4C4OA

Structure of carbonyl reductase cpcr2 from candida parapsilosis in complex with nadh
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
334
structure length
326
Chain Sequence
IPSSQYGFVFNKQSGLNLRNDLPVHKPKAGQLLLKVDAVGLHSDLHIYEGLCGDNYVMGHEIAGTVAAVGDDVINYKVGDRVACVGPNGCGGCKYCRGAIDNVCKNAFGDWFGLGYDGGYQQYLLVTRPRNLSRIPDNVSADVAAASTDAVLTPYHAIKMAQVSPTSNILLIGAGGLGGNAIQVAKAFGAKVTVLDKKKEARDQAKKLGADAVYETLPESISPGSFSACFDFVSVQATFDVCQKYVEPKGVIMPVGLGAPNLSFNLGDLALREIRILGSFWGTTNDLDDVLKLVSEGKVKPVVRSAKLKELPEYIEKLRNNVVFNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords CARBONYL REDUCTASE CPCR2
publication title Structure of Nadh-Dependent Carbonyl Reductase (Cpcr2) from Candida Parapsilosis Provides Insight Into Mutations that Improve Catalytic Properties
doi rcsb
source organism Candida parapsilosis
total genus 98
structure length 326
sequence length 334
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4c4oA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4c4oA01
4BQRA 1PR9A 1JKJA 2Q2WA 3EHEA 2RHRA 1MUUA 3ZU4A 3LT0A 1Y5RA 3ENNA 4NI5A 2GDZA 1E7WA 2AQ8A 2I99A 3AY7A 3G3EA 4I5EA 4OJNA 4AJ1A 4LRTB 3WNVA 4YYZA 5BSHA 2Q1TA 3A1NA 1XEAA 3TL2A 2C0CA 3LYLA 1GQ2A 5U4QA 5TF4A 5H82A 5G2OA 4F45A 4IIUA 1GUYA 4LMRA 1FMCA 4XQGA 1LX6A 1UZMA 2EIHA 4PLTA 1DLIA 4YB8A 1DIAA 1C0LA 4YXFA 1P9LA 3CH6A 3FTNA 3PYXA 1MX3A 2PD4A 3RKUA 2YHIB 1K6JA 5CDSA 6LDHA 5A9TA 4CLRA 1ZEMA 1EUZA 1ENPA 1NPDA 2X6TA 1LEHA 2X0JA 4BKUA 5KVVA 1DFGA 1IYZA 4YJFB 4FGSA 2IXBA 2BFMA 3VTFA 2Y1DA 3U0BA 1X7DA 3NJ4A 1DRWA 3RVDA 4J6FA 3N58A 3I23A 1XELA 3L6OO 4CV1A 4U8GA 3MJEA 3A28A 3VH1A 5IDYA 3G17A 4O0LA 4BO4A 3E82A 1HF3A 3LVFO 3NDJA 3U3XA 2A94A 3NYWA 4GAEA 2X1HA 4PRKA 2GERA 2Q3EA 4U7WA 3JD0A 3JYPA 2C82A 3QIVA 4YEDA 5T57A 4XKJA 1SZJG 5CG1A 3TQHA 3WWZA 4J91A 4MDHA 4WOJA 4ZICA 3U62A 3QP9A 4QFCA 1C0KA 4NJMA 5B1YA 4M89A 4OSPA 4BNUA 1SPXA 4K9DA 4BO5A 5FEUA 2Y0CA 1DXYA 2LDBA 4EYEA 1TT7A 1PJ2A 3WGZA 1GY8A 3PGJA 3IJPA 1I5RA 2GN9A 1E1NA 3WLFA 3WMWA 1O8CA 3LLVA 2X9NA 3NEPX 3FI9A 3QWIA 2Q4BA 1DHRA 2C07A 2QG4A 3LF1A 4HFNA 4J16A 2YV3A 2GRAA 3AFNA 3GVXA 4S3MA 8ADHA 6ADHA 1JW9B 5EQFA 4FFRA 5GZ1A 1NR1A 2X5JO 1BDBA 3DDNA 1T25A 3JQ7B 4MVJG 3VZQA 4BV9A 4INAA 1BXGA 4B4VA 2JJYA 3L0DA 4ZU3A 3K96A 5IN5A 2X86A 2IE0A 3UICA 3INTA 4IS3A 3HWRA 1I10A 2J3HA 3JD4A 1PSDA 4RLSA 1JAYA 3GMSA 3ENKA 4OAQA 4YWJA 4RCVA 3KYCB 3K8ZA 2ZK7A 1EUDA 1SOWA 3NDRA 5A9RA 1B15A 1R0SA 4CM9D 3CZMA 4CM8A 3PHIA 2RHCA 5IZCC 1YXMA 1PTJA 1U7HA 5KCZA 2GUGA 3I6IA 3INGA 3GDFA 4XDYA 5TS3A 2O3RA 3VZSA 3VDQA 1WDMA 4IJVA 4CLOA 4MVJP 4BV8A 2HAEA 1FDWA 4ID9A 4YJGB 2A4KA 4YJHA 5DDIP 3AOEC 3U09A 4UEKA 4W9NC 3UOGA 2CMDA 2YY7A 4GMGA 3HNPA 1YE3A 1ZK0A 4U6QA 3RROA 4ND3A 3B1FA 4W82A 5A3VA 4CLXA 2DUWA 1Y8QA 2OUIA 3T7CA 4AICA 4NZ9A 2B5WA 1PU2A 4E32A 2AA3A 2GN4A 3RJ9A 4YRDA 2HO5A 4P8RA 5T5QA 3BXXA 3MWEB 1G0NA 4FJ1A 3PHLA 3DB2A 2NQ8A 1ADFA 2EHDA 2GN8A 2QX7A 4YQYA 1XA0A 1NX6A 1W73A 2EW8A 1HE3A 1UXKA 3L6EA 3ZWWA 5G0SA 1HYGA 1SC6A 3K31A 1HYHA 1FDTA 2Y99A 4JJFA 3IIEA 1TT5A 3GGOA 1E3LA 4FC6A 4GSLA 3RWBA 4DC1A 4IDGA 5JLAA 1HDGO 1UP4A 2ZTVA 4QECA 3ZGYA 3HHPA 2HK9A 1H6AA 1KC1A 2ZTUA 1DDOA 4GX2A 3UH1A 2Y66A 3X2EA 5BR7A 5G0UA 1V0JA 3WXBA 3U49A 2ZB4A 1PWZA 1LSUA 3GRPA 4EZBA 4GVXA 4Y67A 3ZDFA 2D1YA 9LDTA 5JC8A 4EJMA 1H5QA 2Y1GA 4PGFA 3LT4A 1DOHA 3DOOA 3GHYA 2FPGA 1DBVO 2OGUA 2VHVA 1YRLA 2BLLA 3ZWMA 2GN6A 3U9LA 4S1VA 4XB2A 5EL0A 3BMNA 4C7KA 4H3VA 1LI4A 5TJHA 1FDSA 1SBYA 1U5AA 3WNQA 4BOYA 4FS3A 4RPLA 4GLLA 4UUMA 4IJUA 2W90A 3H3FA 3UAGA 4MP3A 2QZZA 4EJ6A 3R6DA 1YO6A 1HSOA 5B4TA 5DBGA 3KETA 2Q99A 1EFKA 3PYMA 4WLVA 1HDRA 5BNIA 4IDEA 4WASA 5L4SA 1IL0A 5JNLA 4EDFA 2JHGA 1ZW1A 1E77A 1P44A 5I7SA 3AU9A 1DIRA 3VPGA 2F00A 5JYEA 4W7HA 1DC6A 1U2GA 3PRJA 4MINA 4OOEA 3STHA 1GPJA 3EVNA 3IUPA 1G6KA 3QA9A 1UZLA 1XSEA 1GYQA 3CUKA 4O5OA 2PH3A 3QVSA 1VKNA 4QXMA 4E31A 5AXAA 5T8KA 2O23A 4XYEA 5CP8A 3DAFA 1C1DB 5JO0A 2YW9A 1Y81A 1JVBA 3QQPA 3V1UA 3ZNQA 5KJCA 5KJ1A 3GN1A 4E4YA 1B26A 1KYQA 4EI2A 4FB5A 3ZCXA 3Q0EA 4CMBA 1QLJA 4BKPA 3B20A 1IULA 3M6IA 5KJFA 1T4BA 3TN7A 1QLHA 1WWKA 2C29D 1R4NB 1LQTA 2PNFA 1KBZA 3UN1A 1AUPA 5AVOA 1U3UA 3L77A 4P22A 1ZNQO 2VZ0A 4CQMA 3U4IA 4PLPA 1E3JA 1QV7A 2OFPA 3ANNA 4BO8A 4AVYA 4GWKA 1BWSA 2I65A 4CUZA 2BH9A 1U8XX 2V65A 5ADHA 4L8VA 1P33A 3ICPA 3WGHA 1BXZA 5DCUA 2O2YA 3A14A 3RFXA 4PLFA 1E6WA 1UDBA 3ASVA 5EESA 5ENDA 1B3RA 3S2GA 3L4BC 2PD3A 3OJEA 4OL9A 4CMJA 2O4CA 4DIOA 4UVHA 1DC3A 4HNGA 1GZ3A 4HP8A 4ALKA 1DAOA 3WGQA 1LQUA 2X0NA 4WLFA 1WPQA 3JQAA 1KVQA 1EVIA 4RQUA 2PA3A 1KEPA 3IP3A 4YACA 3MOIA 3IL2A 3EC7A 4WECA 5IAAA 3FWNA 1OOEA 4DUPA 1IE3A 2VRCD 3QVXA 1YQGA 5MDHA 1U4SA 2G82A 1E6UA 2ZTMA 1OI7A 3DBHA 3L9WA 2ZCVA 1CETA 4UVEA 4CM4A 3EZYA 2D3TA 5LC1A 5JMWA 1I3LA 4B4WA 4PZCA 3I6QA 3K30A 4D41A 1WXDA 2W2KA 2NACA 4J9VA 5I9LA 3WFIA 1A9YA 3PQEA 2X58A 4CJXA 1YJ8A 1ORRA 1YOVA 2NTJA 4YRBA 4IQ8A 1PJCA 1Q7BA 1HKUA 1LLUA 2PZKA 2AQIA 2FSVA 4CMIA 2O3TA 2G5CA 3WGIA 2Y68A 3DFUA 3F4LA 3K92A 4LCEA 3I9KA 3RC1A 5DF1A 5A04A 2VT3A 1NVMB 1XQ6A 4NK5A 4FFLA 1MC4A 5A5FA 2Y0DA 4BNGA 2YUTA 1B2LA 4J90A 3DAGA 1R37A 4LK3A 4L74A 4ZQFA 1ISJA 4YTEA 1JWAB 2QYTA 2OZPA 3ZI0A 5CAEA 4P4NA 1EUCA 1NAHA 1GU7A 4NFYA 4F6LA 3NKLA 4PG6A 2OORA 3JQ8A 4FSHA 4PLHA 1YL6A 1GEGA 4GBJA 1WMBA 2V6GA 3BHIA 3KHUA 1R15A 3JQFA 2GASA 3KBOA 5ITWA 5ILGA 1ZBQA 3RU9A 5T6BA 2UDPA 4ZGWA 3R1IA 2W4QA 2GCGA 2OL4A 3QJ5A 7MDHA 3GDOA 4TSKA 3RAJA 1O6ZA 1J5PA 5LDGA 2DPGA 3PFWO 4BGEA 4L0QA 5BQFA 4ALMA 5ILOA 2EP5A 1NHGA 4JX8A 7ADHA 1TEHA 2R00A 2IXAA 4J49A 4R1SA 4HUJA 4JP2A 4DGSA 1OBFO 2VNAA 4BUCA 3IKVA 3SLKA 4MVJF 3OJLA 3WOHA 4BNIA 1XCBA 5KJEA 4OQYA 5JPIA 2H5LA 3UW3A 3TL3A 1CQIA 1GZ4A 3OIFA 2C20A 3JQCA 4FPXA 4WE3A 5TT1A 1ISHA 4MVJA 5JDIC 4MIOA 2RAFA 4RO0A 3SVTA 4OYRA 3UCFA 1LDGA 4HNHA 2D5CA 2O2SA 2FP4A 2GO1A 5DNAA 5CDYA 1C1XB 4MJLA 5TLSA 3P19A 1Y1PA 4MVJI 3KYDA 3H3JA 3Q9UA 4XGIA 4WLEA 1XLTA 4IS2A 1OC2A 4CLHA 2YYYA 4B4UA 3P5SA 5COBA 5TSDA 5DBFA 4CMHA 1DEHA 2D59A 4RQTA 4DQXA 1DFHA 1X14A 2IZ1A 4RF3A 1N9GA 1ZSNA 3OEWA 3GFBA 2J5QA 1RM3A 4XYGA 1LDBA 3SBOA 2HCTA 4LVUA 2NWQA 3JQEA 3K2EA 3LU1A 2P2SA 3DR3A 1GL3A 3VPXA 1F0YA 2JFHA 1BXKA 3B70A 3L4SO 4KOAA 3GN2A 1C0PA 1IB6A 2XF8A 5JYDA 3DBRA 4IDCA 3ROMA 4B8ZA 5IF3A 4LGVA 2FOIA 1XDWA 4TROA 2Y1FA 3KUXA 2JAHA 1YKFA 1DJNA 1LSSA 3ONEA 2ZB3A 4BO3A 1I30A 4YT4A 4EEXA 1B8UA 4WKGA 4Z9YA 3OHSX 4Q3DA 1Z45A 1EZ4A 3NT4A 2HK8A 2JD1A 4IZHA 3AUUA 4TVBA 1ARZA 1ISFA 3PZRA 5FI3A 3RIHA 4OXNA 3V2GA 3ZW9A 3OQ6A 3R3JA 3AY6A 1X1TA 4HFRA 4M49A 3AOGA 4XA8A 2ZKLA 1D1TA 4G5HA 1LSJA 1PEDA 2VTEA 3C3XA 1UAYA 1MP0A 3VHRA 2XXBA 3LT2A 1Y8RB 3OECA 4WPGA 4XD2A 3KSDO 4URFA 3TSCA 4N5NA 2LDXA 1E1LA 3GK3A 3O8QB 3GDGA 3GUYA 1SAYA 1V3TA 4ZRNA 2OMEA 2PKQO 2WTBA 2X0RA 1DFIA 4BNLA 1QR6A 3OSUA 2DTDA 2AG5A 3E9NA 4PIVA 4E2WA 3OFSA 1DIHA 1O95A 1B0AA 2HRBA 3L07A 1QYDA 5CEFA 3ANLA 3W4JA 5EPOA 4E5YA 1Z7EA 3KV3O 1Y7TA 4J7XA 2GPTA 2JFFA 1PS0A 4CL8A 5HWSA 1CDOA 2Q1WA 2DU8A 4UULA 3RBVA 3ROQA 5U9CA 2FR8A 3PVZA 1U28A 1NNUA 5TRTA 3BHMA 3IOYA 4BNFA 2EF1A 5JAZA 3JQFC 1VSVA 5ES3A 1PQWA 3OM9A 3V1TC 3AK4A 4BNZA 4WCFC 1H6CA 5JAQA 4DC0A 4E5MA 3KLMX 4RLHA 3VPFA 3D5QA 4JROA 4BGIA 5BSFA 2JCXA 3H9GA 3EK2A 1FXSA 3DAPA 1PGNA 3AUAA 4B3HA 1CRWG 3GAZA 3HN7A 1P0FA 2XOXA 4ALIA 2OO5A 4R1UA 5ER9A 4WNCA 1CF2O 2NU7A 1C3VA 3RCBA 1O9BA 2R00C 4I08A 1LDYA 1KS9A 1MC5A 3QY9A 5THKA 5G0WA 2C2YA 2I76A 1ZEJA 3MTJA 5LDHA 3QSGA 1UXHA 1QSGA 3GZNB 1P31A 3G1UA 3JQ7A 1E7MA 4G65A 3PZBA 4DIFA 4N5LA 1BW9A 5FYDA 3DZKA 5B37A 1WW8A 1WMAA 1H0KA 2BRUA 3QW2A 3VDRA 2ZATA 4CM7A 1DRVA 3R0IA 1EEHA 3ETDA 2X9GA 2DUUA 2HUNA 2PLAA 3WBFA 2WSBA 3PEFA 3QWAA 3GHHA 3MJVA 5H81A 4A2CA 3F46A 1HLDA 1DIBA 1U8FO 5JC1A 4LSWA 4CMGA 2AE1A 4LSMA 1X0XA 1ZMOA 3FNFA 4OM8A 4R54A 1TXGA 2QW8A 4IQ0A 4LISA 5G4KA 3WG9A 1EBFA 1A27A 4RVDA 1JKIA 3BTVA 4YJGA 4D44A 2NU6A 1EDZA 4FOOA 2HJSA 1W0CA 3ANMA 3V5NA 4G2NA 5GZ3A 4IDDA 5C7OO 4WNIA 1QV6A 1YBMA 3G0OA 4MOWA 1HE4A 2ZB7A 4GKVA 2VYVD 3ZU2A 3BTUA 2VQ3A 4Q3AA 3RQSA 4QSMA 2VHYA 4I9NA 1RM0A 2DPHA 2A9FA 5K6AA 4PLYA 4BO7A 1RM4A 4AJPA 2P68A 2AG8A 4DWVA 4TRMA 3ST7A 3UCEA 4AJHA 5K1SA 1I36A 1PGQA 3BMQB 3HDHA 3DL2A 1E5LA 1HZZA 2H6EA 3JQ9C 4OKNA 4PG8A 3GNQA 5CDTA 3CXRA 3PJDA 3ZHZA 1GUFA 1K2WA 2QRKA 4GWGA 4BNKA 4GL4A 3RC2A 2B0JA 1EFLA 2AQKA 3ZV3A 1ZO8A 2FZWA 3D3WB 3VPSA 1E7QA 1H2HA 4CMCA 2C7GA 4J2HA 3NV9A 3RFVA 2DT5A 1N92A 3GQVA 3HUDA 3JD2A 4YCAA 3U4CA 1E3EA 2VCYA 2CF6A 5K9ZA 3BAZA 1KEWA 3H5AA 3UFXA 4Z3DA 1GPDG 3MZ0A 2EGHA 3ZWYA 2O7SA 4FFOA 1PZFA 3PIDA 4ZQHA 4N18A 5DZSA 1F8FA 1GQQA 3A06A 5F1KA 4PVDA 3KTDA 2EKPA 2YDXA 4OKIA 3DZFA 4BGVA 3TDKA 1V3VA 4XQEA 3O9ZA 3HDQA 3UGKA 3CE6A 3HJAA 2FMUA 4ND2A 5KIAA 4CM3A 1T4DA 5CPFA 1F8GA 1IUKA 5BT9A 3PIIA 2PGLA 1JTVA 2WEKA 1D1SA 2OOSA 1TVEA 3RKRA 3PWSA 3B1JA 3TJRA 3WQRA 1Y5MA 4RORA 4QFDA 2PWZA 4LRSB 4U5QA 4QUKA 3WDSA 4CMAA 5BNFA 1ID1A 2O50A 3DEYX 4R3NA 1A4IA 3W6ZA 3WYCA 1HDXA 4RPGA 4BMNA 2DAPA 1IZ9A 3BTSA 1RPNA 3H2SA 5KVSA 3RJ5A 3X2FA 3FPLA 1CYDA 1PJTA 4Z0TA 4MIEA 1L7EA 1R4MA 4CQLB 4ZQEA 2GSDA 2Q2QA 1LBEA 3T4EA 1I2CA 2P9EA 1EBUA 5CPBA 3ZWPA 4L73A 3PFFA 4PFJA 3I52A 5TJ9A 3G49A 3IJRA 5EJ2A 3KB6A 1S6YA 2PK3A 4PZDA 1WLYA 3AW9A 5ENVA 3DMTA 4A03A 5A5EA 3Q9NA 5JS6A 2QZ9A 1YWGO 1E7RA 3HSKA 2E82A 2BD0A 2Y0EA 3V2UA 5KJ6A 3F9IA 2JCYA 2HRZA 1AXEA 1K5HA 3AI3A 3M1AA 2UYYA 1IZ0A 1EMDA 3PJFA 1D8AA 3SXPA 1WVGA 4KDFA 3MCVA 1Z6ZA 3UCXA 3PYLA 3DHNA 3NDIA 2ZJ0A 1XU7A 4YAJA 4ZQBA 4UVIA 2GD1O 3EZLA 1HSZA 1Q2XA 2X9VA 5A1TA 1R0LA 4B3JA 1SB9A 3ROPA 3ZWBA 1I33A 4UVGA 5ICSA 1PX0A 1UAGA 2B36A 1XWFA 4J0FA 5GZ6A 3FWZA 4R1TA 3NJ8A 3BMOB 4BB6A 3JQGA 3RFTA 4E21A 1X13A 4ZHSA 2WD7B 4I9UA 1G1AA 1NXQA 3JYNA 4II2A 2VYND 1V9LA 3JD1A 4DA9A 3KM0A 1A72A 2J5KA 4FIZA 3AUSA 4TZTA 2O3UA 1DJQA 1MXFA 2CDBA 2HMTA 1NHWA 5JAMA 3QHAA 3LQFA 4TQGA 1T2AA 4HKTA 4BNTA 3T7EA 4QQRA 3H7AA 3WB9A 1FDUA 4E0BA 3WR5A 3GEMA 4IXWA 3LC1O 5JCXA 1BTOA 3DXFA 1F14A 3OA0A 3U4HA 4R5MA 5A9SA 2B35A 2WMDA 4NNJA 4DMLA 1SOVA 4B3IA 3TOZA 4E6PA 5C5IA 1ONOA 2YHUA 3C1TA 1BVRA 3SX2A 3RBZA 3TNLA 1F12A 4NBWA 3PJGA 4ROSA 2OHXA 3HG7A 4RDIA 1UXIA 1JDJA 1O5IA 1O94A 3QWBA 1X15A 1DO8A 2DVMA 1N7HA 2NVUA 4DLLA 2E37A 3BIOA 4WEOA 1T1SA 2W98A 4JLWA 4OO3A 3NT2A 3BYZA 1E1KA 3UUWA 3RI3A 3AM3A 4RZIA 2FZEA 4N5MA 3O03A 3FN4A 5JY1A 1GUZA 2YFQA 3OJFA 1HDCA 5B4VA 4L9RA 3KYBA 3PDJA 4CLRB 1ZKMA 2IODA 4A73A 3I4CA 5C3MA 4RPKA 5ITVA 3JQBA 2G1UA 4U0KA 2W8ZA 3WSWA 3VKUA 4DXHA 1ISMA 2GNAA 4RVGA 1VRWA 5L53A 3AM4A 1QYWA 1W8DA 4K6FA 3VH3A 4M87A 2R6JA 2DBVO 4MKRA 2I5PO 4ILKA 1TI7A 1WDKA 3CKYA 2H63A 3D7LA 3DHEA 2C5AA 4F46A 5JSFA 2PZJA 4NPCA 1VJ1A 3O38A 4FD3A 3PLNA 1AHIA 4J4TA 2CFCA 3CTMA 4HFMA 2QQ5A 2Q50A 4R51A 1YH3A 5L7YA 4BS9A 4FFMA 1FK8A 1ZK4A 3C7DB 5COQA 1BHSA 3BMCB 1GD1O 1YBAA 4OMUA 2BKAA 3VZPA 3CMMA 3F6YA 3PHGA 3CMCO 5JCJD 2BFPA 4NJMB 1FJHA 3WGOA 3D4PA 3LZ6A 3R3SA 4JQCA 3ULKA 2FHSA 4PLWA 1SMKA 3W4KA 1LA2A 3VTZA 9LDBA 2GZ1A 4CR6A 1PL6A 3GFGA 2I3AA 5C37A 5IDXA 5JDCA 1S7CA 3UKOA 5IJZA 1QYCA 2VHWA 4C7JA 1Z82A 4YAIA 5BNTA 1PQUA 4BNHA 4KUGA 3ZV4A 1N7GA 1NAIA 2D4AA 3GVCA 4RPHA 5F1PA 1PL7A 1OAAA 2X23A 3HB4X 2EXXA 2FR1A 1LLCA 3HDJA 4DL9A 1BG6A 5F5NA 4I5DA 2IDZA 3FF4A 5T64A 3DC2A 3C7CB 1BGVA 4RVFA 3GEGA 1BXGB 1ZUD1 4XIYA 1GCUA 4DTIA 3KSUA 2A35A 4CMEA 3DO5A 2C59A 3WX0A 3WICA 4ZA2A 3ADOA 5KTKA 1ML3A 1YS4A 2VWHA 4K26A 4GLOA 3AWDA 3E18A 1VE9A 1HEUA 4N7RA 3ZWXA 2QIOA 2W2LD 4CQMD 1E1MA 1T2EA 4E33A 1X7GA 2D0IA 2PGJA 4BQPA 3FBTA 4CM8B 1V6AA 1RWBA 2YQ4A 2E48A 1WP4A 4FJ2A 5IN4A 2G76A 5L7WA 4JP3A 1QRRA 2VTDA 3NGXA 5GMOA 4XQCA 3ZHXA 3WTCA 3KSZO 1X0VA 4CLOB 4FJ0A 2OP0A 3D4OA 4ZJUA 3F1LA 4D3SA 3PDUA 3VOSA 1R16A 4JBIA 1M75A 2FSSA 3DBLA 1Z73A 2PZLA 3JQAD 1PR3A 4H15A 1Y8QB 1DLJA 3MJSA 1DC4A 1LRJA 3LF2A 3ZHBA 3IQDB 1KC3A 2ZQZA 1ZK3A 1QMGA 3EW7A 3RBXA 3ZN2A 4XRRA 4RZHA 4J1NA 1KERA 3IUSA 1DAPA 3T4XA 4Z9XA 1GAEO 4YQZA 2I9PA 1Q0QA 1HDOA 2AEFA 1U7TA 2JKVA 4FFPA 3EVTA 1AN9A 4NBTA 4OHUA 4YA6A 4YAEA 5A06A 1HE2A 5DCYA 1Y9EA 4A27A 2OP1A 1ULUA 3FNHA 2WYUA 4PLZA 1TT5B 4Q3NA 4KTTE 2DTEA 1WAMA 5HS6A 1E3WA 3OMLA 3D1LA 4JNKA 2RCYA 4AJEA 4KWIA 3JQ6A 4L4RA 4MKZA 2CVOA 2Q1SA 1B8VA 1ZSYA 1C0IA 2RH4A 3A9WA 3AI1A 4E2XA 4GX5A 1DRUA 3NT5A 1YDWA 4BMVA 5A03A 1IOLA 4BNXA 4MKXA 2JD0A 1PJ4A 1R12A 5T67A 2CY0A 1LXCA 1P3DA 2V6BA 1QG6A 1DHTA 1GYPA 1I32A 2HDHA 4IIVA 4TKMA 4TRNA 4WLNA 1UR5A 4D0RA 2PY6A 5TIIA 1HWYA 3C24A 3C1OA 3JQBC 1HYEA 3EGOA 3TZKA 3KO8A 4E2YA 1LLQA 3BMNB 1MG0A 2AQHA 2ZYGA 5AXBA 4IZIA 2CNBA 3K6JA 4GX0A 1VL6A 1I3NA 5CEEA 1EDOA 2NNLD 3A4VA 1U3WA 4XJSA 2NLOA 1TA4A 2CVZA 3L9XA 5GY7A 4E30A 5F21A 4J0EA 3VH2A 4BKRA 4Y8VA 1JQBA 3DONA 2AE2A 1LDEA 1GZ6A 1HETA 4EITA 3GZNA 4GPD1 3TPCA 2HSDA 2V7PA 3TZQA 2YQ5A 1LRLA 3EY4A 2V6MA 2DC1A 4Y6SA 4MVJH 2E6UX 5AXDA 2NVBA 3DZHA 4NHEA 3ZNOA 1HRDA 3W6UA 5T8KC 2Y1CA 3GG2A 3JV7A 4Z0HO 2PFGA 4J1QA 4CR8A 1U1IA 3ZWNA 1SEVA 3M1LA 3CEAA 3EYWA 4IMRA 4D42A 4QO7A 2E49A 3E8XA 3C7AA 1RM5A 1K6XA 1PZEA 3GEDA 5TT0A 3Q1LA 1B3BA 1ONPA 4H7PA 4E13A 3VC7A 1AE1A 3P7MA 2Q2VA 3SC6A 3OIGA 4R9SA 1T2DA 2NV6A 1ADCA 5JY6A 2AEJA 1A9ZA 3ASUA 5IXYA 4R01A 4XWYA 3MOGA 4RJTA 4IBOA 5HBRA 3H9QA 4RDHA 4BHTA 1QYXA 1M6HA 4A5OA 4NDNE 5JAIA 2J8ZA 4CQMB 5A05A 4DPKA 1XKQA 4X54A 4XEHA 5CG2A 4GX1A 5CHEA 3CZRA 2OBNA 1PL8A 1UDAA 2J6IA 4NR0A 3GZ4A 4YJDA 5THQA 1LLDA 4CMEC 4B7CA 1WDLA 3L6DA 3BMQA 1NTOA 5KWEA 5G4LA 1NP3A 3KEQA 5JBIA 1EVZA 2EKLA 1O0SA 4GSKA 4K1LA 2VUTA 4BNMA 4DBZA 4J1TA 4WUVA 4CV2A 2YHIA 3JQAB 1PGOA 2CVQA 4D3FA 1D7OA 1F06A 3ROKA 3E9QA 1NWCA 3I4FA 3OP4A 3JYQA 4AL4A 4YR9A 4KDEA 1EE9A 3VZRA 3WLEA 4K6CA 4M54A 4P4LA 3ZU3A 2Q4EA 1ONNA 5TNXA 1PZGA 5TGDA 3F3SA 3DBHB 1LC3A 3AJRA 1HT0A 4Q3BA 4CM4B 3S55A 4YJFA 2VHXA 4GGPA 2CZCA 1RKXA 3OA2A 3QV1A 1VLLA 4HY3A 4MVJM 2W2KB 4EUFA 2J3IA 1E0DA 1SO8A 1GV0A 2O48X 2X5OA 4ALJA 5KOIA 1NPTO 1QXSA 4GQAA 1YOVB 1EQ2A 1N1EA 2JL1A 4XGKA 2NADA 1H9BA 1HL3A 4CMIB 3FR8A 3W8EA 4U0JA 1BVUA 4R4JA 3TFOA 4XCVA 4XIJA 4BL5A 1U2DA 2GZ3A 3Q6IA 1ISIA 4R68A 2EGGA 5COAA 4D3DA 2NTNA 2RH8A 2FWMX 2YJZA 2Q45A 3GC6A 3ETGA 2Z1NA 2B69A 3KXDA 1ZH8A 2J3JA 1LSOA 1NWHA 5TQVA 1JVSA 1Z74A 4IJKA 3KVOA 2JHFA 5HRUA 1NFFA 1UP7A 1ZXBA 1ENYA 3JQ8B 3JTMA 3OICA 4FCCA 4UEOA 4YDRA 5AYVA 3VH4A 3S1LA 2EG9A 1I3KA 4WGGA 2YV1A 3LDHA 3HDYA 1DIGA 4WCFB 3I9NA 4DPLA 1N1GA 3KRTA 1R0KA 2P4HX 3LLSA 1PZHA 2X5KO 1DPGA 5JO9A 3PTZA 3DBVO 3OH8A 5JXWA 4NBRA 3ORFA 4FFNA 1VJTA 1P1FA 1KVRA 3ZWVA 4XJTA 1I8TA 1R6DA 1VSUA 5I9NA 4KWHA 5EQDA 3HFGA 3GNSA 3W8DA 2GF2A 2AXQA 2GGSA 3EMKA 3FTPA 3ZH2A 3FD8A 1B8PA 3H9EO 2ET6A 2WM3A 2NUAA 2ZCUA 2HMVA 3W1VA 5A3JA 2CF5A 2XXJA 4IQGA 4AJNA 1I01A 4BNVA 3B1KA 3H5NA 2VOEA 4PLGA 4W6ZA 5G0VA 1KIFA 3KYCA 4NH4A 2VHZA 4CV3A 4RV9A 2D2IA 5F1OA 3K9QO 4RL6A 3U5TA 3WS7A 2PKRA 3ZV6A 1B16A 1K6IA 3PPIA 4Q3EA 4ALNA 4YT8A 5KVCA 4A10A 2DQ4A 4FGWA 3EDMA 4IPTA 3H8VA 1Q1NA 1HLPA 3PHHA 4Y9DA 5JMPA 3RUCA 4LMPA 3S8MA 3FSRA 2FY8A 3KYDB 4WK6A 5L95A 1VI2A 4RVSA 1NR7A 4AG3A 5IZCA 1OMOA 2B83A 4Y6RA 5KVQA 2WWRA 2WDZA 3WGGA 2BHLA 3PP8A 4NBUA 1ZVMA 1PJLA 3AOEA 1CQJA 4W9NA 2GR9A 1P1KA 2ILTA 2IZZA 5IZ4A 3I9OA 1N9GB 4NFHA 4WJZA 5L3ZA 3ZNNA 1NPYA 2NVWA 3IAHA 5I7EA 1PJSA 3GPIA 4QTZA 1RYEA 1K3TA 2B4TO 3GLQA 3GAFA 4CMKA 5L51A 3JQDA 1NVTA 2I6TA 2WYWA 1E3SA 3GR6A 3ZNPA 4XYBA 3VPHA 4ZD6A 3HN2A 3TF5A 3DBRB 2WD8A 2G17A 3GMDA 3CPSA 4BO2A 4BVAA 4Z6KA 3V8BA 3DZJA 2BGLA 4WLOA 3WTBA 4CM1A 5B4UA 4B7XA 5A02A 2EERA 1U5CA 4KMSA 2O7QA 4DYVA 5JE8A 1B14A 4IJWA 4RF4A 3TFQA 3UF0A 4EJ0A 3ITKA 1T24A 2PV7A 5DBIA 1G0OA 1JWBB 1C14A 1E5QA 1W4ZA 4ALLA 4Y98A 4XRGA 4L4SA 4ZN6A 2AW5A 2BI8A 4RF5A 2HMWA 4D45A 3C8MA 1N8KA 3AFMA 2VWQA 4KQWA 3BA1A 3RUEA 1U3VA 4AJ2A 5IXSA 3GVPA 3GF4A 3AM5A 4YBZA 1J0XO 3GT0A 2PKQP 2P5UA 2GYYA 2P9CA 2Z5LA 4PG7A 3HB5X 1E7YA 3WBBA 1R66A 3OQ1A 1I3MA 1VPDA 1IPEA 3W4IA 3SEFA 3TZCA 3SJ7A 4ZVVA 2X22A 3GH3A 3GVIA 1VL0A 4JXKA 4E3ZA 1IY8A 3IMFA 5ER6A 3GRKA 1A7KA 1WZIA 2B37A 4DLBA 1SEPA 3CSDA 2Q49A 2JCVA 3EAGA 3GNTA 3NX4A 1E6EA 4GKBA 1KETA 1V3UA 4OH1A 4RF2A 4BO9A 4JK3A 1GQYA 1X7HA 1YQXA 3ICCA 2CUKA 3AY3A 2X8LA 1GTMA 3GA0A 4TZKA 4D0SA 4O59O 1FF9A 4OIMA 1LRKA 1LNQA 1XHLA 2B4QA 2QRJA 3ITDA 1YB1A 4ZRMA 4EEZA 1F17A 1GADO 1JA9A 1C1DA 1MFPA 3BMCA 3D5TA 1Z7BA 3NTRA 4XB1A 3ONDA 4ESOA 4Z3KA 1OFGA 2HJRA 3VVBA 4U6SA 1EK5A 4O63O 2EJVA 5EERA 4OXYA 1M6WA 3QRWA 2O3JA 3JD3A 4WEQA 4A7PA 4IY1A 1ZMTA 8LDHA 1MG5A 1R4NA 3V1YA 4L4XA 4KZPA 4XYLA 1WZEA 1CERA 1JKFA 3HADA 4E5PA 5J23A 3GGPA 4DVJA 3LC7O 5I8ZA 1P1HA 5DT9A 4CM9A 3BTOA 1UXGA 2BFOA 4YT5A 1U4OA 4QO8A 1DSSG 4AJOA 1ZK1A 4L75A 1YQDA 5IG2A 1M66A 4MP6A 2E4AA 4DYDA 4EGFA 1BW9B 3WMXA 4DMMA 1NFQA 2NSDA 3W8FA 1HE5A 2AHRA 2VYNA 3CIFA 3F47A 3L4BA 4ND5A 4CM5A 4IGEA 3DMYA 1HXHA 5ICMA 2UAGA 2JD2A 1Q7GA 1M67A 4M1QA 2PTGA 3AI2A 4B4OA 1PWXA 4FBGA 5I7VA 3RUDA 3H6KA 1KEUA 5G4KB 3F4BA 4MVJE 1HDYA 4EUEA 2SCUA 3BZUA 4MPDA 1U3TA 1BRMA 2D5AA 4R41A 1SNYA 2Z95A 3OIDA 2DBQA 1XQ1A 5EMHA 3RSHA 3UVEA 4EUHA 5K6AC 4J7CA 3PXXA 4PVCA 1JLLA 3BHJA 4OGWA 2ZTLA 4HFJA 2FR0A 1XR3A 1PJQA 4OQZA 1GDHA 1UXJA 2DBZA 3C85A 3N74A 3PJEA 4GVLA 2YV2A 2VZ8A 3OJOA 4DIBA 4DPMA 5CFZA 4R69A 4M8SA 4RVUA 1BDMA 1LC0A 1H9AA 5TX7A 1H2BA 3DHYA 2EP7A 3ABIA 3HZZA 4FC7A 4BGUA 1GEEA 4LW8A 2ZYAA 4GH5A 1ZZEA 3WJ7A 2GZ2A 5L40A 1N2SA 4IM7A 3AU8A 3DZIA 4HBGA 4NJOA 3RUFA 5HS4A 3ZWOA 5DOVA 1YDEA 4FN4A 4E12A 2CD9A 3NGLA 2J5RA 2UUPA 4NU5A 4RVHA 4CV0A 3I9JA 1Y6JA 2UUOA 4JJIA 1UUFA 4J3FA 3D0OA 3RC7A 3HE3A 1K0UA 3GOHA 4IMPA 2RIRA 3MTGA 3QWFA 4KUHA 3VAZA 4B79A 1T26A 5I8WA 5CEJA 1KVUA 1CIVA 1E3IA 3JSAA 3OEYA 1EVJA 3S2IA 3H2ZA 1P1RA 3NAQA 3RC9A 4KUEA 4W99A 3I83A 2BGMA 1A5ZA 1LDNA 2BF7A 3HQ4O 3COSA 3GGGA 2X7HA 3DZBA 4IDAA 3RU7A 3OJ0A 3SLGA 2I67A 1MXHA 2DBRA 1ZSVA 4OOFA 1KEVA 1SB8A 1J4AA 1NQOA 3MWDB 3ON5A 5I7FA 4WOKA 2TMDA 5AQ1A 2A92A 2VN8A 2WE7A 3LC2O 3NRCA 1E92A 3O4RA 4IUYA 1VM6A 4XR4A 4JBHA 1NYTA 1KVTA 5JCJA 4AFNA 2BI7A 4Q3CA 4UUNA 1FDVA 2VUSA 1DB3A 3P2OA 1C1XA 3DTTA 1Y9AA 2UV8A 5JDIA 4JGBA 4R1NA 5C7LO 3PHJA 2ZYDA 4KP7A 5FFFA 3TRIA 3WQSB 2FPIA 4AJKA 4DRYA 2O3SA 4CUJA 3UXYA 3IS3A 4ND4A 3ZZNA 3NUGA 3H9JA 3E03A 4GMFA 2CDCA 4BNNA 5C7IO 3F5SA 3IC5A 1L7DA 4J1SA 1R4MB 4TMFA 1JU9A 4E2ZA 1V8BA 1BSVA 3DMTC 1NQ5A 3PWKA 3INRA 2JFGA 1MLDA 2P9GA 4K28A 4PCVA 3WYBA 2X4GA 1P1JA 1YL7A 2Q46A 2XPCA 4LVCA 4HWKA 1CJCA 4Y6PA 3Q2KA 3WSVA 3IKTA 3I3OA 4LN1A 3ZHYA 3H5RA 2C7VA 1OC4A 3TZHA 4II3A 3KOUA 2P4QA 2W2LA 1CEQA 4NQZA 1ADBA 4BMSA 4FDAA 2H9IA 3ADPA 2VRCA 4XR9A 3E5RA 1A71A 1NVGA 1TLTA 2FRDA 1N5DA 4YAKA 4IGFA 4D7AA 3PI7A 3S2FA 1XU9A 3D4NA 4IINA 4DBVO 4MO2A 3QVOA 3QVTA 3QE3A 2VRBA 4NFSA 3DWFA 1EK6A 2AMFA 3GUCA 2NU8A 1D4FA 4BO0A 2HMSA 3P2YA 1YVEI 5EINA 1GR0A 4C4OA 4JCOA 4YJHB 3SC4A 4J7UA 4W7IA 3PQDA 3JCZA 4QT0A 1DC5A 4FR5A 5LCXA 4D79A 1LU9A 1Y8RA 3EUWA 4XX0A 3JQGB 2Z1MA 4N54A 4ZQGA 4AJLA 2XAAA 1JAXA 5F5LA 3O8QA 1Q0HA 4TRRA 2BGKA 2QRLA 1ISGA 4ITUA 1XG5A 3WIDA 3D64A 4HADA 1I2ZA 3VKVA 1YB4A 4NU6A 4CM6A 2POQX 2UVDA 4UUOA 3RASA 4DQVA 4UAGA 4CL3A 5FF9A 2P5YA 4I1IA 1EE2A 4YPOA 2QHXA 5L45A 1BMDA 1EQUA 4XDZA 3LSYA 2HU2A 3H65A 3LT1A 5CDGA 2DFDA 5A9SB 1LJ8A 5DOZA 3VVCA 4I5FA 1AHHA 1O89A 3UHAA 4M55A 2VNSA 4FQ8A 1MB4A 1PGJA 4BKQA 1A7AA 1YL5A 4IXTA 1AXGA 3ZW8A 1ZJZA 4B7UA 5IFLA 4NG5A 2V6FA 3I9MA 2G0TA 2VZ9A 5L9AA 4HXYA 1VL8A 2EV9A 3B6ZA 2NVUB 1XGKA 1L1FA 5JFOA 5A4DA 2YDYA 4MP8A 1GCOA 4H16A 4KTVE 2Q1UA 3ZWAA 2CDAA 1HDZA 3V2HA 1EVYA 5IDQA 1CWUA 2ZIZA 3GPDG 3K5PA 4XZ3A 1J6UA 3I5MA 2AEMA 1ZFNA 1H6DA 3MJTA 3K2BA 4WCFA 1YGYA 3ETEA 4F6CA 5FWNA 3QWHA 1PIWA 2PR2A 3E1KA 3Q11A 2GLXA 2DFVA 1UZNA 3FRJA 4G81A 4D43A 2EWMA 1J49A 2JAPA 1KY5A 2IYPA 4CPDA 5AXCA 1RYDA 2WJPA 2NM0A 3K73O 4Q9NA 2DM6A 4JN6B 5DP2A 4YT2A 2FN7A 2OBYA 3TWOA 4BKOA 2NTVA 1UP6A 2IYOA 1ZCJA 3WQQA 1KOLA 3IDSA 4FW8A 1P0CA 4JBGA 3M2PA 5EIOA 1ENOA 4HX5A 2NU9A 4AJ4A 3ZU5A 5KKAA 1D3AA 1TB4A 4J4BA 3WJAA 2DTXA 3MJCA 4AJJA 4O6VA 3DZGA 3U4DA 2CSUA 1T2CA 1KVSA 1YBVA 1WNTA 1LTHR 4PRLA 5CDUA 4R16A 2EJWA 5K0ZA 4Q39A 4D46A 1PGPA 4BB5A 3OBBA 2D8AA 5JDCC 4MVJD 2OXIA 4CR7A 4JIGA 4WCDA 3WIEA 2C5EA 5L4NA 1QP8A 3HFSA 5L7TA 3RUIA 3I9LA 4WLUA 1PQPA 3FPCA 4GGOA 4DREA 4Z9FA 5HTOA 1NQTA 3D3EA 1NASA 3FCOA 3ZV5A 4CODB 2IEDA 4E5KA 1XIVA 2DKNA 4PLVA 4M86A 4ND1A 2Y05A 4PZEA 2ZB8A 5L4LA 3RUAA 4BO6A 4BNWA 5DP1A 4YAGA 3Q2IA 1NFRA 1VC2A 4RPJA 1GFSA 3RD5A 2C54A 4I8XA 1H6BA 2DLDA 4F3YA 2BMAA 1HTBA 4YVFA 1YB5A 4NBVA 4IDBA 2HMUA 1LDMA 4L76A 3DFZA 4OSOA 4KQXA 5MGBA 2QYSA 5DULA 5DCWA 2Y1EA 3S2EA 1I24A 5B12A 1JN0A 3D3WA 3JQ9A 1NQAO 2YZ7A 4LCJA 3PWZA 4XYMA 4EBFA 2HQ1A 4DQUA 1K89A 2IRWA 1UJMA 4CLEA 1U9JA 3SJUA 1PJBA 4ONEA 2FPPA 3GY0A 1P1IA 2Y93A 4XGNA 2VWGA 1IHXA 3DOCA 1IPFA 2VUUA 5I9MA 3G79A 1M2WA 2PD6A 3WYEA 3E6AA 1A4UA 3WWYA 4E5NA 2IEBA 1W6UA 2O3QA 4YRAA 2B4RO 3E5MA 5U1PA 2EW2A 3DBLB 1LUAA 4TKLA 1MFZA 3FHLA 2F1KA 3ONFA 3PQFA 3M2TA 3H9UA 3LK7A 3WGTA 4B8WA 3NTQA 4A26A 1VKOA 4NK4A 1YONA 1T1RA 4EW6A 1M76A 1VJ0A 5HM8A 4R3WA 4I5GA 2C2XA 4RGBA 1ADGA 3WGYA 1NBOA 3QVWA 1GYRA 2IZ0A 1ZJYA 3OQBA 4CLDA 3JYLA 3H4VA 1ZIDA 2B5VA 2EEZA 4J2OA 2O4UX 4P4GA 3MJ4A 4BNYA 4UEJA 5BSGA 5F3RA 2WE8A 2BELA 4W4TA 3F1KA 3KEOA 2J3KA 2PZMA 4PLCA 2HLPA 5IDWA 1QKIA 3AUTA 3GG9A 1E3WB 2I3GA 3MEQA 2I66A 3NTOA 1I0ZA 4I9HA 3G1TA 4GI2A 4UUPA 1B7GO 1NM5A 3E9MA 3OETA 4IDFA 3RUHA 4R9RA 3E48A 1HZJA 1I2BA 2PGDA 2P91A 3WFJA 4CQLA 3TZ6A 1V35A 1MV8A 3TOXA 3PGXA 5KNLA 1XYGA 2ZQYA 1P74A 2HKIA 5HA5A 4BO1A 1H93A 1MGOA 2BFAA 3KLPX 5H83A 4TRJA 3O26A 4J43A 4OXKA 2EKQA 1PS8A 4J9UE 1UDCA 3CINA 3FNGA 4A0SA 4PG4A 1ZK2A 2ZJ1A 3FR7A 3FNEA 5EN4A 4TVOA 3QLJA 3F5QA 5KKCA 5TC4A 3FBGA 1ULSA 4CUKA 4Z0PA 3KZVA 3GVHA 3IP1A 2HK7A 4BNJA 1ZXLA 1P45A 3PLRA 1PJ3A 4NMHA 1P77A 4QX6A 1OZAA 3Q3CA 4UVDA 2R2GA 2H1SA 5DN9A 1GV1A 1AGNA 1E7SA 1RJWA 2Y1OA 4PG5A 4PN3A 2WYVA 2VOJA 2RBEA 5G0TA 5FI5A 1ENZA 4J4HA 4DLAA 1UH5A 1MA0A 4O1MA 1Z75A 1X1EA 2NQTA 3PK0A 2VT2A 4MIYA 3ZWCA 5JW6A 2VYVA 4R5HA 1SCUA 4P38A 1KY4A 3BMOA 4JJGA 5AOVA 1Q7CA 2VWPA 1H94A 2WD7A 1Q0LA 2Y67A 2YFHA 5BSEA 3DTYA 3I1JA 3C1AA 3DQPA 1PS9A 3DOJA 1YJQA 1T2FA 4UREA 4XQ9A 4QEDA 4BIIA 4HV4A 1QORA 3OF2A 1IHYA 4AJIA 2TMGA 3JYOA 2X0IA 2PH5A 4FOSA 4TWRA 3N7UA 4NIMA 1QYVA
chains in the Genus database with same CATH superfamily
3LAWA 1P5JA 2A7XA 3EHEA 1Z5GA 1XHEA 3SVZA 4TKZA 4BLPA 3DCJA 1MUUA 3OOYA 4EJFA 5LQUA 1Y5RA 4ESHA 4HLUC 1MNAA 3ENQA 3L0ZA 5K0TA 4EW1A 4FONA 1KRHA 2M2IA 4WZAA 5MF6A 3DLAA 3WNVA 4H7DA 2Q1TA 4MNTA 3C3DA 3G68A 2OZEA 2IXDA 4PBTA 7MHTA 3KQOA 1GQ2A 3RFCA 1E1YA 3D3NA 1GPWB 1G6HA 1UBLS 2P2YA 1H1TA 4MWSA 3BD7A 1T5LA 2HNKA 4C08A 2YTZA 4J1TC 2V9PA 3S1AB 4CKEB 2GS9A 2HOQA 4ETNA 4F45A 5B36A 2P90A 4LMRA 2C7PA 4EHIA 1LX6A 4IWYA 5FI1B 1DLIA 4YB8A 3VR5D 4QGBA 3DV0A 1JHZA 1QRSA 1DIAA 3NM4A 1QVVA 4L28A 4G5XA 4YXFA 3UV3A 3ECCA 1ZDMA 2IHZA 3P2IA 4DHWA 2V0NA 3KD3A 1PEAA 1OBHA 4OTZA 4KH0A 3U9TA 4QGSA 2H65A 4ENQA 3EFBA 3WHPA 2AGVA 3HCCA 2COEA 1K6JA 2N0SA 3OWOA 4OJKA 5CDSA 5JRZA 3GIDA 5A9TA 3M4YA 3SYKA 3L93A 3VUFA 4UBMA 1BA2A 3PQ3A 3ZBUA 1BHJA 1LEHA 3X1JA 5KVVA 3GFRA 5FEMA 2JAXA 2ZIGA 1COZA 1Y48E 2Q8PA 4YJFB 1DCFA 1P2BA 4BLRA 2IXBA 3TIGA 3I76A 4YROA 4Z86A 2GSWA 2YXLA 5JS8A 1DRWA 4G3XA 5L3SA 1HEYA 3G8YA 3L6OO 3IKMB 4GDFA 3RIGA 4EG5A 3N0WA 3Q98A 4I1SA 3GCWA 3MJEA 3MRTA 1L7XA 4HMQA 4KO2S 4U8GA 5LYJF 1DBIA 1WUHS 4O0LA 5EIWA 4CVNA 4NPHA 4XFJA 4YS6A 3PQ6A 3DPIA 3E82A 4HGNA 4V0OA 1P8AA 3NDJA 3VYVA 2I3DA 2CVPA 4N0PA 2OY0A 3WLOA 4D8WA 4IJQA 5JSYA 4HAXA 2K2QB 1W5FA 3FB1A 1DUIA 2AFVA 3P9XA 1QIIA 1HQYE 4RA9B 3WWCA 5TIIA 3W77A 1NJ8A 1GPH1 3GUHA 3OIVA 3OU7A 4HH1A 4NBLA 1SZJG 2ROQA 5BV0A 1WR8A 3OJXA 1OI2A 4J91A 4MUEA 1KI4A 2X7JA 4LDPA 4QDXA 5C8YB 4NJMA 4ARCA 1OX4B 4F6RB 2LV8A 1YJ5A 2JHPA 4NCHA 1YAHA 3BRQA 3U48A 4IIBA 5J58A 4EYEA 4K1XA 5FWXB 2EBWA 4LQCA 3RRJA 2RGXA 1CB7A 1TT7A 1VECA 4KN8A 4WFJA 4ZVOA 3SR0A 3NHPA 4DQDA 1G21B 3IJPA 1E1NA 1GSHA 3PFIA 2CHGA 1KK0A 2WP8J 4MARA 4NYJR 4TX1A 1BVYF 3TW0A 2PWAA 2EFYA 1UT6A 2NO9A 2X9NA 3DWGA 3EXHC 3LIIA 5J1TB 1W76A 1FSFA 3RPEA 3QWIA 3WO1A 2C07A 2HWUA 1QONA 2IHYA 4G0XA 4J16A 4MH0R 4Y18A 3VAAA 1TJ3A 2GRAA 3DEZA 3O1JC 3GVXA 4S3MA 4F1JA 6ADHA 1JW9B 4XB6B 3ZIAA 3L0CA 1KSFX 4FFRA 1ZYUA 5E8RA 4ZC1A 5GZ1A 1FSPA 1BDBA 3NTLA 1ZISA 3R40A 3UTDA 1Z88A 3F49S 1TK9A 4I8IA 3VZQA 1M2OA 1UKYA 1XVVA 5BY2A 4C3UA 1ORTA 4KZKA 2J33A 3TGPA 3L0DA 4ZU3A 1LY1A 4ZEMA 1A9XA 3E1SA 4JKYA 1YK0A 2NUAB 3INTA 4IS3A 1AMNA 4LE2A 2R7NA 2J3HA 1VL5A 3JD4A 1OREA 5DYTA 3C70A 1B6RA 1L2TA 3GMSA 5TMPA 3ENKA 4OAQA 3NANA 4GYKA 3WRXA 4CG0A 3E8MA 4NYMQ 2F48A 2KJQA 4PC6A 3DMGA 4RVCA 1WOMA 3UB2A 2PL1A 3K8ZA 2BGIA 3NDRA 4GWLA 3CZMA 3LUHA 1CUJA 1A9PA 1ZA1A 4BU0A 2Q5EA 3GBPA 1T6ZA 1YXMA 2R6R1 3V8EA 4MQMA 2XMQA 4ZZ1A 2GUGA 1TKAA 2GD6A 3BGSA 2GK6A 3GDFA 4GKAA 4W63A 4XDYA 2AK2A 3Q0TA 4K9QA 5F1OA 4IJVA 1RRMA 3WK8A 4CLOA 2GDJA 1K8YB 1F51E 2O8VA 4BV8A 4YJGB 1UBRS 2A4KA 4U1RA 1FFXB 1N2XA 3HKDA 5E7MA 5LXTF 1QK4A 2YY7A 2YRXA 4QTUB 3OE5A 4R7TA 2GT1A 2HQRA 2CBGA 3DVLA 3RVQA 4ZHQF 3SNKA 2C7BA 1ZXXA 3B1FA 3DCYA 3Q8KA 1JLKA 2VO1A 5A3VA 3NV7A 4R8RA 2DUWA 1G5IA 3ZQJA 2ZR7A 3CVVA 2XZTA 2ST1A 4JOSA 4BTEA 1XALA 1OXVA 2ZSHA 4NZ9A 4JU8A 1TQ8A 5CVCA 2XBMA 3T9BA 1YRWA 2AA3A 3LPAA 4NG4A 3PR2B 2O8FB 4JUAA 2V7WA 1QV9A 1BCSB 2WA1A 1GDDA 3AEZA 4JT8A 4DCSA 1RXWA 1O0BA 3PHLA 2VDRB 2JBHA 2AOVA 2WQZA 3EPRA 3AHFA 1ADFA 3H8SA 3KZCA 3FBWA 2ASVA 2PKCA 4YQYA 4C6TA 2ZUBA 4L27A 1UXKA 1U0TA 3FPJA 2H2AA 3K31A 3LYUA 1HYHA 2Y99A 4JJFA 1N0IA 3GGOA 3PNPA 1E3LA 2QMYA 3ABZA 3GJXC 3OI7A 4GSLA 1NIJA 4R2XA 3RWBA 3OAAD 3SS9X 3DYIA 4GOOD 4EHKA 1SCAA 4PFKA 1HDGO 4QECA 2AMVA 2JGJA 4AK9A 3HHPA 3LHSA 3NBXX 1L0BA 3K2IA 3IR7A 3RU3A 3VAYA 2QP3A 4U3JA 5IJ9A 4M4SA 2KB0A 3CUUA 1BKDR 2WVJA 5JEEA 3NHBA 4LNUB 4E08A 3Q3VA 5JMOA 3E35A 3F9CA 2WG2A 3P2KA 1WD5A 2PT6A 3WL3A 4EZBA 2GAAA 4GVXA 4KX5A 3SSNA 4UPEA 3GRZA 5I8PA 1MO6A 1SXQA 2R6HA 4GLBA 3NCTA 1GR1A 1RPTA 3C4JA 1QGUA 1XE3A 2JH3A 2O20A 4EG6A 2FPGA 4TUYB 3W9YA 1JFTA 2Q7DA 1VSQA 1YRLA 2BLLA 2GAOA 2IYWA 2PR7A 5AJHA 3T3DA 3U9LA 4D4GA 4UQPA 4GOMD 4LI0A 1UZUA 4N7JA 4DV4B 2FETA 4C7KA 1LI4A 4ZO8A 1JXAA 3CFYA 4WZBE 4NMMA 1U5AA 3WQHA 1FLDA 1ECGA 3HO6A 3LL4A 4M88A 3U7FB 4RPLA 4XJXA 1XA3A 1O96B 4I6JA 3IEKA 3TINA 5CB8A 1P6UA 5TEVA 3KOOA 4MP3A 4B3MB 4B44A 3W2FA 1HSOA 1UZAA 5B4TA 1F2TA 3HDTA 4GQIA 4GW3A 1IQPA 1OYVA 1PD0A 1SXJA 3FFXA 5H3LA 2R7KA 2R1VB 4RJLA 1DWOA 2XE4A 3E2MA 2B61A 2JI9A 5AW6A 2JHGA 1WXEA 2O8BB 1B93A 1P44A 5I7SA 3L1HA 5BOVA 3WLQA 5HUQA 3REFA 1DIRA 1E2QA 4BQQA 2ZBFA 1VL2A 4MX8A 2G5PA 3ZZ1A 4MK4A 4B6GA 2YJTD 4O2BF 2OVFA 2WC1A 1A2OA 4KIFA 1FMLA 1VB3A 3TJMA 2WWFA 3W5HA 4E51A 3EVNA 3BK1A 1C3XA 3IUPA 4R31A 2F9MA 3BD8A 3V4OA 3PFHA 5BUQA 1KP2A 1MX5A 4H1HA 4O5OA 2WKSA 4E31A 4P3PA 1VKNA 2OA0A 3GCGA 1TM1E 2Z6UA 4S1PA 4XYEA 1FFCA 2VRWA 3LO8A 5CX1B 4ZT2A 1C1DB 2B4AA 4QVIA 1R5JA 1VGRA 5CD1A 1R8QA 3AF3A 5FNVB 3ZNQA 4B9EA 5DWQA 4EZEA 2QN2A 3GN1A 1BMQA 1B26A 2J09A 3IV6A 4UNQA 1KYQA 1EA5A 3Q0EA 4UHEA 1QLJA 3RG8A 3ZCXA 1PHRA 4CMBA 5I7HA 5KOHA 1CU1A 1IULA 3HGQA 3ZIUA 4OFZA 3QELA 5ICFA 4BVHA 2DH5A 1E89A 1T4BA 2AYXA 3TN7A 3V8VA 4BX3A 3RVSA 2ZT6A 3TE7A 3W1WA 5B55A 1H05A 2H85A 4CQMA 2GQ0A 3U4IA 3K1JA 1QV7A 2IIVA 4BO8A 1ZPDA 5B1EA 5BWBA 4N76A 2BH9A 4H4CA 4UM9B 1Y9JA 5ICEA 1P33A 4CEJA 1ECFA 3E3OA 4R2LA 3F97A 3A14A 2VP9A 3MCZA 4MI6A 5ECWA 4IEFB 5K51A 3WL7A 4R3UC 1UIMA 5ENDA 1KH3A 2XTJA 3AEQA 1I5EA 1OSNA 5ESXA 3I6MA 4GZMA 3DAHA 3VC1A 4DVGA 1X42A 2BONA 4PYQA 4OL9A 2RFLA 1DC3A 3R0QA 5FIUA 1DAOA 3RGWS 1KKMA 1OB2A 4B46A 4V0NA 1SBQA 1TVKA 2QN6A 2X0NA 1BOFA 2QUZA 3JQAA 4LBWA 1EVIA 2QD2A 4AMGA 4UATA 2PA3A 4GPTA 1PTJC 1NONA 4M7WA 2QN7A 2BF4A 4Q01A 4WI1A 3EC7A 4MWGA 2O5CA 3Q7TA 3NBQA 5DLEA 1S9HA 5IAAA 2VXBA 4DUPA 3GJ8A 1IE3A 3HBNA 3QVXA 3ET4A 3TAXA 1U4SA 4H6VA 4CL0A 3EEBA 2CHEA 5I7UA 5MDHA 3DGFC 2I78A 4WK4B 1QP7A 4E2WA 5LC1A 5LJLA 4NCAA 4PRYA 4G86A 4JLPA 3OLZA 2EARA 3K30A 1V26A 2BW0A 1GN8A 2W2KA 4XJVA 2GUWA 2XOEA 3BZBA 2B1RA 4UHDA 4ZZ3A 4H1VA 1JT2A 1VMKA 2NQ2C 1A9YA 1ZWKA 4GI5A 5D3MA 5F4ZA 3ZX5A 1TTHA 1YJ8A 5J2TB 5HRAA 1BE0A 5K4GA 1PJCA 3ND8A 1HKUA 3M9LA 4KIWA 2VDQB 2O3TA 4CMEA 2VBGA 4LCEA 3F4LA 5KBYA 2YH2A 3RC1A 3ZLUA 1OLXB 2F6RA 4WN9A 1H0RA 1XQ6A 1EFRD 1GFIA 3HCPA 1XNRB 1MC4A 4PC2A 5A5FA 4HNTA 4BNGA 2H9YA 5KTSA 4Q6BA 4CT0A 4D8YA 4ZQFA 4L74A 1K1EA 5IBCA 3C6YA 2IY7A 2J46A 3GMIA 1CS4C 1CY4A 4H1UA 5K3DA 1BWQA 3BIFA 2IYFA 2VDWB 1NAHA 3G7SA 4NMLA 1GU7A 4WNYA 1Z33A 2P9BA 1P4GA 3EBPA 2R3SA 4BE9A 1WB6A 2FFAA 2OORA 3BQNB 3JQ8A 1KYVA 2CNWD 3KPWA 4FSHA 1YL6A 4O4JB 5FI0B 3DMNA 1MQ8B 2IKSA 3B6EA 1L5NA 2XCIA 3L2OB 4WVFA 2AD5A 2P1DA 3KHUA 3OCCA 2XADA 2BEWB 4HN9A 4P3XA 1UKBA 1K7SN 5ILGA 2WY2D 4E7OA 1IM5A 1T8SA 1P72A 1Y8AA 2QKYA 3AEUA 3GLGB 2UDPA 4ZGWA 2W4QA 3AM1A 3KL4A 1H8ED 2OL4A 1P7PA 5HYVA 4WZAE 2GVZC 1SHZA 2QNIA 2FJ0A 4TSKA 5D8DA 1LB1B 4MS4A 3LWNA 4Y30A 4Z99A 4ZAWA 2V9ZA 4CTKA 4YPFA 3VSEA 5FBVB 3EXG1 1X7ZB 5ITSA 2XR1A 1TEXA 4O4HF 4DR1B 4GVPA 5KO2A 4RQAA 4D02A 5DM70 1XEXA 2JATA 3LHFA 2IS1A 4RK7A 5ILOA 1NHGA 3ET5A 4IVNA 4M9RA 2QORA 1NYQA 2MCFA 3C43A 4OJQA 2IXAA 4HUJA 1XMJA 4PN7A 1IRIA 3LRTA 2FN8A 1OBFO 1R1DA 2VCEA 4DGSA 4LMAA 3IKVA 4MVJF 9GPBA 1T15A 3S7ZA 4HDMB 2BMDA 1CTQA 3KUCA 4WGFA 3VSAA 5ALEA 1Y6FA 4PHCA 3UW3A 3DAOA 3C5VA 3OIFA 4HH4A 4WE3A 4C88A 4ZCTA 1J2UA 1KFBB 1ISHA 2CXPA 4C3ZA 1QPBA 1TCAA 4MIOA 2ANCA 2XNHA 1U2GC 3SVTA 3I5UA 1E9FA 5J4HA 4KJXA 2Z5VA 1HDEA 3FCUB 4N0EA 1WKVA 2WUGA 3Q72A 1TU4A 2PDAA 3ETLA 3N2ZB 3GPCA 5ITZA 1RWOA 2GO1A 2QVZX 3MIIA 1ILEA 3RG2A 3B51X 4MJLA 4PX5A 1FVFA 3SU8A 1E2IA 2BMJA 4UCWA 5A0VA 1YQ9A 2QRGA 4RMJA 3D7MA 1PG2A 2B9EA 1XMPA 4XIIA 4Y9RA 4AUKA 4WLEA 2QDKA 4DV3B 1XLTA 4IS2A 3LE8A 4CLHA 4IVQA 4G0ZA 3ZC3A 3TD6A 2GEJA 3FY4A 4V2UA 5COBA 1M2EA 5DBFA 3NAGA 2RAVA 1L5GB 4GNRA 2NP6A 2VQSA 3KJGA 3FPSA 4RQTA 1DFHA 3G7UA 1NUSA 4OP3A 2WHRA 4B6SA 1V16B 1ZSNA 3NIBA 2J5QA 1SR8A 5CH8A 4RV4A 1JJ7A 4QYWA 4XPIB 3OZTA 2ZJ8A 2AFHE 2WVAA 4UD2A 4UU7A 2NWQA 4I0WB 5D3ZA 4A8JA 5LLTA 1P6XA 1E9RA 2IFTA 4M21A 3DR3A 2YW2A 3ZY4A 5FWYA 1GL3A 3JAWB 4M3NA 1BXKA 1RWWA 2J9GA 2MINB 2ZZMA 1TAQA 3TW4A 3DBRA 4IDCA 4JGGA 3WLHA 3BFVA 4BNKA 1I7LA 3FGNA 2XB6A 4LGVA 3TIVA 2C2OA 1XDWA 3KUXA 4Q6WA 4QQNA 3K70C 2WFZA 4WXHA 5F73A 2B8JA 3R0ZA 1QJCA 4Z9YA 4YUXA 2GYWA 1NSTA 5GGXA 2WTXA 2FWPA 3AESA 5JCOA 4KI7A 3WIBA 3QFTA 2P1RA 3G2NA 3SCZA 2HK8A 2IDKA 3GJ3A 3AUUA 2VIIA 4IZHA 1UFVA 1ZJWA 821PA 3V2GA 3L8HA 4OXNA 3R3HA 2XKJE 3KTAB 3AY6A 3K1AB 3T3MB 4ZGBA 4C7OA 2NU8B 1LS1A 4XA8A 5EE3A 5F76A 3DP9A 1YZFA 3D5EA 4KQGA 5TQ0B 1D1TA 4G8DA 4C7XA 5DNYB 3EPHA 2W00A 2EKZA 1MA3A 1D2EA 4LZPA 1PEKE 1Y8RB 2FB9A 3OECA 4WAUA 1P5HA 3QG1A 4R9UC 4XD2A 2WAXA 3KSDO 4XOIA 1EP2B 4YRPA 3B5EA 4KBYA 1E1LA 4N5NA 3SM9A 1U94A 4RVOA 4ZRNA 1LKZA 1PJAA 4ZTUB 3BFPA 2HA0A 4U7GA 1HPLA 5DYYA 4M1TA 4YO8A 3U31A 2PKQO 2JCGA 2O2DA 5BVHB 4QAJA 5DM0A 2EZ9A 1FNSA 3AL3A 4W7SA 4FFBA 4PY2A 4BNLA 4DJTA 1QR6A 4II7A 4JR0A 5FLYA 4DR7B 3E9NA 4PIVA 3Q40A 4UHFA 1UWVA 2IU6A 2EQBA 3BWEA 2HRBA 2Z98A 3L07A 1NLFA 1TLLA 5PGMA 3MBOA 3W4JA 5EPOA 2WJJA 4CKBB 3ILSA 4URWR 1Z0FA 3KV3O 3CBQA 1Y7TA 1BMFA 4H0CA 4J7XA 2GPTA 4QQKA 2Q4TA 4ZYLA 3D6NB 1P2SA 3AR6A 1JIVA 1P3JA 4IKOA 2RKOA 2VDJA 1NBME 2BP7A 2F7SA 2WFLB 4LZNA 2VLBA 2YC4C 1XNGA 4MA5A 4P84A 2XGMA 4YIKA 5IMBA 4UULA 3ROQA 2AYZA 2OYSA 4V02A 5EZYA 3HMQA 2LIPA 2YXEA 5TRTA 3RW9A 5IUNC 3C6KA 5IUJC 3K05A 1SHLA 3NWPA 3TJZA 2EF1A 1OAKA 5JAZA 2CLSA 5CVDA 4EY7A 3HO1A 1Z36A 3OM9A 4DC0A 3AK4A 5ERXA 4RTPA 3GLUA 5JAQA 3W5SA 2LRHA 4FM9A 1T0UA 4C14A 4RLHA 3EA0A 4NULA 2BLNA 5C3UA 1JG1A 1TKCA 3D5QA 4BGIA 3D0QA 5BSFA 2BZ1A 1OGJA 1XRMA 2E21A 4Q9HA 5AJXA 2FEXA 2ZPTX 3N2LA 1CRWG 3R5JA 3O0DA 5DX1A 3GLIE 3THWA 2OG1A 2XOXA 1FP4B 4OXIA 1C9JA 4MUNA 1MX1A 1T9KA 2YNMC 3IP9A 4MUMA 3O84A 3RV4A 1Q16A 3RCBA 4ZOCA 3WP1B 4RLFA 3GLGE 3GJSA 4B2PA 5THKA 3CJQA 5AKKA 4DG8A 1DINA 4QPDA 2R8YA 2M9MA 1QSGA 2YWBA 3GZNB 4E5SA 2ONJA 2GJ8A 3L0YA 4YP1A 4S1WA 5HJ2A 2R85A 1CY7A 5C31A 2YKGA 1JPUA 1CDZA 1BW9A 3C39A 1SRRA 3PBKA 1DQSA 1LS6A 4IGAA 5KNCD 3PQ5A 2DF8A 3TKAA 3DUFB 3FCCA 3UJHA 5B37A 4PWZA 1WMAA 3QW2A 2DLCX 1F7UA 1WKBA 4KWCA 3K71B 1J09A 2NU9B 1DQZA 1VIYA 2OD9A 4QUJA 3TS1A 1LPOA 2X8BA 2DUUA 1JA0A 2HUNA 3VYTB 5JBNA 1CLUA 1E3QA 4FCVA 4ZI7A 1PNTA 4Y9TA 5AKJA 4B32A 3FFWA 2V7XA 2IIQA 1Q50A 2VJMB 2WU1A 3E1GA 5LZ7A 3ZLVA 4B71A 3V4RA 2VI5A 2NSHA 4CMGA 4GM4A 1XKTA 3FNFA 3WG9A 4KHPB 2GBLA 1SXJE 2QW8A 3SXJA 5JIBA 1I4OA 2HRCA 4LYDA 3RU2A 3T0IA 4ER3A 3QYPA 1K6EA 3ZKWB 4D44A 1QLWA 3MT8A 1KHHA 4FOOA 2H3HA 3LNTA 2HJSA 1W0CA 1DG3A 4TS3A 3H6HA 4KE6A 3O93A 4HD8A 2C4HA 1F0NA 1QV6A 5CHYA 5B3AA 4U2FA 3W2IA 1KSJA 1D5WA 2YVUA 4MOWA 3C98A 4R2HA 5GV7A 3IEMA 2DR2A 2VQ3A 3HEBA 2QMEA 2O8NA 4EYOA 2WVGA 1DRJA 1RM0A 3S8EA 2NXNA 2OCAA 2HSJA 2QDXA 4KAAA 2Z3WA 1IY0A 1G3IA 2ADMA 2OV8A 1J2TA 1KYTA 3TIIA 1K4KA 1UXOA 1M8FA 4TRMA 5KYYA 3QOYA 3OCYA 4DM7A 2IOFA 3HR7A 4INOA 2PWYA 3H19A 1EDDA 2IYZA 5AK3A 2C98A 1WV1A 1E99A 2A8YA 1HZZA 2AOXA 2H6EA 3IV7A 4L0MA 4OKNA 3CVWA 2WJ6A 4A0GA 5CDTA 3A6KA 5D6NA 4Y6LA 3UBTA 5YASA 4GWGA 1UBMS 1W8IA 2EL9A 2X0KA 5IAGA 3RHFA 4TQ9A 5TMBA 2B0JA 3B60A 4GZ5A 5E9JA 1LPSA 4JJEA 5EXDA 1LVGA 2AQKA 3ZV3A 1WTAA 3VKGA 3VPSA 5EGNA 1V96A 4EAAA 3O47A 4ZV9A 2KW5A 2CJPA 5AKZA 1OIXA 3WRVA 1W88B 2O0LA 1FW8A 2Y9PB 3GQVA 3HUDA 4DS3A 3FPGA 1E3EA 3COVA 4QD3A 5HF9A 3BAZA 3D2BA 1LVHA 1GPDG 3TNFA 4ZVUA 1P2FA 1V4VA 4BE7B 2C9OA 3D2CA 2BTQA 1MABB 4FFOA 4QUHA 3G0HA 3BIWA 1GQQA 3A06A 3KTDA 3M34A 1AMOA 1Z3CA 1SQFA 3MG9A 3DZFA 3GFTA 3VPBA 5KHOC 1Z39A 3NYIA 4XQEA 3HDQA 4X91A 4LXHA 2RBKA 3ZD8A 4DADA 1T3SA 2F3SA 2H1HA 2XBUA 3HJAA 4Y1RB 3D0RA 5CJJA 1OWMA 1J0AA 4HDOB 5CPFA 3R24A 2OO7A 3PIIA 2Q5QA 2F1HA 1ESEA 2PGLA 3MLAA 1W34A 3MWDA 1JTVA 4FZVA 2IYTA 4J7AA 5I7AA 5LFAA 1TVMA 1D1SA 1MEOA 3DEFA 4LHXA 2Q3CA 3DG9A 4BUZA 4BXOA 1F2VA 1TVEA 1WBBA 3Q7EA 2HZ7A 4XD7A 2LTAA 1RAIA 3IMEA 3B1JA 5ERYA 1UJ4A 1DX6A 3WQRA 2XB8A 4BLVA 1I4WA 2AWNA 2DJIA 2Q3BA 1GJRA 2X5NA 1TEVA 3FWKA 3I2JA 1RHJA 4PFSA 2XNSA 1Z6PA 3JVEA 4G26A 4X3CA 4LRSB 5FBHA 1U90A 1VB5A 4V0RA 3WDSA 5BNFA 1ID1A 2AF4C 2O52A 3REOA 3KFXA 3E7DA 1Y8ZA 1MOQA 2FR8C 1RCUA 1Y7PA 3R3UA 1KK1A 4GC9A 3OTIA 1JDUA 4JAVC 4L8WB 3TCXB 4PSDA 3CKMA 3W6ZA 1NUHA 5FBKA 1Q92A 1ZBDA 4RPGA 4ZO4A 4NARA 2O1SA 5HDQA 1IZ9A 4QBGB 3STYA 4AS2A 4EO9A 1Y4SA 3H2SA 5JLJA 4X90A 4TT8A 4OHOA 4C03A 2R47A 5ALPA 1R4MA 3RWMB 4CQLB 3UG7A 1UBCA 4KYTA 4S2EA 3COWA 5D1HA 1U8YA 2C7QA 1U0HC 1WZUA 1I2CA 1EBUA 1FX0A 2YRWA 4L73A 3SIWA 2ZAOA 2LKCA 3AFGA 3GGSA 5AD1A 1USWA 1FRVA 3FLAA 3G88A 3EVZA 5EJ2A 3KB6A 2X9QA 3PD1A 4YGYA 1OWPA 3QV2A 1D04A 5ENVA 1NNI1 1JX6A 4A03A 1IDN1 4B6FA 2E0IA 3Q9NA 3VHXB 4CN9A 3LGSA 2QZ9A 3UT5B 3RKSA 3HV2A 3LXRA 1XRNA 3QBJA 3R6GA 4OBWA 3V1KA 4N7BA 4AQYB 5KJ6A 1Q0UA 2JCYA 2XB4A 4P32A 3OF3A 4DMFA 2AOTB 1XZPA 3DLPX 3DHWC 2YZGA 3LGAA 4C2UA 2UYYA 1IZ0A 3OZCA 3WYFA 3SICE 3SXPA 1K7YA 4KDFA 3AKZA 3DC7A 4YX9A 2CXOA 1APBA 1WUKS 4UXJA 3DHNA 3NDIA 2ZJ0A 3DE4X 3T1NA 1TW2A 1PNOA 4N5HX 4MITA 1XO1A 1ZX1A 1KBQA 1HNNA 4XUDA 3R9XA 1SB9A 3G8CA 1B0UA 1I33A 4UVGA 1NLYA 1PX0A 1UAGA 3ZWBA 5GZ6A 1SXHA 5KYTA 3NJ8A 4BB6A 2CLIB 1J5EB 2C42A 3FMPB 1I9GA 3RFTA 3EAFA 2IT1A 2R8PA 3T38A 3U7IA 3JYNA 4HYEA 1AH2A 4D96A 2E6KA 4J0GA 1A72A 2Q6VA 4FIZA 2OEPA 4G5FA 2REQB 3VZDA 4EG3A 4EPVA 2WWYA 3TOCA 2GXSA 1CNFA 4NOMA 2PJZA 4HNRA 4UJ5A 3UKDA 2A9PA 1T2AA 1FYWA 3FCXA 5IUKC 1GRRA 3T7EA 4I4TA 3H7AA 3M5CA 2QJTA 4LXXA 2ZJYA 4QQRA 3LBIA 4P0QB 3EIUA 3RGGA 2P2DA 4ER0A 1J8YF 3MA0A 3G2MA 3G8AA 1OXBB 4GMDA 1Y5IA 3TLEA 3TQRA 1K9SA 4H3KB 1IHUA 2C4UA 4R5MA 2VP2A 5A9SA 5C8DA 2Z2YA 3UMMA 5F7JA 1OFIA 3FI0A 2L69A 4NCXA 1EH5A 3EQ8A 4YLYA 2BDEA 4LOAA 2YHUA 3U3JA 1GNVA 2O9JA 1GCIA 2HA6A 4GXQA 4JA2A 4Y1GA 3RBZA 1Y3AA 3HUEA 4ZVPA 3RTAA 4MMZB 3TNLA 4ZGGA 3CISA 4F8YA 4NBWA 3AF2A 4ROSA 3SC2A 3F78A 2QGFA 3B3GA 4RDIA 1G38A 2C2KA 3ZUPA 1LH0A 3TLGA 4PHTA 5CLJA 1AS2A 5JXIA 2Q2NA 3PUXA 5GONA 2WSLA 3Q85A 4RENA 5C34B 1RRKA 2VDPB 1NVFA 2L19A 3IFSA 3JALB 3KU4A 4JLWA 4CL2A 1UK9A 1KTVA 2GBCA 1NE2A 3HKEA 2V7UA 2D6FA 2OYCA 3MTQA 1E1KA 3OUUA 3AM3A 4OHVA 5CIWA 1NQXA 4RELA 4D9MA 621PA 2XX3A 3FN4A 4MGIR 3TSWA 2OAQ1 3OHPA 5JD6A 2POCA 1U04A 1SBIA 2QT0A 3AJEA 3KXIA 1CJVC 5IVDA 5JY1A 3WLSA 4PSAA 3U7JA 1KE1A 5B4VA 4B1FA 2VQFB 1F60A 4CF7A 1OH6A 2J1LA 1D2AA 1FXWA 3THXA 4LGYA 5E6SB 1KNQA 1Z28A 3VHQA 3MMPA 4QJBA 2RHHA 4RPKA 3UAWA 3JQBA 2G1UA 1D9ZA 5DGHA 4JD5A 1ONBA 3M3HA 1D7AA 3WSWA 2CV1A 1YNSA 1YBFA 2IP1A 1F8UA 5CX4A 1DJOA 1EWTA 2R25B 4X84A 2QF7A 4OQMA 3AM4A 5FJJA 4DTCA 3EDOA 1V71A 4NYIR 4F0JA 1FYXA 2R751 2B2CA 2ZRFA 2R6JA 1IVNA 3HFRA 3KUKA 4MKRA 3WV5A 3ZE1B 1YZGA 4CYMA 1FFHA 4F2HA 1EFTA 4KXVA 1HE8B 2IPAB 3IOBA 3DT8A 4F4HA 1W85B 3BCHA 3B89A 2MDTA 3BEDA 4F1KA 2PZJA 4I1OA 1P1BA 1XL1A 3G13A 3O38A 4FD3A 4Y2YA 2Z83A 2OQIA 3WK4A 1ACLA 1G8AA 1YIOA 5EHQA 4LRQA 1GUAA 5LYJB 3JAMA 2RAUA 1UQTA 2VJOA 2GN1A 5EE0A 4NOJA 5GOTA 5L7YA 1FK8A 1ZK4A 2AFIA 2C4NA 2LZ0A 5EWJB 5C1BA 3BMCB 5BSUA 1IB0A 3ZR4B 2R8XA 1CULC 1NA5A 3VZPA 4EPTA 3CMMA 1SXPA 5LMNB 2BFPA 3WGOA 5KSYA 4JQCA 1ST2A 4KFCA 5H4HA 4LYFA 1YU9A 1JJIA 1Z4LA 4MS3A 2FRVA 3ULKA 3N75A 3USCS 5AW3A 1SMKA 1B23P 3SKVA 2CMHA 3SF8B 9LDBA 5C37A 2I3AA 1XZNA 5JDCA 3UKOA 3NIFB 5IJZA 3HY6A 2PZFA 2VHWA 4KR3A 3BM5A 3MBIA 3TW6A 5CA1A 4DMHA 2G1JA 2PFSA 3ZV4A 1N7GA 1MZVA 1NAIA 4FMCB 4ZANA 3COYA 2IQIA 3BWYA 4RYDA 1Z5UA 1U11A 3VR2A 4C0AC 2X23A 2GO7A 1XVUA 4RA6B 3HB4X 2FR1A 1LLCA 4PGGA 1U6IA 3AF0A 5GADl 2QM8A 2H5JA 2IDZA 4MUHA 3FF4A 3ODPA 3C7CB 4D4IA 2C99A 2ZYHA 2BTOA 3PDHA 4RVFA 3OEHD 4YN3A 5J9FA 4EJ2A 4KPEC 3SOPA 5JJCA 1T5DX 1IAQA 4I2VA 1P7YA 3UWKA 3VR6H 3ZHSA 4BZZA 1Q0TA 1N78A 1SCDA 2FMXA 1RLJA 2Z9DA 3DO5A 4GZLA 5AVTA 4LDAA 4OH7A 1PEYA 1XTRA 2YUIA 3B82A 5KTKA 3AWDA 1NMXA 3GRCA 5J4YA 3DNFA 4N7RA 3RSOA 2ZSBA 4ZOAA 2W2LD 1E1MA 2FWNA 1EUDB 2QRHA 2ZJZA 4DMUB 4DA4A 1JFFB 4E33A 1X7GA 2QMHA 4UUBA 1RRGA 5EE1A 4KITB 4CM8B 1Z17A 1S8AA 1RWBA 3KSMA 1VJ5A 2YJNA 3F0TA 4FJ2A 8GPBA 2XZDA 4DOMA 4D9JA 5IN4A 4KR2A 4G0UA 3G9QA 1P2TA 5GMOA 5C4MA 4BNDA 1EIZA 1Y1QA 4DILA 3OTOB 3EIWA 1LPNA 1X0VA 1XRLA 2ZI9A 4G09A 2OP0A 1OKKD 1L1EA 3O6VA 4MCIA 5SZIA 4CIDA 3I73A 1MN6A 4ZJUA 1U8TA 2I6GA 4BV2A 1C9KA 1R16A 4W5WA 1F4LA 2CKMA 2KS6A 5C18A 1OR8A 1NI4B 4ZZ0A 2YJGA 4QTTB 3R9WA 2PVCA 1D6NA 1PR3A 3OC6A 4CTOA 1DLJA 5LXTB 1LRJA 1W47A 3IQDB 3AXSA 3W6NA 4O0MA 1KC3A 5CGQB 5CW1A 5WRFA 2OXTA 4ZHQB 2GNPA 3TNYA 4RZHA 5A62A 5JSZB 3A4IA 1QIGA 4PNHA 1N33B 3DE7X 5E95A 4UBNA 2R7AA 3QFFA 2A2ZA 2HPVA 4U9UA 3NVKI 2PZEA 4YQZA 3NBUA 2QUJA 2QM3A 2I9PA 4FFPA 1HDOA 1T2NA 1U7TA 3QPBA 1SC1A 2CYCA 2WYIA 4G23A 4G41A 1AN9A 2AUNA 4YA6A 3A6DA 4MAFA 4UAUA 1N3LA 1FUUA 1UJ5A 1Y9EA 4LBVA 2P2GA 4PYKA 5FBLB 4RZ3A 3FNHA 2ATIA 2ZVJA 4YAOA 4PLZA 1EFAA 3MWKA 1A9QA 5EKDA 1E3WA 4PAQA 4DCJA 4WCVA 4UHCA 2XWPA 3GRAA 3RK1A 4M98A 2JIMA 4M1EA 3OMLA 4LHZA 4DARA 1K4MA 4JNKA 2RCYA 4EGSA 4UTPA 1E0JA 1W5BA 5TQJA 1N2EA 1SKQA 1WXXA 3ENZA 3NR2A 4LC1A 5H3HA 3RTEA 5JV5A 1G41A 4JBNA 2FW7A 5ELLA 1TIKA 2Q1SA 1Z13A 2VEDA 5F9HA 5JNTA 1YDHA 2ES4A 4GX5A 1DRUA 1DRKA 1TYZA 2F90A 3IMKA 3NT5A 3IUEA 2GJSA 2DWQA 2BUBA 4LXQA 4MB0A 3AIIA 4TMWA 1N8NA 1PNRA 2HLDA 5K0NA 2JD0A 3F71A 1PJ4A 1R12A 4TL8A 4LQ4A 3KEGA 4EKGA 4D9IA 1OI4A 1GYPA 1I32A 1QG6A 3K72B 4TRNA 4D0RA 3KV1A 2PY6A 4BVJA 4C0XA 1JHOA 2GCEA 2VNIA 3A37A 2J67A 3KO8A 3TZKA 5CBPB 1NNSA 1UJ2A 2DRIA 2VQDA 3NHUA 5HIIA 2CNBA 1ZUNB 1VL6A 3HWWA 4R8KA 1EDOA 4XQ0A 3D3QA 3PUVA 1RI1A 5FTJA 4EG7A 5CEEA 4ABTA 3UMVA 1U3WA 4PYLA 2NLOA 1CY1A 1TA4A 1UK7A 3ZCSA 1E1RD 2IX3A 2H1WA 4EGJA 2IHJA 5F21A 3FXAA 4BKRA 4D9EA 4F2GA 4JUCA 521PA 4Y8VA 1NN0A 3DONA 4AD8A 5FLKA 1GGVA 2ORVA 5CXQA 5AT1A 2XQKA 1JR6A 2HSDA 4LOKA 3PT9A 3TZQA 2OZVA 2IPMA 2HF8A 5TGZA 2HSWA 4MVJH 1ZN9A 2E6UX 1LD3A 1RXEA 3DZHA 3I2KA 3JWGA 3LFTA 1UIRA 3PXBA 4NHEA 2KMLA 3TXAA 2UZIR 4ZI5A 3WMRA 4CG2A 4EY6A 2ODEA 1JHDA 2Y1CA 3F7OA 4RCYA 1RQ7A 4Z0HO 4AURA 1ICEA 5JAUA 4QODA 4CR8A 1T29A 5KYNA 4MGZR 1QF6A 1SEVA 2A9QA 3M1LA 1OYOA 4P3KA 3CLVA 4Y7DA 1ORIA 4O2BB 4INPA 4D4JA 3IQFA 4YUYA 5HIKA 2PPVA 3DO8A 3RIEA 3CVOA 1K86A 3E05A 3FCEA 4L85A 1V4NA 3QFSA 1XRRA 4H7PA 4E13A 3IVCA 1V43A 4ITVA 3IILA 3SC6A 4ENRA 3RVJA 3BKWA 3BBPA 1T2DA 1EVLA 1ADCA 1U0NA 1ZKDA 2NV6A 2PX3A 3EIXA 1A4RA 3GFSA 1T8PA 2Z5FA 3LHIA 4A16A 3VA7A 4LFAB 1E3DA 4R2MA 3MOGA 1KOGA 3BFKA 2VF2A 4TTVA 1J00A 3RVNA 3ND5A 3CGGA 4GI3A 2JS7A 3UGJA 3OIUA 2DCMA 3NOOA 1JSRA 2XODA 3DL0A 1J7KA 3BREA 1LBTA 1AS3A 1CE8A 3D4IA 2IH4A 4LJSA 3Q9LA 2H48A 2V4MA 2O2HA 3GRRA 4G8BA 4MCJA 3PXAA 1XX6A 1U3GA 5CHEA 2OBNA 1PL8A 3OWXA 2KLHA 1H42A 3NFYA 4QBHA 5HJ5A 1WCIA 4P5DA 2QA5A 4R2WA 1Y1KE 1XNJA 1CUGA 2RB5A 1QDEA 3L6DA 1KZGB 1KOJA 1QGDA 1NTOA 3B9QA 5KWEA 5ARDA 4D25A 4IG4A 2JIDA 2EKLA 2IOFK 2JFUA 3NHLA 4K1LA 2VUTA 4CKWB 3IPXA 1WMFA 3ZXSA 5BSWA 4RJJA 4J1TA 1VHJA 1TK2A 1KZ9A 1XAHA 1NGSA 5CVTA 5HM6A 2LBPA 1JG3A 4HTFB 4OQ4A 5IYZF 1OILA 3OP4A 2G9ZA 4JEUA 3JYQA 4WXEA 4AL4A 3ZCUA 3AVVA 4YR9A 2VDLB 3MAGA 2RK3A 1JP7A 1EE9A 2IYXA 3VZRA 1OE0A 2H08A 2FUG1 3ZU3A 5KYUB 4YWHA 1YTUA 5AH0A 4O2AF 3RS7A 3F3SA 2PSFA 5K3EA 2FUNB 5BQXA 1E0AA 2W6ID 2C5LA 2RHGB 2XYRA 4OJTA 3H4MA 3UA3A 1HKHA 1VL1A 2OCPA 3FKSA 1JR2A 1I0IA 4HV4A 2ZWPA 1Z4OA 3RVRA 4QIHA 1HQCA 1I51A 4KMOA 3ROTA 1RKXA 3OA2A 4HY3A 1VLLA 3I53A 4MVJM 3X44A 3ZUGA 1PP4A 2XXAA 4ALJA 3TXYA 5I51A 4LDNA 4GQAA 1X8LA 1YOVB 3DUWA 2JL1A 4AIIA 1S1MA 1SUCA 2NADA 4ZEXA 3P9IA 2ALJA 2C9ZA 3HB0A 5HKAA 3JWPA 1PZNA 3W8EA 5IKEA 3G0CA 4U0JA 1JMVA 4PC1A 4XIJA 1OFVA 5EMMA 4MLZA 1W29A 2KI5A 3CE9A 3ZHVA 4BMZA 2WIJA 1PWHA 2EGGA 4MYCA 5A4MS 2RH8A 2FWMX 5CGZA 5DI3A 1S0UA 2XGSA 3AEKB 2QMZA 1GZVA 3VR3A 3DMHA 5DRYA 2Q45A 2QAGA 3GFOA 3NP9A 1DG1G 1Q21A 1K7CA 2B69A 2ZSEA 2CZQA 1VLQA 1VPEA 2C5SA 2YV4A 2QXTA 4HEJA 1LSOA 1Y98A 4HWTA 1JVSA 1J42A 1EUCB