 1ZXLA 3NDJA 1HKUA 4NNJA 4Y67A 3WICA 4DUPA 1ZW1A 3RI3A 4Z0TA 4J1NA 3KTDA 3CMCO 1I5RA 4EJMA 3RJ5A 3EY4A 2JHGA 3QP9A 1RM3A 1I30A 4P4NA 1VE9A 3C8MA 4KWHA 4OSOA 1ONNA 3PLNA 3JD1A 2UYYA 3WMWA 1WP4A 5IDQA 2GN6A 2QYSA 2V6GA 2WJPA 4NI5A 5F5LA 4EJ0A 3RFXA 5TIIA 3UFXA 3LQFA 1DC4A 1G0NA 3KHUA 1A4UA 4LMPA 4DQXA 3NT5A 3IJPA 1GQ2A 2PKQO 4BNGA 2Y1CA 3H3FA 4UUPA 5AOVA 2W8ZA 4MIYA 1FMCA 4MVJF 4JP3A 2VCYA 1O6ZA 3VPFA 4B4WA 3KEQA 4ND1A 2WD8A 3NAQA 1E3WA 1GYRA 1VL6A 3VC7A 4JJIA 4LSWA 1QV7A 2WD7B 3GHHA 3MZ0A 3D1LA 4F45A 3L6OO 4UAGA 1KC3A 1K2WA 2I3AA 3F6YA 3GG9A 5IZCA 2PZLA 3ICCA 4CL8A 3OA0A 1HL3A 3FNGA 4K6FA 3HE3A 3ZU2A 1B3BA 3AM4A 4YDRA 1P77A 3ETEA 2HSDA 1UXJA 4RPGA 2QZ9A 5I7EA 3UCFA 4CQLB 3P5SA 2GASA 1E92A 1P33A 2XF8A 1A9YA 3VPSA 1XA0A 2CZCA 5IXSA 5TLSA 3CMMA 4CUJA 2VNSA 3K73O 3AI1A 1Q1NA 3G49A 4D43A 1ZSNA 7ADHA 1I8TA 1ZSVA 4HFJA 4FFRA
chains in the Genus database with same CATH superfamily
3P97A 2X6RA 2FG6C 2QM3A 3OTHA 2IPXA 4KVGA 2Q1YA 2OD7A 1CF9A 4CMGA 2WTNA 1OA0A 1PR1A 1AO3A 1U1EA 4PLCA 2IV7A 3AJ9A 3A04A 1NN1A 3D6UA 4PSAA 2EQ5A 3DLTA 3TQSA 2VP5A 3P4XA 4EG6A 1CR2A 5KWJA 3IMEA 2OXCA 4MJ3A 2LCFA 2XVAA 3U7IA 5D3MA 1OV4A 4ALJA 1JSCA 3HSKA 2PA0A 4IZIA 5FPHA 1HE5A 3L06A 4C0QC 3QVVA 4D0NA 1PR9A 3BMNB 4Z86A 4E1BA 1AKTA 2JD0A 3OHMA 1US8B 3NEYA 2IE0A 2WKRA 3KR9A 1LNZA 1Z3IX 2FOIA 4WN9A 4DJJA 4EYKA 3H0EA 4J2HA 4O59O 1SWVA 1WXXA 3KYCB 4K6KA 3WV5A 3GEHA 2XOXA 2VEOA 1KDYA 1KE2A 1QYVA 1UFOA 3FPCA 4LDAA 1YRYE 1Z9BA 2WG2A 5F52A 3ZCTA 1MIHA 1BXGA 3ZDXB 5FBVB 3IP9A 5HUJA 3BK2A 3J81A 1YVPA 1IE3A 3ACBA 3CRRA 5DDIP 1E64A 4RY9A 3UGTA 2OAQ1 3DHVA 4YMGA 4AZ0B 4LFAB 2VPPA 5JAZA 3GLFB 2FWPA 4UUNA 4MQFA 2H31A 5CIYA 1NVAA 3KKNA 2CXTA 2R1VB 3SOZA 5IN4A 4CLDA 1RADA 3DBRB 4Y2TA 2VK2A 1AGNA 5DHRA 4ZQIA 4JSYA 4NU0A 3KOYA 4GVLA 2COEA 4XJSA 3SQLA 1QSGA 2CYAA 1V26A 2NXNA 4X85A 4LYJA 4UXHA 3STWA 1VM6A 3BWVA 1G64A 1W46A 1WPXA 4OEHA 1JFSA 4MCAA 1ANKA 2CJPA 4KU4A 2BCJQ 5CCEA 2BKVA 2AN9A 3FLEA 1RYMA 5K3AA 4LOAA 1KNXA 3G5LA 3WYEA 4XH9B 3NTOA 1W9HA 5CH5A 4XLTA 3DEJA 2WHXA 1U8TA 1N0VC 3I23A 3TFOA 2UYHA 1HSOA 1S3SA 3MLBA 1BDJA 3HSSA 3W9YA 5JUWA 3IT1A 2PMWB 4OCZA 4I08A 2ONJA 4MSUA 1XI2A 3FCYA 1E2HA 5I9TA 4GPBA 3ZY4A 3LPLA 1AMOA 4KZKA 3UPDA 3JQQA 3ZW8A 2CL7X 1AB6A 2H9YA 2H5LA 5JRDS 2IWHA 3OJWA 3Q12A 5B64A 4N3CA 3ZXXA 1RQLA 1OAAA 3IB3A 1S89A 2X8LA 2P9YA 3PIDA 3UUWA 2JFYA 1XVIA 5CA0A 1BWPA 2P9EA 3TSAA 4ZA2A 3G9XA 3RJ9A 4HLUA 4BNYA 3I2KA 3K9WA 1RFLA 3GRPA 4K9KA 5E2IA 4NCHA 2C9OA 4NCXA 1X92A 1BU8A 1LFAA 4KN9S 3WNQA 3G2MA 1PHRA 2IP4A 3B2QA 3K9CA 1MVNA 2EWMA 2OILA 3PC8C 3O8BA 2QRPA 1W5AA 4RVSA 4XFJA 5EIOA 1BN6A 4EB6B 3ZDZB 5HK9A 1CTQA 2J4FA 1WNFA 2RGNA 3FRJA 4Q3CA 1L4NA 2CDNA 2QXUA 4UVGA 4NESA 3MERA 1U7XA 3ABRB 3ICVA 4TRNA 2O8DA 3D7NA 1BGWA 3DV2A 3QBTA 4JZYA 2EZ4A 3DULA 3WYFA 2REQB 3QEMA 2PT9A 3CLUC 4JLOA 4UM9B 3AYZB 2AHOA 4R0NA 4K81B 1CVLA 5DN6D 2AFIB 2WP0A 4L57A 3BGSA 2A9JA 3IAS6 3MMZA 4FHDA 3G0CA 4YBRA 3VPGA 4RV9A 3GEGA 4TXMA 1RKVA 4W5JA 3CRW1 4ZXPA 1UZLA 2CSUA 1NBMA 2K2QB 2W2QA 1HQYE 3LUBA 3BFKA 3MT0A 4FDAA 3EZNA 3K8ZA 3LGSA 2H29A 3JYQA 4HADA 3ZGNA 1QG6A 3DFUA 1U99A 3EGVA 5LFAA 3HCOA 4FMCB 2BJHA 3I3OA 1QE3A 3V8QA 4F5EA 4Z2YA 1ZMXA 3ASUA 1RHQA 1LWNA 4BU1A 4BQNA 1DCKA 3FHOA 4MW9A 2H18A 4MWEA 1ULAA 4KXFB 1YNOA 1OQAA 3SYKA 2FOLA 3PXAA 3A6GA 1JG4A 4DM7A 3PD1A 2WVAA 3OAAD 1YZLA 3NRJA 2DR0A 4RSGA 2QORA 3LYLA 1NJ5A 1YQUA 3S7TA 4LXQA 1RKUA 2RONA 1CUYA 2WU1A 4E32A 2E4XA 5L7YA 3T38A 3D3WA 5IW8A 4WX2B 2NUPB 3K3PA 4BFCA 4ZYUA 3FTNA 1XF9A 1AZLA 4G4JA 2CLLB 2VJBA 4TKLA 2J8ZA 5DPMA 5ITSA 2D6FA 1NQAO 2KHZA 4XQ9A 5IUKC 4QLBA 3RNLA 4OBWA 3L7DA 2OYCA 2JFFA 4EJSB 1Y33E 2XXAB 3MF4A 2WU3A 3A1CA 2W6ID 5FULA 3DAOA 1Q1EA 4RY0A 5CM8B 1W5TA 3PFBA 1H2RS 2EJCA 4G0OA 4LMBA 5THKA 3RT9A 4JV5B 3CLTC 4FDUA 4AJIA 3DLIA 5KVVA 1XZBA 1ENZA 2IDJA 1X7XB 2GB4A 5JALA 4AJPA 3EXG1 3CG4A 4DREA 2LRHA 4MEJA 1C81A 2QUBA 3AUXA 4NAVA 4EUHA 1EK2A 2CEAA 2B2NA 2F62A 4K0RA 2FEMA 3CZ5A 4WCVA 4DA9A 3HXKA 5HRCA 4ZI7F 3RU9A 4HGNA 3DDHA 2I0FA 1XRSB 3KQMA 1XTKA 3HUUA 3OF3A 4JFRA 1TJ4A 2I4RA 1N6KA 3FYDA 3HKDA 2GYVA 2WC1A 2X13A 1B76A 4KV9A 1YVRA 2DBRA 3E0XA 4OAOA 5IK2A 3ZWMA 2GLXA 2AF3C 4FHGA 5K5EA 2GDZA 3R0QA 3GJ3A 1DXOA 3KKPA 1Y81A 2VBCA 5AK0A 3AT1A 5DFAA 1ABBA 4Z4FA 5AVYA 3IUYA 1DRKA 3CLVA 3PQ3A 4RXTA 2BDUA 3UMSA 4YNBA 1VOTA 2WTMA 1ISGA 4BEVA 2F43A 5A1JA 5KTPA 4MYSA 4INAA 3X0DA 3VR2D 3ZKWA 3ZDYB 2BHSA 3TO5A 4DLXA 2AFHA 3DXXA 3A9RA 2A86A 2Q1TA 2GBCA 3QBJA 4FFBA 3BRQA 3WO1A 3AG6A 4XSHA 1NQUA 3T7JA 3C3BA 1I4DD 1X1SA 1OLUA 3BD9A 3FA2A 3L4EA 4HZGA 3W0LB 3NVDA 2OCLA 4LOKA 5BNTA 1CDEA 1UBKS 4KFUA 4Q1VA 1V3QE 2FGJA 1NT4A 1KH2A 5FL7A 4DCOA 221PA 4ETMA 1XZLA 1V1MB 3PWZA 2OCGA 5IC6A 3TB6A 3VX3A 1HYQA 4HC4A 1UBTS 3Q3VA 2Q1SA 4NEHB 4YAEA 3BVPA 3EGDA 1N7HA 2IKSA 3PX3A 1NXSA 1NVXQ 2J5XA 4FZJA 2HHJA 1O94C 2R4TA 4CFSA 5A06A 2NVOA 4W8HA 4LY9A 4I55F 1QG0A 5ALMA 3I52A 1LGYA 1U65A 2C00A 4HEA6 4D0GA 2OORC 3PPWA 4BJ1A 4E5DA 3KPVA 5DULA 4RS4A 1OMOA 2WHYA 1GRCA 4D9GA 1W1WA 4XR4A 4AF6A 4DYHA 3TIGA 4EGSA 6REQB 4MP3A 4GM4A 3HKEB 2QYOA 2ATVA 4JT9A 1N2CB 3RRYA 3S1AB 2DU8A 4N0DA 2UZ4A 2IW1A 1GGEA 1ISIA 2FHPA 1L8LA 5ECDA 4EPTA 3G8YA 2IYYA 3GDGA 5CD1A 3OIVA 4PYJA 4I66A 5DT2A 3LBYA 5E1MA 2HFJA 1Z6ZA 2FUCA 4N3AA 5GGXA 2HTFA 3NHJA 4KLRA 3BXHA 2Q6LA 3GG2A 3RK0A 3ST7A 5JROA 3AO0B 4CIAA 1AD2A 2UYOA 1KXZA 3LIIA 4DDWA 1O6FA 1Q84A 2XAAA 2CCGA 4LBVA 3RVPA 4A0FA 3QFFA 1HLPA 2PWAA 1NF9A 4Z4EA 1EFPB 5KYXA 1GTL1 3DP9A 4P54A 4C2BA 4DJAA 1B23P 1DJMA 5KVSA 3DBLA 4BV3A 4EFLA 1KQNA 4EKYA 2V54A 1JSXA 5BOSB 2HGSA 1WZUA 2FFBA 1ZJZA 2OD2A 1Y1SA 4Q1BA 4ZXFA 2V55B 5LP6A 1QX3A 3RUEA 3VDXA 1A8IA 2PJRA 4LN1A 4EIWA 3HJAA 2PX6A 3ZJYA 3S55A 3O47A 4C76A 2WHRA 1SZCA 3Q9UA 4EPVA 3V4ZA 2ZTHA 1L7DA 4AKTA 1ZVKA 1I1HA 4NECA 1SPBS 4PC7A 3EPJA 3EG5A 1K98A 4ASUD 1EE9A 4CI9A 4R1LA 3LLVA 4NJMB 4D9JA 4IVQA 4TYQA 1P4GA 1L5WA 2C99A 5BV0A 4RDHA 2VPZA 2AK2A 3K20A 2BHNA 3CC8A 2BR3A 1SVKA 4N12A 1ISPA 3HADA 1TGVA 4EZBA 5BNFA 4G0ZA 2PWPA 1CZOA 4I2VA 4K6HA 1N0IA 1N7JA 4ICIA 3QYPA 5TPWB 1QU3A 4MVJP 2QP9X 2C9ZA 3HDYA 3KTOA 4PGAA 5J1TB 4W1RA 1VI5A 5EIBD 2R11A 1E5VA 4C0KA 3SDSA 1NW9B 2XNSA 3C7KA 3LOUA 1EUYA 1INLA 3KUKA 5HZHA 3I61A 5EMJA 3AU8A 2QXYA 4P7BA 1JE0A 1BOOA 3BD6A 4KQIA 3AL2A 1J22A 1JT2A 2A6PA 3KTFA 4UHDA 2Y0CA 4I4TF 2BF4A 3W1VA 4AT1A 4EVRA 5MFPA 2VF8A 4X97A 3D6JA 1PZHA 2JGKA 2QSYA 3A36A 4QVGA 4IIGA 2CHEA 3K70C 3UMBA 4BPBA 2Z5LA 3HUEA 1TIPA 2BFDA 3P45A 5A9TA 2NUTA 4F93B 4TTQA 1H4VB 3ZDEA 2E1PA 2BHRA 4UHFA 2B7CA 3VNVA 1E58A 3ER6A 4MV4A 1KI8A 3BAFA 3S1LA 5IAGA 3S8MA 2CNWD 1BE0A 4O2RA 1J0EA 2NPOA 1PQUA 4MLCA 1WVIA 5DBGA 1ZJYA 4OBBA 3WGLA 1UPTA 4MQEA 3TGWA 1FDWA 5BSGA 3ROEA 2VPXA 1J00A 5KU7A 4DA4A 2DH5A 2IDMA 1GKYA 1JEQB 3G8BA 4MWDA 4ZEMA 1U04A 4R9RA 1QGUB 1LK0A 4RA9A 2IBTA 1LDGA 5DHAA 5JMPA 4EWLA 3F5MA 2Z3WA 3BSFA 2XH8A 3ECSA 4Q3EA 4BNDA 4BB5A 4RFVA 2QD4A 1U90A 2X86A 3I6BA 4JP5A 4M99A 3NG1A 4R41A 3VH3A 5KPDA 5AXAA 4CQMA 3OIYA 4XIJA 4B6RA 1CK4A 3EUAA 3JZFA 4HO1X 5AJUA 3KOOA 3GFBA 3ANYB 2Q5CA 2VAWA 4U9IS 2HPAA 5HTKA 4CG0A 1DAFA 1NJ2A 3H42B 3VMFA 5KX5A 3OU7A 4KPUB 1VGVA 4JQOA 1BGVA 3JVVA 4J43A 3U4HA 1CP2A 4EJ2A 4EZIA 2R7NA 1DUSA 2I6TA 3AW8A 2NUBA 4C89A 1M5UA 2FXVA 2GWRA 4QU8A 2ZJZA 3V34A 4OMFG 5DM4A 3VTKA 5JNSA 4U9HS 2WJVA 2OL4A 4DCGA 5CFNA 5AW6A 5I45A 4UDYX 2I71A 1FYDA 3DNPA 2ZB8A 5JO0A 1FUYB 1SQ0A 2B1IA 2VJDA 4LHZA 5EWMB 5H59A 4DSOA 1AS0A 2PN1A 2P6UA 3DHNA 3NYQA 1XDWA 4U0JA 4A2QA 1DV2A 1GUBA 1RLIA 4PINA 5KTRA 5DGIA 3PK0A 1P1RA 3AXSA 4BFZA 1I36A 3DVLA 1OXXK 3DL7A 5BSTA 1QO9A 2QNIA 3PI7A 4E07A 4ZVLA 3IURA 4DZRA 4WBNB 1DL5A 2AJTA 2CSXA 1GN9A 2E55A 2P8JA 4R0VA 4PSCA 1V9CA 1K8YB 4KAXA 4RSHA 4EG7A 5LWQA 2QN6A 2V6JA 1TRHA 2CNNA 3UHPA 1UWKA 3B7GA 4CL2A 2AFVA 4LVCA 4V0NA 1G1MA 3AY3A 4KI7A 5B3KA 1Z5OA 5A9RA 1M0WA 4UUQA 2E4VA 3A31A 3L40A 3DF9A 4PZ0A 3R9XB 4RPCA 3ODGA 5JDCC 1Y9JA 4D0RA 3KOXA 3FWZA 4KWCA 1EFAA 2Q7OE 2IZ1A 3NH9A 3B1KA 4EOGA 1XKTA 4RJKA 3W05A 1C4XA 2IHZA 3FTDA 5JDIA 5DMXA 3V00A 4LCBA 4LZPA 2ENWA 1AHIA 2ZKLA 2K87A 3GDWA 3I42A 3QKUA 4L4ZA 4Y0NA 3SEAA 2VI5A 5JMOA 2NUAB 3IEPA 5BUZA 3AUAA 5EJ7A 2DUMA 2I4LA 3GLQA 3W3AD 1SXJA 2HRBA 2BFOA 3LY9A 4TL7A 3JR3A 2WIBA 4JUFA 4W9MC 3C6QA 4EKDA 1D2RA 3OQVA 4N7JA 3WWCA 2QYHA 2RJOA 3LOQA 3QKSB 4WZBE 3R3WA 2BFEB 5EWLB 3U0VA 3WJ2A 4KDEA 2CDRA 3D7MA 1NR1A 4OJTA 1N1MA 1T5LA 3UW3A 1E2GA 2JH3A 2SCUB 5IABA 3OZTA 4Y6RA 1UQUA 3MGCA 1NPDA 1XZQA 3ONDA 4QIHA 2FRDC 4KVFA 3GPDG 4K05A 4P3OA 4ARSA 2ZRKA 3O21A 3M3DA 3G9TA 4TKZA 2A9VA 1T5DX 2ZYVX 3IRVA 3N0TA 5CGQB 2YOHA 4OLBA 5TEWA 2M6RA 5AXCA 1IUKA 4MVJM 2AMFA 4NXMB 3X2SA 2R7AA 3BF7A 3W7AA 4KCGA 4CR7A 4QASA 3DKIA 2JFBA 1KIAA 1PW5A 2PMFA 5KTKA 2GN9A 2C1EA 4FDVA 2PUTA 4M89A 5BXYA 3CSSA 4JI7B 1V8OA 2IOQA 1H42A 3KUCA 2ID7A 3OZRA 3NPAA 4IFEA 4HQNA 4RF4A 2H3HA 1EVJA 2XB6A 5B55A 2D1YA 4ER5A 1F0KA 2YOGA 4L22A 2IIQA 3DLAA 4ZANA 3NVKI 1QLHA 3RJTA 3T41A 3AINA 2BOVA 3FF1A 4BTVA 1H3FA 1OLOA 1V8ZA 4GMDA 1W0KD 2WDZA 1XTZA 3DVRX 4QC2A 4LEIA 2XKKA 4XM1A 4GPD1 5CVJA 2I33A 2XT9A 3K0KA 1NFFA 3K71B 3IXMA 3O82A 4FFMA 3O93A 1XQ1A 3QYFA 3WGIA 2JIRA 4FQ8A 2OCKA 2D4HA 2GAAA 3KWJA 3ROKA 4WWHA 1LRJA 5BMVB 3W5VA 4GQBA 2I8CA 4NHEA 5BMOA 3RFTA 3OMXA 2G1PA 2HJVA 2DC1A 3C6MA 2GZ2A 1VPDA 2YH2A 4R71A 1YE8A 3N07A 4OGLA 1P0QA 3CF0A 4U7TB 3FHLA 3KT6A 4EGAA 2PFGA 2NSHA 2YY6A 4UE6A 4BO5A 4ROSA 4URUR 1CE8A 1RXUA 3IX7A 3TAHA 5AVQA 1U3GA 4JL5A 3HY6A 4QWWA 1UZAA 4DV0B 1CIVA 4Q4AA 1E7WA 1FW8A 2VO1A 1V8BA 1T3ZA 4GYJA 1I5OA 4C3VA 1DUIA 1QIFA 5T64A 5K20A 3V3KA 6ADHA 1ZEMA 1A4XA 4BVKA 4JI8B 2FZCA 3OWOA 3VPXA 4W5HA 4ZYLA 3F90A 3LM8A 4BZXA 1Z4KA 5E4TA 3QEKA 5JY1A 2W6CX 1GNRA 2WICA 3ISTA 4HGPA 1NY6A 2KWIA 2VJNA 2YTZA 4GLLA 1GPWB 2REBA 1LLFA 1YQXA 1X15A 4PBRA 3LDFA 1G3QA 2QR3A 2W4IA 3DZCA 4AECA 2HPVA 5JXGA 1DOZA 3RVDA 5I7HA 1ZUHA 2ETVA 3GD5A 3L3BA 4WBSA 2BGRA 4B1FA 4CXMA 4PYQA 1ZLXA 2MSDB 4DLYA 4I8XA 1KDRA 3H75A 1L5GB 2FPGA 2YRFA 5DCWA 4BVBA 1FCJA 2IYFA 3WB1A 3HV2A 3RV3A 3EXEA 4KIGA 1AF7A 1PYDA 1VLLA 4ZOBA 3ESYA 1U3UA 3RFVA 1EINA 3RU7A 1UJ6A 4GAEA 3ZDBA 3BRSA 2BMAA 2IEIA 3MJEA 5G2OA 1XD9A 4J0DA 3HU3A 1E1YA 1ZJ6A 1Q12A 4RD3A 3TMAA 3VHQA 3WGZA 4C7MA 2F8TA 3NV9A 2BRUA 3HFJA 1C3LA 1XYYA 2R6AA 4FC7A 4B47A 1VKRA 2GSWA 2IXFA 4AJOA 5AM3A 3FNFA 1HV8A 1VE7A 5EPUA 1PAUA 5C34B 4CJXA 1ONOA 4K40A 5JBIA 3UB3A 2L42A 4EHIA 2CBZA 3ESRA 1WABA 3B5JA 3F78A 4RD6A 2IHKA 5AW4A 1J1IA 5CTJA 3EZYA 2G17A 5GV8A 2IXAA 1H2WA 5AVWA 4UFOA 3NW9A 2A0FA 3K1TA 3V6LA 2B1GA 3KTAA 3JQFC 3C41J 3OE4A 2Y68A 2CV1A 4CR8A 4BVAA 3QJ5A 2DQSA 4I6EA 2AKYA 3VR5H 2JBAB 2QTLA 4BX9A 4DEYA 1AS2A 3RKRA 5JAUA 3N76A 2IOYA 2JGNA 2WTUA 2PD4A 1NZJA 2UVPB 3MS7A 5FUWA 3PD7A 3LBAA 3E22B 1W4RA 3G9UA 3KG2A 1ECBA 4S05A 1BS9A 4O1HA 1VJ0A 2XZDA 2YHIA 4C4TA 2IH2A 3IL2A 4JUBA 3ISJA 3PG5A 4O1MA 5LU8A 4X0EA 3BIFA 1CS4C 1XR3A 4A2WA 2ZWVA 2JAPA 2ZQ5A 4Y0AA 5CB4B 2DPGA 5LR6A 2QNRA 2ZROA 3PA8A 3C7DB 3HWWA 4AC9A 2XB8A 2JFGA 1CY7A 2NIPA 4Q47A 4A23A 4OX9Y 3SEQA 4OLJA 4DUGA 1DWPA 5I3CA 3CVUA 5LIRA 1H4TA 1FFBA 3DEYX 5LL6P 3EVFA 3C1AA 4ZK6A 1PEKE 3ZV6A 4HRAA 3CCCA 1JDBB 3C3YA 3DG9A 1QU2A 1FTNA 2JS7A 3HQ4O 4TV9B 5K8JB 4MVJG 3GU3A 1CQPA 4B6PA 1K7EB 2V96A 2V4MA 3NTLA 3VSDA 1L5FA 4DZTA 1T9DA 4NE7A 4I4LA 1ULHA 4I9HA 4B8WA 1EFTA 1IY0A 3N59A 4E22A 4LF5B 1WIWA 1JHRA 3W6UA 4ZQEA 1V43A 3JALB 3ND8A 4TGLA 3DYVA 5KYYA 4XUCA 3OQIA 3UWKA 2DLCX 2JGDA 2V6FA 4C3UA 3H97A 2M6SA 5JNWA 4YUYA 1TKBA 4RHYA 1GV0A 4U6SA 3TQOA 1JKMA 2Y93A 1G21A 1N8SA 1XVTA 5DRTA 4B75A 4DGSA 2VUSA 3Q15C 1YE3A 4BE4A 4MOWA 3SLRA 4M1SA 2Q49A 1D1QA 5JCPA 1LTKA 3RGGA 2FYTA 1QQAA 1ZH8A 3UB2A 1QVWA 1J25A 1TQ8A 1RKXA 1ZKMA 3LCUA 1E4EA 3DMTC 3QUBA 4ONEA 2ZM6B 1P81A 2QUIA 2PA3A 4V1CI 3E8SA 2CB0A 4RA6A 2DHDA 1YS7A 1T9GR 1FSZA 2VJMB 1NJ6A 2VRWA 4L2IA 3UXYA 2V7XA 1VB5A 4RETA 3C7AA 5AOBA 4FOLA 4JJ4A 4RDCA 5IBQA 1OBVA 3LD9A 1ZJJA 1E9FA 4ZCRA 4RKWA 4POOA 2H63A 4HT3B 3GMTA 3SE7A 2J33A 1FXUA 1J7JA 4FDTA 1KGDA 5K8TA 3ZHXA 2D2XA 1J09A 3H1AA 4Q7LA 1W19A 5AESA 4CM9A 2YFHA 2ZR8A 4Z1MD 1V37A 3RODA 2DCUA 4BQSA 4YPOA 4ECAA 1MC5A 5C5DA 1Y4AE 2RIRA 3GRYA 2RGBA 4MW0A 1KDZA 2HJHA 2ICAA 3IAS1 1JYFA 1ZQ9A 4TRMA 3OETA 3S5JA 5L7WA 5DLDA 1YB6A 4AG6A 1G4AE 1SHLA 3IPCA 4H1UA 4W1PA 1WPRA 3WK9A 5E95A 4HGZA 4NCAA 3IQDB 4G2TA 3FDFA 4H18A 2XPCA 4NBNA 3TGPA 2XTJA 5EIHA 5JQWA 3TI9A 3KSMA 4RCZA 3PL1A 1G8PA 1TTPB 3EWAA 4BZWA 2I7XA 4R2MA 4FUQA 2QG6A 3GY0A 2RHJA 3MMNA 4Y6LA 4W1QA 2A59A 4GGOA 1ZK3A 5SZJA 2PYDA 4LHXA 4MR9A 5CURA 4MO9A 4WEOA 1Z13A 3H9JA 4IXDA 3OCCA 5I47A 1G6OA 3LO8A 4II2A 4K88A 1DB3A 3PVZA 4H15A 4YV0A 4RGYA 2PDAA 3KR1A 1I4TD 2YWGA 4K6OA 4I81A 4S0XA 5KU1A 5CVCA 3BQMB 4R9SA 1I1NA 3IIEA 5KVQA 2XI4A 4TWRA 1NSYA 4IILA 5F9MA 5C3UA 3GUVA 1K89A 5AUQA 4AIIA 2EZ9A 3V8EA 1PZXA 2XWSA 3MTDA 1JBKA 2YIMA 2HIGA 2VXCA 3K1AB 3S99A 3Q8LA 2BZGA 2HSEA 2HDOA 1OC2A 3W6ZA 4WUTA 2GESA 5A7GA 1N9GB 3ZD9A 4AY3A 5HZKA 5CITA 5IMSA 3I4FA 2PMBA 4JENA 2NACA 3MJHA 4R01A 1D3AA 1B7GO 3EIQA 3OPXA 4AJ9A 2RGCA 3DO6A 3GGJA 5CP8A 2JFPA 2ZJAA 3LCMA 4L9RA 5EHGA 4G89A 1JPUA 4DYDA 3ZVNA 5TQ0B 1N32B 1X77A 3O6VA 2GJAA 4JGGA 1VP3A 1JKXA 1SOMA 1NQVA 1Y3CE 2J3QA 4J9VA 1T36B 4HN4B 1W1IA 5DOVA 1J99A 2IHNA 1GPAA 1T8RA 4XIFA 2WILA 3CLSD 3IMKA 4QO7A 1VPTA 1NU8A 2N1BA 2ZJ2A 4EGQA 3ZX5A 4YRDA 2WHQA 1EE2A 2CY0A 3IT2A 4IMPA 3X1XA 5B6PA 4BGIA 3RLFA 1KO8A 2IUEA 3NDBB 4J4HA 3BMQB 1M8PA 2YYYA 4MB0A 1OVMA 4S1PA 2XB2A 1ODKA 1HLGA 4XUEA 3ADKA 3EF3A 1Q7TA 3G59A 3KETA 4H7IA 2XNDD 1AXGA 2LPMA 5A3SA 1Z4OA 1Z82A 2D5BA 4LJ8A 4TMYA 2ZVPX 1VKHA 4X60A 5EJMA 5JAQA 4AURA 4MDHA 4EB0A 4LMRA 5HJEA 5HA5A 1EB8A 3N0RA 4RYLA 3TFWA 5CDTA 3EY9A 2R8OA 3AVPA 1LBTA 2W6ZA 3A4VA 3K0FA 4YASA 3S6JA 3DGEC 4HWSA 4QDOA 3TECE 1WY5A 2FXIA 2Y1DA 3F74A 3HCNA 4P3PA 4B4OA 2FX2A 1PF7E 2BMVA 2I4NA 4DBLC 2WWIA 5DX1A 2R0QC 2FFHA 2Q3LA 2RGWA 2EG9A 2NYUA 3NKFA 4XUDA 5JWHA 3TLXA 1SBZA 3I2GA 3PFWO 5MN5A 2LKDA 4DLNA 1WNTA 1I4EB 4YAKA 1H5QA 2C95A 3QTBA 3WLMA 5EUCA 4C3ZA 3QH4A 1YQ9A 3PXXA 2A3RA 5KKAA 4OP1A 4FN4A 3C6KA 3TDKA 4CQJA 3X3HA 1RQRA 4CIWA 5K45A 4I5DA 4L8YA 1VE3A 4JJZA 1YWGO 5HJ2A 4HEA1 1IOZA 4ZAGA 5CW1A 3HI4A 3TRJA 1O9BA 1FS6A 4CKZA 2VWHA 3RUCA 1SC3A 3BMOB 1DDOA 4I7EA 4MP8A 5L45A 1DAEA 2J7PD 2X0IA 2XTNA 2F1JA 3ZK9A 3QMPA 2WJZB 2A0UA 1B43A 1NY5A 4MI1A 5DCLA 3ZHYA 1AN0A 2WE8A 4AYTA 1YJBA 1Y6FA 1R2QA 3DQZA 3KAQA 4P7GA 2C31A 3S8EA 3OHSX 4KXVA 4JOSA 1RJEA 2UYQA 3SX4A 3NV7A 4A5OA 1N34B 2BCGY 3Q5DA 4INOA 4UEJA 2XZPA 3VPHA 3GAFA 4I4TB 4LXHA 2GFIA 2VNAA 4KYIB 2H2GA 4LTNA 3RRJA 3VPDA 1X1TA 2RBGA 1AX9A 1QHNA 1UP4A 2GK6A 4IHQA 1ISSA 1JH8A 1I33A 3VV3A 3FCOA 1QGOA 2GHTA 2A9PA 4Z3DA 2X5OA 3UFXB 4MQ4A 4ZYTA 2PU7A 4E30A 3HDQA 3PC8A 2O2HA 2ZAYA 2VHQA 3LG2A 3QVOA 2XGMA 1GTSA 1SKYE 3PZBA 5E3JA 3OLVA 4QXQA 4DT1B 2I2FA 3CBQA 2JAOA 3NRCA 4E5UA 2C58A 4QRDA 3RVSA 3H2IA 4PLFA 3DPSA 3UUGA 2Q45A 2O7SA 1L8OA 5KHLB 2GRJA 4EUNA 2O1EA 4LF6B 4ZI5A 1THZA 5DSZA 2Q5EA 4FZVA 2BUBA 1OTYA 1T25A 2BM8A 3DV0B 3JY6A 4HUTA 2A5FA 1AURA 1DE0A 1YONA 4V0RA 3Q87B 5L3SA 2OV1A 2HA3A 1PIWA 3RS2A 1NN5A 3D8BA 1UEJA 2HIMA 3D5TA 1JIVA 3O03A 1P44A 1RXYA 2C4KA 3GXOA 4LE0A 4YONB 4IR7A 5EIWA 4MYHA 4BXOB 1X87A 2MT9A 3PE6A 4XVRA 1Y6QA 1O2DA 4Y6SA 3OQHA 4NJEB 2ZUVA 2I6XA 5JJLA 2JEZA 2DFVA 3CUSA 1XNHA 4EVIA 2HCBA 4OI4A 3AERB 3QKTA 2ZM5A 4PCAA 4MKXA 4KFSA 5FA5A 4E5YA 3EGXA 3FLMA 4MVJE 3TX6A 1ZY2A 3CX8A 5JNUA 1M1NA 5AWFC 5EVJA 2PAFA 3HNRA 1E7RA 1JLKA 1Q0PA 4N3BA 1PWHA 2Q3EA 2G09A 2UDPA 2V3WA 2PZGA 4OJQA 2YRWA 4D45A 1JT9A 3G13A 1YR7A 3GZJA 4Z9AA 5DVZA 1KK0A 4IOMA 4A8TA 5EZ5A 3PB3A 1W4BA 1P75A 1XTSA 1UEXC 4Y2UA 3LP8A 3CH5A 2TMDA 5D86A 5GONA 3MUNA 2WY2D 2ZXUA 4FKZA 1BVHA 5BYKA 5M3BA 2IDZA 2OD9A 3FR8A 1I7DA 4I1VA 3RWOA 1O96B 1RXIA 1E1CA 1B74A 1L4KA 3OP1A 1XRQA 4YRLA 3PHHA 4JY7A 1MV5A 3RRFA 1GZDA 1GNLA 3KCQA 4PZYA 1EZ1A 1K63A 3HGMA 1SZJG 3JQPA 1M6EX 1Q1GA 2G6TA 5AKHA 3WP0A 3LF1A 2FW1A 3DAYA 1L7EA 5EP1A 4EL0A 4H2DA 3G9QA 3A06A 3CSUA 4QFBA 3RARA 2QV0A 1E9RA 1QH9A 4JBNA 3QXHA 3CB2A 3M6LA 4FW8A 4Q7QA 3G2NA 1F8XA 3KZVA 3CZAA 3EXFA 3EZ9A 1NL3A 1NYRA 1OPXA 2ZUCA 4FNOA 4OK3A 4X8HA 4E0BA 3ET5A 1GCAA 2I9PA 3HA7A 3DQPA 1AK1A 3E0QA 1IK4A 5J47A 3W2GA 3L7NA 1HRKA 2YBEA 4DIEA 2I1VB 1E0AA 1N5DA 4NQRA 3KOMA 5DCUA 1TNDA 5JIBA 1Q57A 3O1JC 2AOUA 4TS4A 2P7IA 2JGIA 1L5HA 4KPEC 1M1YA 1M5TA 1OOEA 3M4NA 4NATA 1QGYA 4WXMA 1A77A 4ITUA 3U26A 3V2GA 2F3UA 3L8HA 3WGUA 4TTPA 4EFMA 3SJUA 4PYKA 5J5AA 1P31A 1ZR4A 3L0BA 3HABA 3Q7TA 1R15A 4G09A 5A4FS 2C9YA 3LX8A 2ZRJA 4HYEA 4US1R 2O8BB 1FK8A 4MV5A 1TK3A 1ZH0A 2WM3A 1FP2A 1UWCA 1OH6A 4MR7A 3NU1A 4G5OA 1RZRD 4TRRA 1QC5B 3PJEA 1OKKD 2E48A 5DZSA 3VVLA 7REQA 5JI2E 2AYYA 1T1IA 2ST1A 1TAUA 3EGEA 4LKRA 1ZO8A 4XZ3A 4OUKX 1PFQA 1CCWA 4MS1A 3D31A 4Q39A 4QT0A 1J2YA 2VPIA 5AICA 3V8NA 5C53B 2IEGA 4EW3A 5JEDA 1U81A 3K2BA 4W1SA 4ZEXA 1FEZA 3ZBTA 5FX2A 1YDFA 1JV2B 2D8AA 3P26A 4BQQA 5BWOA 3I1FA 3SY8A 1Z17A 4HFRA 2L0XA 2MSWA 3WKAA 2QQGA 5C8YF 1USVA 1YHNA 1SVUA 1JE1A 2MCFA 3ZVKA 4DYVA 1O94A 4Y18A 4P98A 5U4QA 2XOEA 621PA 1TAHA 1TEXA 2B5WA 4HWPA 3TLEA 1KJQA 5AVTA 1JLRA 2OORA 4YUWA 3IEKA 1EUCB 2LXNA 2FN9A 1P2VA 1HFJA 3GUUA 3ZOKA 3LX6A 5BN4A 1NRXA 2FWAA 3GRFA 4RLHA 2C3UA 3KQSA 4LHYA 1Y3BE 1UDRA 1ULSA 1UUFA 3A37A 3LBNA 3Q4GA 3AF5A 1N25A 4J0HA 1R5OA 5EE9A 1KI1A 2Y92A 4GU5A 5B37A 1IBMB 1UDXA 1QDLB 2V7PA 2KLBA 4D6YA 4GUAA 5FOUA 1O57A 1PEDA 1GAEO 3MWEA 4OK5A 2HJSA 4JLAA 4KWEA 1EDZA 4ZVMA 3E8XA 3M6UA 4KFRA 2QL6A 2D7CA 4QQFA 5JYDA 3EIXA 3IKTA 4KRFA 2BFBA 4ZI7A 2JW5A 5FL3A 2Y77A 1KH1A 3A1UA 4HATA 2GHRA 3BGDA 4JS0A 4XLZA 3QA9A 2BD0A 3BHMA 2HCRA 4DJEC 4YTEA 2HJGA 5DW3A 2VP6A 1MJGM 1O9HA 3KSZO 1D0SA 2W70A 2HY7A 3HHPA 3I01M 1WBJB 4KV7A 2DWOA 2FWNA 3RVQA 3SMQA 3ZHRA 2DPHA 4KMRA 2OSVA 3F5FA 4J16C 3UXHA 4RESA 4IH1A 2XNJA 2A5LA 2HJRA 1JW9B 3H4IA 3MIIA 4E6EA 3C43A 1FDUA 4CHTA 5H9WA 1U5BB 3TRKA 5FDFA 5TMPA 4S3MA 1ODIA 4N01A 4DCMA 4XYLA 4YBZA 2ZYUX 1TYDE 3PE4A 4GGMX 3M6VA 1C9JA 4A9AA 2PBZA 3ORFA 4B79A 3M89A 4B09A 3QKRA 1RWQA 3ES9A 4BCDA 5T3UA 3HB4X 3MTQA 4UC0A 3RANA 4DWWA 1JEYB 2VTEA 4Q1AA 2GN1A 5C1DA 2VSYA 1RPTA 3MFQA 2G7ZA 5JV5A 3JYHA 3FPBA 1PGNA 4NOMA 5E1OA 1GNQA 2IEZA 1E2LA 1DZIA 1TLTA 3G7SA 3CNNA 5L3ZA 3QOWA 5LUBA 5JRJA 1OJ7A 5ALNA 5ERYA 3S2IA 3UK0A 4D9BA 4D9NA 1QZUA 5EXPA 1PJ3A 2CFCA 3A10A 3W90A 1KKMA 1Q77A 4TOIA 4AYWA 1KZ4A 1P5JA 3LP5A 3QV2A 1D7OA 1T1SA 1MW8X 1ZGHA 3LZ6A 3NATA 2Z2ZA 4MROA 3U7GA 1J8QA 1NVWQ 1Z47A 3GCWA 4ODIA 5IZCC 3IMCA 4Z4CA 2PS9A 4YDQA 4DG9A 4I55A 3SJCA 1CBUA 1TK2A 4MS4A 1Y8AA 3B3QA 2HV8A 4RHFA 4RZXA 3M34A 4TXHA 5B3JC 5FEUA 2RIPA 4GIBA 3TLGB 3N2LA 1QFZA 4F8YA 2WW8A 5HCIA 1OE0A 2YW9A 2ZSBA 1M1ZA 3PZRA 2OY0A 2Z57A 1HTWA 4A82A 1AS3A 3VBCA 5AJYA 1XJWA 1U1CA 2Q8QA 4AF7A 1PQPA 2X9GA 3MJSA 3P7MA 3SQXA 4TMWA 1DFHA 5JJ5A 3CLKA 5KSPA 4YUVA 3K9LA 1ESDA 2YHSA 4AO6A 2A9QA 1GGHA 3QQPA 5J59A 4QUDA 1RMYA 3TLAA 3JAWA 3DE1X 1L7MA 4EA9A 1T8TA 4G23A 1SUCA 2CNDA 3OJLA 4EITA 1PWXA 1KAOA 3UAXA 4BU0A 2RGGA 1BXZA 2QVLA 3W8RA 5LQAA 3O26A 4OSPA 1OASA 4EFNA 2GLTA 1K5PA 5DBIA 5B12A 2OQIA 1AZWA 2J45A 4W5QA 4YV1A 1T8YA 3BFXA 1SCQA 2O4CA 1Z7GA 4BMPB 3C5CA 3R09A 1Z5VA 5K8UA 4BMNA 3ZHBA 2OFWA 4PLYA 3B5IA 1A7KA 2WNIA 3GEDA 3A1EA 3HWRA 4OB6A 4YP7A 5JT1A 4DABA 3GJ5A 4QELA 1REQB 4G5FA 1CSEE 2GBGA 4UBJA 3AR3A 2I03A 4Z7JA 1QRTA 4PGHA 2IA5A 3OCVA 1ZR2A 3RASA 4OKIA 5IS2A 4XDYA 3R5FA 3M33A 3PX2A 1DT3A 1VZ2A 2OB2A 2P91A 3CJQA 3OZVA 4ON9A 2JATA 4WCFC 3TMYA 1LX7A 4MWTA 5EP3A 2XUOA 5G4KB 1NPTO 5FPQA 5SY6A 4IIVA 3A7EA 3VNSA 4IWYA 2A3NA 4J0CA 1ECJA 1FFXB 2OOSA 1WM1A 2VXOA 4MPJA 4Q9DA 4WDQA 5ETJA 2QM7A 2O7QA 3E15A 3K94A 3SF8A 3C3DA 3VSCA 4Z1OA 5IKMA 4GLOA 1PQ4A 4PGGA 4Q9JA 3FPAA 3CZQA 3V8RA 3ZHCA 2H9IA 4FOTA 3BGWA 1T43A 4G9GA 4HNQA 4EF6A 3EK2A 4NBKA 1DDIA 4X20A 3ZWQA 3WISA 2PBFA 4NARA 1WHSA 1FVFA 4MV9A 4Q7JB 3C45A 1TYAE 2B7LA 2FRVA 4BFVA 4C43A 2NQ8A 4R16A 4BC0A 5KYTA 1TCAA 4K0KB 1X13A 2OLEA 1H5NA 4X94A 3KPJA 1R8XA 2R5WA 3PFKA 2X19A 3GJZA 1SA0B 4RD1A 3ZHVA 1P1JA 2B6NA 2HNKA 4XD2A 3L5OA 4HMOA 4D46A 4R5HA 3FETA 5AHXA 1MT0A 5DHUA 4DA7A 1E7YA 4ZVKA 2WKWA 3L7AA 1ESNA 4K86A 3ENZA 3DP7A 1ZXBA 1EFVB 1P0IA 5CX1B 5FUQA 1IRXA 2YWBA 4GX2A 1SJ9A 3BCHA 1E6UA 1QIIA 1NUQA 2X4LA 1M6YA 1R7RA 1HDGO 1RQNA 5BUQA 2JKVA 4O4LA 2YHUA 2BP7A 5C4GB 3W6PA 4JVLA 4TT3D 4HDMA 3JWEA 1NGSA 3BG5A 4YRCA 3PUHA 5LB2A 1QCYA 1VMEA 5F1OA 1C7EA 2JCGA 1BWSA 2O3RA 2V7QA 3E5RA 4JLUA 4PNEA 1P60A 2O1SA 2QD1A 3GD7A