4DUPA

Crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
331
structure length
331
Chain Sequence
MSLPQEMRFVDLKSFGGPDVMVIGKRPLPVAGEGEVLVRAEAIGVNRPDIAQRQGSYPPPKDASPILGLELSGEIVGVGPGVSGYAVGDKVCGLANGGAYAEYCLLPAGQILPFPKGYDAVKAAALPETFFTVWANLFQMAGLTEGESVLIHGGTSGIGTTAIQLARAFGAEVYATAGSTGKCEACERLGAKRGINYRSEDFAAVIKAETGQGVDIILDMIGAAYFERNIASLAKDGCLSIIAFLGGAVAEKVNLSPIMVKRLTVTGSTMRPRTAEEKRAIRDDLLSEVWPLLEAGTVAPVIHKVFAFEDVADAHRLLEEGSHVGKVMLTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords quinone oxidoreductase
publication title Crystal Structure of a quinone oxidoreductase from Rhizobium etli CFN 42
rcsb
source organism Rhizobium etli
total genus 101
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dupA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4dupA01
1HDGO 3AFNA 2CVOA 1LDNA 1Z6ZA 3GUYA 3LLSA 4ROSA 2JD1A 3N58A 4J1NA 3EHEA 1EDZA 1P77A 4I9HA 3KSZO 4NFYA 4DIFA 1E92A 4CLXA 3E18A 1JKFA 1BW9B 2BRUA 4U8GA 5CHEA 3O8QB 1NX6A 4AJLA 4A26A 1ONPA 1N92A 4YT5A 3DBRB 1IHXA 1X7DA 4O1MA 1DIBA 3MJVA 2X7HA 5CPBA 1ISMA 1PZHA 1DIRA 4BO7A 1WVGA 2NM0A 3BMCB 3OJ0A 4RORA 2OBNA 4W99A 4Y6SA 1D1TA 5KVSA 1LDGA 3JD1A 3GDGA 3Q9UA 4WASA 5IN4A 1HEUA 2Y0CA 3SEFA 1GY8A 2HRZA 2I65A 2B36A 3TL2A 2P9GA 4YA6A 3PYXA 2X0JA 4ALNA 3PFFA 4R9SA 2GLXA 1XSEA 3DC2A 3NT4A 1NWHA 3KLMX 3WQQA 1HETA 1C0PA 3WMXA 4LRSB 2VOJA 1UJMA 2HUNA 2I6TA 1MX3A 3GVPA 3OQ6A 3ITDA 1PWXA 3ZHYA 1I10A 4I5GA 5IFLA 4ZRNA 5BNIA 4CPDA 1PR9A 4RLSA 5GY7A 3F9IA 8ADHA 2GN8A 4DWVA 3MJEA 3OIDA 1J6UA 5AXBA 3K9QO 3DMYA 3GVCA 3U4HA 4RVUA 4PG6A 1ISJA 3LYLA 1YDWA 4Y6RA 3D3WA 1MV8A 1EK5A 4DYDA 4PVCA 1I3NA 3JYPA 1SOVA 3EW7A 1U4OA 4J1SA 1ENPA 4ITUA 5TC4A 2VUTA 4AG3A 1BW9A 3Q3CA 3O8QA 2PZLA 5IZCA 2CF5A 1GV1A 3TJRA 4N54A 4YQYA 2J8ZA 2CY0A 4TRNA 3DBRA 1BMDA 4OAQA 3UCEA 3GPIA 3NTQA 4PZDA 1QP8A 2X4GA 1GV0A 3NT2A 4G81A 5COBA 3H2ZA 3BMCA 5HA5A 3LF1A 3DR3A 3VHRA 3OFSA 4K6CA 1LDEA 3FN4A 1ADFA 5JDIA 2JD0A 5IJZA 1W8DA 1SEVA 1B14A 3F6YA 1R4MB 1G1AA 3S2EA 4ZQGA 2NU7A 4Z3DA 4YR9A 2ZKLA 4RVDA 3BXXA 1LU9A 1QORA 1YVEI 5BT9A 2EEZA 1QYDA 2BFAA 2I3AA 4IJWA 1H6DA 3PZBA 3LF2A 3AM4A 3BMNB 2QZ9A 1I2ZA 3AM3A 3D4OA 5FF9A 1V8BA 1WPQA 4A73A 4NMHA 4AVYA 4E30A 4IS3A 3FWNA 1QYVA 2YV1A 4B7CA 4R1TA 1AGNA 2O3QA 1F12A 2FHSA 2O3SA 4HX5A 4R1SA 5K6AC 5K9ZA 1GZ6A 2Y68A 1JVSA 3MWDB 4AJOA 3VC7A 3TF5A 1NM5A 1ARZA 2WTBA 3L0DA 3D64A 3EZYA 4FS3A 1HDCA 1WDKA 2VZ9A 1GQ2A 4HFMA 4U6QA 3K31A 4YAGA 1KS9A 3GAZA 1YXMA 3LK7A 1E3JA 4NU5A 4R41A 3UAGA 1QLHA 1EK6A 2DM6A 3TZQA 1GFSA 4JK3A 4ZHSA 1ULUA 2AQ8A 3T4EA 2X8LA 3GK3A 4EYEA 5A5EA 1PL8A 2X23A 4Z9XA 4CM7A 5G0WA 4GKBA 1E5QA 3ZU3A 2CDAA 4B8ZA 5A1TA 1SMKA 1R4NB 1L7EA 4ND5A 4IS2A 1PJQA 2QRJA 4GLLA 4WLFA 1PJBA 3FF4A 4N5MA 3K6JA 3OQ1A 2Q1WA 5JY1A 2TMGA 3TL3A 1PL6A 3FR8A 4BNFA 4BNZA 2R6JA 3FPCA 2J6IA 4J3FA 1FF9A 3ZV3A 3U09A 4CV3A 3FNFA 3D4PA 3ZV6A 4R1UA 5C5IA 1I24A 3AJRA 4CR7A 3KZVA 3LLVA 3H5NA 1R4MA 2DTXA 2W98A 5ER6A 1LC3A 5F1OA 2J3IA 3HE3A 4ND4A 3DZHA 1BXZA 1YDEA 3QQPA 4E13A 5FYDA 5DOZA 2Z1NA 1LLQA 4IMPA 3NX4A 1Q7CA 1FDTA 4E5YA 1NXQA 1T1SA 1E1LA 4B3IA 3BMNA 5JE8A 3I4CA 3R3SA 2Z1MA 5EQDA 3ZI0A 5DCUA 1LRJA 1RM5A 4ONEA 1MG5A 3RFXA 4J2OA 1Y9AA 3V2UA 2JAHA 2YV2A 3R0IA 4HP8A 5L3ZA 4IJUA 1PJSA 3I9JA 3ZGYA 3NRCA 1A5ZA 3RSHA 2VUSA 4YJFB 1P3DA 5C7IO 1H2BA 1N9GB 3KB6A 5DDIP 1VKOA 3MOGA 5EIOA 2IEBA 4OIMA 1JLLA 4RZIA 4MP6A 1PZEA 4BKQA 2NTVA 4XR4A 5L4LA 2V6BA 4CMIA 4E0BA 1AHHA 1LDBA 4CV0A 1E1KA 1QRRA 4IDAA 3DTTA 5IDXA 4PLVA 3BTSA 4Q3BA 2IRWA 1R4NA 4JCOA 3F4BA 2OUIA 4E3ZA 3P2OA 4MIEA 4YYZA 4ZGWA 1ADCA 1E1NA 1K2WA 1LSSA 2E4AA 2GUGA 4HY3A 3JSAA 1FDUA 4TRRA 5IDQA 2FR1A 4Y8VA 4I08A 2E48A 1PQWA 2JAPA 4YJHB 3T4XA 3ZHBA 4YXFA 2FR8A 1ENZA 3OHSX 1KVUA 5JW6A 2YFHA 1ORRA 3BHJA 3U4DA 4CUZA 4DXHA 3K2EA 4A5OA 1YB5A 1RYEA 2CNBA 1YL7A 5T8KC 1I2CA 1QYCA 4GX0A 4E4YA 4J0EA 1MLDA 1R66A 3KYCB 5I9LA 4RPGA 2D8AA 2HMSA 4J49A 2O4CA 4I5DA 3QW2A 3S2IA 1B16A 2X9GA 1NVMB 5A03A 2J3KA 1FDSA 4BNVA 4UVDA 3E48A 1HYEA 3COSA 1U3TA 4XYBA 4A03A 3JQGB 4LVCA 1NHGA 1WW8A 2FZEA 5JAQA 1O89A 4JJFA 4NI5A 3UF0A 3E1KA 2R00C 4EUEA 1PJ4A 4PRKA 2EW8A 3DBLB 4TRMA 1BRMA 1DAOA 1MG0A 2VT3A 1DOHA 3UW3A 5HM8A 1LXCA 2VRCD 5EN4A 3VZRA 3JYOA 4MKXA 3L4SO 2FPGA 4GX1A 1LC0A 1PWZA 2RIRA 3L6DA 2UYYA 1O8CA 4TKLA 4YJFA 1LI4A 1N9GA 1PIWA 1Z45A 4U6SA 5JDCC 4Z3KA 3FTNA 3ZU2A 2W8ZA 2H6EA 1D1SA 1D3AA 3QWFA 4Y6PA 4DRYA 1N7GA 1IZ0A 2AE2A 3JD4A 3L9XA 2VZ8A 3G17A 3QHAA 1K3TA 4BO8A 3DZKA 3O26A 1JTVA 3DOCA 2ZB7A 1EVZA 5BSHA 3UGKA 1O95A 2CDCA 1CWUA 2GN6A 4FFRA 4ZA2A 2HMVA 1CEQA 1YE3A 3TSCA 2YV3A 2JHGA 5JY6A 1CJCA 1P1RA 3FD8A 1B7GO 3JQFC 4II3A 4Z0PA 3WGIA 4D43A 4B3JA 2HO5A 4YJHA 1Q7GA 2EIHA 4BIIA 1U4SA 4J16A 1LSJA 1T25A 2CVZA 3W6ZA 3HDQA 3WOHA 2QZZA 3PLRA 3DAGA 1C0LA 1ZK0A 3LVFO 2EGGA 1EVJA 2B83A 1VJ0A 3WR5A 3U9LA 3WWYA 3KYCA 3ZWXA 2C2XA 1DFHA 1KYQA 2Y99A 4NH4A 3VZQA 1I30A 4EBFA 2AA3A 3INGA 5TLSA 1Z73A 3WIEA 3HSKA 4EITA 2FY8A 1K5HA 3JQGA 3QWHA 3RD5A 2H5LA 2VWQA 3MJTA 4YVFA 5G2OA 1B8UA 2DTEA 2FP4A 1AXEA 3B1JA 3DBLA 1LRKA 1U2GA 2RCYA 4R3NA 2DC1A 1G0NA 3BIOA 1KBZA 4X54A 4JBGA 3F3SA 2YUTA 1SAYA 5CPFA 3VH1A 5EERA 1E5LA 3VPGA 3TWOA 3PIDA 3VPSA 1F17A 1E7YA 3DMTC 2DLDA 5L7WA 1PGQA 2PR2A 3ZNQA 1MXHA 5L95A 4KDEA 3MJSA 1XYGA 4WEQA 4Q3EA 2CD9A 3WLFA 4Q3NA 5TF4A 5ICMA 4IQ8A 2CZCA 4TRJA 2NV6A 2QYSA 1T4DA 1DC6A 4YAKA 2X9VA 1CDOA 3L77A 1U3VA 2OHXA 4XRGA 4L4SA 3SC6A 3KXDA 5I9MA 1LBEA 4DMLA 5HRUA 1R16A 2GGSA 1ZKMA 2WWRA 3V2GA 2PFGA 3GAFA 6LDHA 3GZNB 4RDHA 4W4TA 4B79A 3C3XA 4CM5A 4NK5A 1E77A 2G5CA 3TN7A 1Y5MA 4I9UA 1SB9A 2BMAA 2BH9A 2FR0A 3ZDFA 2Z95A 3F4LA 2Y1EA 2NUAA 3CXRA 4IXTA 1UDBA 5A4DA 2IXBA 3NT5A 3KOUA 5F1PA 3UCFA 4BO3A 1I3LA 4FQ8A 4WLEA 5B4VA 2FN7A 1CQJA 4PG4A 1AXGA 3PDUA 3SLGA 1X7HA 1DRUA 3HQ4O 2O23A 5KKCA 4NFSA 1NFQA 4CUJA 1A71A 2GN4A 4IJKA 2QW8A 3ONEA 3IUSA 4IZHA 4B4OA 3AOEA 3GFBA 4WE3A 2F1KA 2AG8A 1T2AA 3JQAB 4AJPA 4ZN6A 3PGJA 3HNPA 4FCCA 4JJGA 1N5DA 3FPLA 3PGXA 2O7QA 5FI5A 3RKRA 2AQIA 1LTHR 1M75A 1PL7A 2FPIA 4R9RA 1F0YA 3U0BA 4E31A 5KNLA 4UVHA 1OI7A 4E2ZA 4BNKA 4GVXA 4BS9A 1PS0A 1U8FO 3D7LA 3HFSA 3IIEA 1BXKA 4QECA 2X22A 4EEZA 2X5KO 3FWZA 3JQEA 2NU6A 1C1DB 1HLPA 1JAYA 1QXSA 4E6PA 5KJ6A 4OKIA 1DLJA 3KTDA 3F1LA 2JCXA 4QXMA 3GZNA 1R0KA 1F8GA 3SC4A 1W4ZA 2C7VA 3ETDA 2DKNA 5ENVA 1ZBQA 4XIYA 4KP7A 2VYNA 2B4RO 1WAMA 1E6EA 2O2SA 4LW8A 4S3MA 3WSVA 4D45A 1QR6A 4KQXA 4B7XA 1UP4A 3CPSA 4U5QA 1HDXA 1IPEA 2NU8A 3HDJA 1KEWA 3FTPA 5I7FA 4F3YA 2FRDA 3RUEA 4YACA 3ZHXA 4NBVA 3WGOA 1YB4A 5COQA 4Z6KA 3U5TA 3H2SA 1ENOA 1I32A 3DDNA 3PYMA 4GBJA 1G6KA 4LGVA 1ADBA 3NEPX 5THQA 4F46A 4JIGA 1HTBA 4GGOA 2PZJA 2VOEA 4LN1A 1O94A 3VDQA 3PYLA 3ZNPA 1SNYA 2DVMA 3G0OA 4FFMA 5GZ6A 3ZV4A 4K9DA 3P5SA 1QV7A 1GCOA 2IXAA 2GZ1A 3A06A 1YKFA 3ONDA 1WMBA 1NAHA 1HZZA 4TWRA 4YRBA 1N1GA 2YYYA 2EP5A 4MVJH 2VRBA 1BSVA 4UUPA 4R51A 4UEKA 1ZO8A 2QRLA 2QG4A 5CG2A 3ZN2A 3BMQB 3OF2A 3OA2A 4BNXA 1FMCA 5DCWA 2YQ4A 1MFPA 1K6XA 4E2XA 3B70A 5TX7A 1GYRA 4YAIA 5JYDA 1XA0A 1N2SA 3C24A 3G79A 5JS6A 1C1DA 2DBVO 3EMKA 2PWZA 4ND2A 4PLPA 3PJFA 1NFRA 3D0OA 4BKRA 1IZ9A 1FJHA 3GY0A 4MKRA 4ALJA 3A9WA 1ZK4A 4U0KA 4N5NA 3RFTA 2WMDA 2JKVA 2GZ2A 2DQ4A 3PZRA 1K89A 1V9LA 4F45A 3E9QA 5TT0A 3O38A 2Y66A 4BO1A 4BNHA 1YBMA 2BFMA 3T7CA 2QIOA 3RFVA 1RM0A 1VPDA 2Q4BA 3H5AA 1LSUA 3GVXA 2AQKA 4J4HA 5TNXA 3ZH2A 1P45A 1X1EA 2HK8A 4ZRMA 1DHTA 4XDZA 2X86A 2YHIB 3W4JA 4FD3A 1UZNA 3PPIA 5DP1A 3E6AA 4FC6A 2EV9A 4J7CA 4DLAA 3EVNA 4IGEA 3EAGA 2Z5LA 5GZ3A 5JYEA 3D1LA 4CL3A 5FI3A 4FC7A 3GEGA 4JLWA 5A9SA 1VM6A 4M55A 3WDSA 1M76A 3B1FA 4AJ2A 4HNGA 2C82A 1KVSA 2I9PA 2HU2A 3BTVA 2J5QA 4BVAA 2PH3A 4BQRA 1VKNA 4XGNA 3H5RA 3GGPA 1I3MA 2EW2A 1F14A 3Q6IA 2WE8A 3AU8A 5CEEA 5A02A 1MXFA 2VRCA 3PTZA 1PR3A 2NVUB 4U7WA 4XKJA 4M8SA 1TT5B 1V6AA 4BO9A 3KRTA 2UUPA 5DBFA 1D4FA 3Q0EA 3BMQA 4RV9A 3TRIA 1YH3A 1BXGB 2VHZA 4IDCA 4H3VA 3RUHA 4GKVA 4BMVA 4E12A 3VH2A 3EYWA 5L4NA 4E5PA 4CM8B 4PLCA 4PLWA 3RUAA 2NACA 2EGHA 3TFQA 2PKQP 4AJ4A 4CLDA 2G82A 1ZEJA 2Y0EA 1YBVA 2OZPA 2W2LD 3NYWA 3ZWNA 1T4BA 1U1IA 2D1YA 3DHNA 5KTKA 1I01A 3E03A 3ETGA 3UN1A 3RCBA 1ZXLA 2O50A 2EP7A 1KEPA 2FOIA 2OO5A 4BB6A 1GDHA 3UXYA 3QY9A 4BNGA 3GA0A 1P33A 3ZWPA 4Z9YA 2HRBA 4J4TA 2AXQA 4GSLA 4YEDA 5U9CA 5KWEA 3GC6A 3DZBA 3H9GA 1M66A 1TB4A 1A4UA 2D59A 2GR9A 4QSMA 4Y98A 3WGZA 1I33A 3JQDA 3C7AA 2HCTA 2PK3A 3QWAA 4CM6A 4MIYA 3PVZA 5JNLA 1HDOA 3KHUA 1O9BA 4L73A 4QO8A 5A04A 4JNKA 2ZB4A 2NVUA 3PQDA 1G0OA 1ZVMA 5F3RA 1Y1PA 3DZJA 1H93A 1TT5A 1PGJA 5EL0A 3U4IA 4ZQBA 1M6WA 4E33A 1JQBA 4IMRA 4D42A 4XQGA 3UHAA 1MC5A 4FJ0A 1YWGO 2H9IA 1BXGA 3RVDA 4DIBA 4ID9A 5IZ4A 3FNGA 3JD0A 1SOWA 4XIJA 4EZBA 2WE7A 4BUCA 3LC1O 3WSWA 1NFFA 1AN9A 4QUKA 1PQUA 4BV8A 4YJGB 4CM8A 1DC4A 1EZ4A 3KSUA 4AJNA 4NZ9A 3G1TA 5LDGA 4RVSA 2X6TA 2JCYA 4BNLA 2POQX 1Y8RB 2AEMA 2VYVD 4FFPA 4XQCA 2NSDA 1E6UA 5TRTA 5CAEA 4DC0A 4QTZA 1LDMA 2IE0A 5G0VA 1NPYA 2VZ0A 4J2HA 1PZFA 1E7RA 3PJGA 5G0SA 5G4LA 5B4UA 2BGLA 2GRAA 3GNTA 3DAFA 4A2CA 5KOIA 3QVTA 3ETEA 4NJMB 5G0UA 3OIFA 4D0RA 3H7AA 4CODB 5I7SA 3CMMA 4CQLB 4LVUA 2NNLD 2B4TO 1UXHA 4PN3A 5IDWA 2ZATA 4OSOA 3RUCA 3LQFA 3K5PA 3GVIA 4DBVO 1BVRA 1YL6A 3OEWA 4ESOA 4FIZA 3K30A 3VZPA 3HB4X 1TT7A 3EZLA 4WK6A 3PHLA 3RBXA 3CZRA 5F21A 4J0FA 4L8VA 4NBTA 2VYND 2W90A 2G0TA 2VHXA 3GEDA 4PVDA 1A7AA 5BNTA 4BO4A 3AOGA 4WECA 4HBGA 4MVJM 2VN8A 4O59O 3IKTA 3WTBA 3WGTA 1T2FA 3OETA 1GYPA 3ROQA 5ENDA 5EESA 1XDWA 1XLTA 2LDXA 2Y1CA 4YAEA 5H83A 4I1IA 4CMCA 1OOEA 4WCFB 4OOFA 1B2LA 4JJIA 2D5CA 2HK7A 4AJ1A 4J6FA 1B3BA 2WDZA 4XYMA 1YGYA 5DOVA 4ZU3A 4DPLA 4NQZA 1PGOA 3HJAA 3BAZA 4OGWA 5THKA 2XXBA 4YJGA 4HFNA 3I9LA 3WB9A 3LT4A 2PV7A 1Y8RA 2X0IA 1TVEA 1NAIA 1V3UA 1GR0A 5JO9A 4BB5A 1EMDA 1R0SA 2HAEA 3DZIA 4CMEA 2OP1A 2A4KA 3GHHA 1ENYA 3H9QA 1WZIA 4HWKA 3RIHA 3W1VA 2PGLA 4J1TA 3JQAD 4MVJI 1Z82A 5DULA 3JQBA 4BNYA 1HL3A 4KWIA 3GOHA 1ZSYA 2ET6A 2VUUA 3DZGA 2YHUA 4IQGA 4DTIA 2DBZA 4NJMA 4ALIA 4URFA 1WLYA 1XEAA 3BHMA 1ID1A 4CQLA 3DO5A 4TQGA 4KMSA 4GQAA 4XYEA 5A3VA 1MFZA 4FR5A 1DRWA 1XHLA 3M1AA 1CIVA 4EUFA 1PJ2A 3X2FA 3WYEA 5DN9A 1DPGA 4OXKA 5T57A 4A27A 2OXIA 2HQ1A 2C20A 4MKZA 2PKRA 4XD2A 4DL9A 3WQSB 3WS7A 2Y0DA 1VRWA 5IZCC 4ZQEA 2NTJA 2GSDA 2J5KA 2JCVA 3IOYA 4PCVA 3ZW8A 4CLEA 4L76A 1KY4A 4ND1A 1OMOA 5L9AA 2IZ1A 2PD4A 4R3WA 3GT0A 5HWSA 2ZJ0A 3PWKA 1GD1O 1BG6A 4WCFA 1ZSNA 1U7HA 2O3JA 3FBTA 2XPCA 3Q2KA 5JDIC 3HN7A 1DLIA 5JCJA 3GN1A 2ZTLA 2OP0A 4EEXA 3UH1A 1D7OA 1V3TA 2WM3A 3F5QA 4IUYA 4BNIA 2VHVA 1HYHA 4YQZA 2Q1TA 5K0ZA 5L7YA 2ZTUA 4BL5A 3GQVA 2AEFA 1M67A 4HADA 2GNAA 1LDYA 5JC1A 2I67A 3L6OO 1ZMTA 3QP9A 3AUUA 3PHGA 4M49A 4PG7A 4CM1A 4MVJD 4C7KA 1UXJA 2X58A 1N7HA 5G4KB 5MGBA 2X0RA 4FN4A 1KIFA 4NBRA 4NJOA 3ICPA 2EKPA 2YDXA 3GDFA 1DAPA 2Q46A 4B3HA 1EUCA 3RBVA 2D2IA 5H81A 3PLNA 3V8BA 3NDRA 2SCUA 3DEYX 1E6WA 1PJTA 2IYPA 3KLPX 1EUDA 3B20A 1NQTA 3C7DB 3GG9A 4W7IA 1I36A 4K6FA 4CL8A 1QG6A 2QYTA 4JGBA 4DQXA 2C5AA 1PS9A 1UXGA 3LSYA 2PZMA 2VHYA 1NHWA 4B4VA 2E37A 5TQVA 4M87A 3AW9A 3NTRA 4IQ0A 4UUNA 2X9NA 4D41A 3I6IA 5JXWA 2JD2A 4RL6A 2BGKA 3GLQA 2CUKA 2ZJ1A 2J3JA 3VPFA 3WGYA 3ASVA 3UKOA 3L6EA 1HDRA 1RWBA 1T2DA 4J9UE 1DBVO 1E7SA 3JQ6A 1JA9A 2F00A 4E5MA 4YT4A 3I1JA 1X0XA 1BVUA 2PTGA 3OSUA 4O6VA 3F5SA 2FSVA 1UAGA 1LLDA 1XU7A 3W4IA 1RKXA 1EE2A 2DBRA 3H9UA 1YS4A 3QIVA 3LC2O 4R68A 2UAGA 5EQFA 1EFLA 5IAAA 3A4VA 3IDSA 1GUZA 1XCBA 5ADHA 1FXSA 1P74A 2VNAA 4GSKA 1DXYA 5T6BA 3TOZA 1DO8A 4P4GA 4DLBA 4LCEA 3V2HA 3C85A 4JBHA 4MJLA 3S2FA 1JN0A 4R5MA 2D3TA 1X1TA 1ZK2A 2A92A 3ZWBA 3LT0A 5L40A 5I8WA 5LDHA 1Y6JA 4TVOA 2D0IA 1IY8A 3PQFA 3AY6A 3ONFA 4MDHA 3H9JA 3JYQA 2IZ0A 3OH8A 5CDUA 4CM3A 2PD6A 3R6DA 1B8PA 1XIVA 4BNWA 2B5WA 4FFLA 3NGXA 3RASA 2P4HX 4G2NA 3QV1A 5J23A 1ONNA 5IF3A 4YT8A 3N7UA 4FPXA 1HWYA 2BHLA 4RVHA 4XB2A 4J43A 4RO0A 4PG5A 2NVBA 3GRKA 3PHHA 4XA8A 4D44A 4CMGA 2AW5A 3Q9NA 4E5NA 5ICSA 2O4UX 2YJZA 1PTJA 5BR7A 1EFKA 2W2LA 4QX6A 9LDTA 3JQ9A 1O6ZA 1BWSA 2E6UX 1C1XB 2NQTA 3I9KA 4UULA 3L4BA 1SB8A 1KETA 5IN5A 3VH3A 5JSFA 4J1QA 3TFOA 4L4RA 2OL4A 2GCGA 4B7UA 1I2BA 1NR1A 2QHXA 1HE4A 1HRDA 3ITKA 2C59A 4ILKA 3ANNA 1DSSG 1HYGA 4WNCA 1IYZA 2WD8A 1NWCA 3HFGA 4GX5A 3WJAA 2Q3EA 3NUGA 1U8XX 4IGFA 2Q1UA 4OSPA 3INRA 1X7GA 1GUYA 4FJ2A 1KERA 4IDDA 1PGNA 3S8MA 1NQ5A 2VWPA 2C07A 5AXCA 1HSZA 5A5FA 3JYNA 1EEHA 4WNIA 4A0SA 3WJ7A 4NHEA 4QFDA 1L1FA 1I8TA 2WJPA 1KY5A 4FDAA 4N7RA 2OGUA 2I99A 3IC5A 3AI1A 3JCZA 3GDOA 3GRPA 5DBGA 3MJ4A 1UAYA 1YQGA 1ZFNA 3W8DA 1NVGA 1VL0A 2O3TA 3OEYA 4HFRA 3SBOA 4WGGA 4EUHA 4PLHA 5KVQA 1P1JA 2EJVA 4OM8A 1F06A 4GMFA 2W2KB 3I6QA 4W9NA 4M86A 4TZTA 3RKUA 5TIIA 4RZHA 4DA9A 3OJEA 5DT9A 1NPDA 3DOJA 3E5MA 4QQRA 2NVWA 4UREA 4LRTB 4CMAA 2E82A 4P4NA 1ZK3A 1EBFA 4DLLA 1DJQA 2VYVA 4J7XA 4ALKA 4IZIA 3SJUA 4JP3A 1KC1A 3WXBA 1X0VA 2WD7B 2PLAA 1C1XA 4PFJA 1P1FA 1GU7A 3DOOA 1Q2XA 3GHYA 3OQBA 3RBZA 3ZWMA 4Z9FA 4D7AA 4CM4B 5IXSA 1LX6A 4DUPA 4RQTA 5JAMA 4BHTA 4BNUA 4BMSA 4N5LA 2XOXA 3ZWYA 4GPD1 4DGSA 5EINA 1AHIA 3GVHA 4WLOA 4YDRA 4YJDA 2P68A 1XELA 1B3RA 3VTZA 4PZCA 3X2EA 4RQUA 4WEOA 2VCYA 3H3JA 1E3LA 1Q0LA 3OICA 5TJ9A 4R4JA 2UVDA 4NNJA 3BA1A 5LCXA 4EW6A 4IBOA 1QSGA 3ZNNA 3JQ8B 3WYCA 2Y1GA 3VZSA 1WZEA 4Z0TA 3E8XA 5FFFA 2B35A 1A9ZA 2GD1O 3C1TA 2YDYA 3RC9A 4QFCA 3TNLA 5K1SA 3HDYA 2I5PO 1NBOA 1NP3A 2EKLA 2I66A 2C29D 4CLOB 1GEEA 3E5RA 3GG2A 1OC2A 3H8VA 1GPDG 3PK0A 5LC1A 1DC5A 2W2KA 4YBZA 1E7MA 5DZSA 3I5MA 3I9NA 4DC1A 1FDWA 4CR8A 3D5TA 4JX8A 1R15A 1UZMA 1HKUA 2XXJA 3ON5A 4MVJE 3ZWOA 4JP2A 2Q50A 5C7OO 5ER9A 4AJKA 1E0DA 4JQCA 1SEPA 4TROA 5G0TA 3WBBA 4OKNA 3HZZA 4Q3CA 3FNHA 3I9MA 5H82A 4D3FA 1KVRA 1WXDA 3DHEA 2NTNA 4RVGA 3OJOA 3I4FA 4MO2A 4NBUA 1M6HA 5CG1A 2WD7A 1MUUA 1ZCJA 1ADGA 3JQAA 4OOEA 5JCJD 4OJNA 3ZW9A 3PEFA 2WYVA 4YWJA 1EVIA 1JKIA 1P9LA 1SZJG 2JFFA 4GMGA 2V6MA 5DF1A 3UFXA 1H9BA 7MDHA 5I9NA 3FCOA 1LRLA 4PGFA 3PWSA 5COAA 1RJWA 4P8RA 1RM4A 1V3VA 4BNTA 5U1PA 2Y1DA 4BO0A 4CQMD 1ISIA 4UVGA 1DHRA 3M2PA 3ZCXA 1C0KA 1QV6A 3ABIA 5JBIA 2H1SA 3SXPA 4M54A 3NV9A 1JDJA 1HE3A 3W4KA 2RBEA 5JAZA 5B1YA 4MINA 1Y5RA 4RF5A 1ML3A 4YT2A 3KUXA 1Y81A 1H0KA 3MTGA 4PZEA 4R16A 1C0IA 1LNQA 2YW9A 4TMFA 2FZWA 3K2BA 4MVJF 4DIOA 1R6DA 1T24A 2UUOA 5CP8A 4CM9D 5HS6A 1BDMA 1UUFA 2DPHA 3ZNOA 3MOIA 1GL3A 4CLOA 5GMOA 4F6CA 3H4VA 1JVBA 5DBIA 1ISHA 4PLFA 3SX2A 2FPPA 4UUMA 2YQ5A 1ULSA 3KEOA 3KVOA 1DC3A 3IP3A 2WSBA 4ZQFA 3OECA 1U3WA 4XRRA 1IHYA 1XGKA 3VAZA 4CJXA 4IPTA 1V35A 3QVWA 2IDZA 3W8FA 2B5VA 3VTFA 5T64A 3TZCA 4NU6A 3JD2A 4FW8A 1H6AA 5DCYA 1ISFA 3AU9A 4II2A 1OFGA 4LMPA 2C54A 2RHRA 3SLKA 5ITVA 5BQFA 1DIGA 3R1IA 3HDHA 4MIOA 4MVJA 4G5HA 4L74A 3AOEC 1UR5A 3E82A 1LUAA 2HMTA 4K28A 2Q45A 4H16A 3RROA 5JC8A 2B0JA 4L4XA 1EVYA 1TEHA 1P0FA 1IB6A 2AE1A 3WQRA 1ISGA 3S2GA 3ZWWA 3DL2A 2E49A 3ROPA 4WCDA 4XGIA 4DQUA 2EXXA 4UVEA 1SC6A 2ZYGA 2NQ8A 3DFZA 2V6FA 3WGHA 1NASA 3T7EA 5AVOA 4BGUA 5KJCA 3ZV5A 3RC1A 1ZJYA 4RF4A 1TXGA 3H9EO 5JCXA 2C7GA 4GH5A 2BD0A 4E2WA 4XEHA 4DPMA 1VI2A 3IJPA 4UEJA 4AJIA 1YO6A 2GDZA 2WYUA 3BZUA 1KEVA 2WYWA 5C37A 4M89A 4GWGA 4ZJUA 3B1KA 4WUVA 4FGSA 3NJ8A 1GQYA 1XQ1A 5KVVA 2CVQA 3ADPA 4D3DA 3CH6A 4FJ1A 4INAA 1KVQA 1DJNA 1YQXA 1IOLA 3CTMA 4IDEA 4XCVA 1EBUA 4J91A 1GPJA 1P31A 5BSGA 4OQZA 1UZLA 2IODA 3GFGA 3GN2A 1XKQA 1U28A 4DYVA 3LDHA 2O3UA 1U3UA 3EY4A 4L0QA 1UDAA 1XQ6A 2FMUA 1BTOA 3DQPA 2DT5A 2YHIA 3D5QA 4GWKA 1XU9A 2XAAA 3CSDA 4XDYA 2YZ7A 4KUHA 4DREA 2JFGA 3ORFA 3M2TA 3WIDA 3PWZA 2ZK7A 3FHLA 5TT1A 3AWDA 1MB4A 3U3XA 1MC4A 2NU9A 5GZ1A 1YB1A 3RUIA 4RPJA 1Q1NA 1GADO 4BOYA 3QA9A 4BO2A 3TZ6A 1Z75A 4E21A 4R69A 1Y8QB 2Q2WA 1UH5A 3WBFA 2HJSA 4JBIA 3IJRA 2P9EA 3OIGA 4IJVA 2B4QA 3AFMA 4XQEA 4OMUA 2G76A 9LDBA 4TSKA 4OL9A 1EDOA 4PLTA 4O0LA 3C1OA 5F1KA 4LCJA 4LK3A 1NTOA 5DP2A 2D5AA 4OH1A 3WX0A 4NIMA 3AUAA 1PJ3A 4RGBA 4AJHA 1CQIA 2QRKA 3CMCO 1CERA 4Y67A 1FDVA 1LQUA 1J0XO 2Y05A 2UV8A 1YOVB 1CETA 3F47A 5AXDA 4B8WA 4LMRA 5BNFA 4PLZA 3TQHA 3BHIA 1ZZEA 1A27A 1HLDA 3A14A 3I23A 3P7MA 4CMKA 3KEQA 1A9YA 4GI2A 5TGDA 1PSDA 3F46A 1E3IA 3IL2A 2O2YA 1IL0A 1WWKA 1S7CA 4E32A 3QVXA 2PGDA 3NTOA 4BMNA 4R1NA 2ZTVA 5U4QA 2DTDA 5B4TA 1MA0A 5HBRA 3WWZA 5T8KA 4E2YA 3AY3A 3DBVO 3LT1A 2I76A 3ZZNA 4TKMA 5T67A 3ENKA 1T26A 5I7VA 1I3KA 1RM3A 4RLHA 1H5QA 2BKAA 5ILGA 2XF8A 3INTA 3TPCA 4ALLA 2QQ5A 3MTJA 5KVCA 1WDMA 3D3EA 4DQVA 1IPFA 4WLNA 4RVFA 1K6IA 2GZ3A 2R00A 3WMWA 3NDJA 4RPKA 4LISA 1GZ3A 4RF3A 5JO0A 5KKAA 4OXNA 3V1TC 3CEAA 1U9JA 2GO1A 1PGPA 4IINA 4XX0A 1JU9A 1O5IA 4R54A 1QMGA 4OQYA 2PGJA 1Y8QA 1DDOA 3ROKA 4NPCA 3A1NA 1LSOA 1SBYA 4S1VA 3JQCA 5FWNA 4XYGA 4XYLA 5JDCA 4FFNA 2JJYA 3U4CA 4CMJA 4MP3A 4BO5A 5T5QA 2H63A 4CMIB 1LEHA 2HKIA 3VPHA 4NFHA 2VTEA 1YBAA 4A10A 4PLGA 5CEJA 2ZYAA 2G17A 4FFOA 5KIAA 1UDCA 2ZCVA 3UVEA 1YOVA 5I8ZA 5L45A 4BGIA 3A28A 4PIVA 1VE9A 2Y1FA 3UUWA 1UXKA 2ILTA 4KDFA 3JQFA 1X13A 4IXWA 2IYOA 1AUPA 4EGFA 2AHRA 1C14A 4R01A 4CQMB 5KJFA 1S6YA 1ZK1A 2DBQA 1VLLA 1X15A 1ZMOA 2PKQO 1EE9A 1NR7A 4KUGA 3AUTA 3IUPA 4XR9A 5A9RA 1E3EA 5HTOA 1YJQA 3HWRA 1P44A 2P5UA 3DONA 4LSWA 5C7LO 5CDGA 3GZ4A 5EMHA 3BTUA 1KEUA 4IDGA 4LSMA 2RH8A 3IQDB 2CMDA 2GF2A 3KBOA 3ST7A 4WOJA 1HSOA 1N8KA 4KUEA 3DAPA 3ZU4A 1CF2O 3MWEB 1Z7EA 4H15A 2WEKA 3L07A 1J4AA 5HS4A 1T2CA 1U2DA 1KVTA 3RU9A 1NNUA 1GAEO 2OFPA 3OJFA 4YCAA 1WMAA 3AI3A 2A35A 1U5CA 1BGVA 3BTOA 3I9OA 4L75A 5F5LA 3IKVA 5ES3A 3W8EA 4B4WA 2VT2A 3KSDO 5TJHA 2AMFA 4QEDA 4BQPA 4EJMA 3ANLA 4D3SA 2JL1A 3V5NA 5A06A 1EUZA 3ADOA 2BGMA 2PY6A 1K0UA 4BNNA 3KM0A 3WLEA 2B37A 1P1IA 1B26A 2QX7A 3DMTA 3O4RA 4P4LA 1NPTO 4MPDA 1VSVA 1Z7BA 1LQTA 3O9ZA 4W82A 2BLLA 2A9FA 1H6BA 2DU8A 4HUJA 1HXHA 2RH4A 3KYDB 4BKPA 4ALMA 1W6UA 3KV3O 3GPDG 2FWMX 1ZIDA 5A05A 1LLUA 3QE3A 4KTTE 2AEJA 4AICA 3WNVA 1DEHA 2FSSA 1VJTA 2J3HA 3UICA 4PRLA 2DAPA 2OORA 4CMBA 4EJ0A 3JTMA 4H7PA 3DBHB 1R37A 4RDIA 3ZU5A 3JYLA 1MP0A 4I8XA 4CQMA 3KETA 2HLPA 4DBZA 5IG2A 2ZQZA 1NYTA 3QLJA 1OAAA 1DFGA 2ZIZA 3VVBA 4HNHA 4MP8A 3WYBA 1M2WA 4TVBA 1Q0QA 4IDFA 4ZVVA 3TZHA 4HV4A 2BI7A 4GGPA 5IDYA 5JFOA 2EHDA 2GASA 4EJ6A 4XB1A 4CM9A 4R5HA 4ZQHA 4AJJA 2TMDA 3NKLA 1GTMA 2HMWA 2NWQA 3EGOA 3MCVA 4IIUA 1P0CA 1SPXA 6ADHA 1EQ2A 3G3EA 2DFVA 4XQ9A 3V1YA 3CIFA 5B37A 5KJEA 1LLCA 5TSDA 3MJCA 5L53A 3ZWCA 2LDBA 2CF6A 4BGEA 3C7CB 3GH3A 2NADA 3Q1LA 5CDSA 1OBFO 3VOSA 4RPLA 4I5EA 4RCVA 3H65A 4YPOA 4KZPA 1NVTA 4CMHA 1I5RA 1AE1A 3KYBA 5JMPA 1E7QA 1T1RA 3HHPA 1IUKA 1B8VA 2D4AA 4D79A 4QO7A 3WICA 2PNFA 2YY7A 3AUSA 4IDBA 1LJ8A 4NDNE 1LA2A 3OA0A 5L4SA 2B69A 4L9RA 3CUKA 3KYDA 4ZICA 4WLUA 1U5AA 3M6IA 3QSGA 2C5EA 1EQUA 1D8AA 1V0JA 3UCXA 1A4IA 1P1HA 5AYVA 4J90A 4A7PA 3BYZA 4GAEA 4W7HA 5DNAA 2CSUA 1J49A 2Q2QA 1UP7A 3AK4A 3LZ6A 3K96A 4G65A 4M1QA 4GVLA 1WP4A 3NGLA 4OO3A 3PFWO 3VKUA 1X14A 4K26A 3VPXA 4WPGA 4AJEA 3DBHA 3BMOB 3ZHZA 1VJ1A 1PEDA 3RC7A 4CMEC 2VWHA 3LU1A 5G4KA 2NLOA 4I9NA 1HF3A 3EC7A 4QT0A 4UAGA 2IEDA 2IZZA 1HDZA 2VNSA 3PQEA 3HG7A 3MEQA 4FGWA 4CLHA 4IIVA 4OXYA 4K1LA 3JQBC 2DUWA 2EWMA 1IE3A 3FNEA 4YB8A 1ZEMA 1ONOA 3AY7A 3WFIA 4J4BA 1JW9B 4RF2A 3W6UA 3OMLA 5ILOA 5KJ1A 3P19A 2Y93A 5EJ2A 1E3SA 1ZH8A 3CZMA 5CDTA 3OM9A 3FI9A 3C1AA 3PXXA 3RAJA 2ZYDA 2PH5A 4BNMA 2PZKA 1OZAA 3RU7A 5A9TA 1CRWG 1W73A 4KOAA 1E3WB 2PD3A 1Q0HA 1ZSVA 2BI8A 5MDHA 3LC7O 4MOWA 2BFOA 1MGOA 1PJLA 4JN6B 1SO8A 3PHJA 1WNTA 4CV1A 5TS3A 4N18A 1KOLA 3GMDA 4XWYA 3KO8A 1VL8A 4UEOA 4B4UA 2P2SA 4WCFC 5AQ1A 3K92A 2BELA 1GQQA 2BF7A 2DFDA 1GEGA 1HZJA 1IULA 3FSRA 4PG8A 3EK2A 1L7DA 2O48X 1KC3A 2HDHA 1HE5A 4OYRA 1HE2A 3LT2A 3V1UA 4DPKA 3G49A 3RI3A 2P9CA 4IM7A 3ZWVA 2OMEA 1GYQA 3VVCA 2O7SA 1F8FA 3PJEA 3E9MA 3GF4A 5A3JA 3E9NA 5CEFA 3EVTA 5CFZA 5BSEA 3BMOA 1U7TA 2EKQA 4MVJP 1PS8A 3UOGA 3SVTA 1DB3A 3DWFA 1A7KA 1PZGA 3N74A 3ANMA 2O3RA 3PIIA 5AXAA 3RUDA 4DVJA 1YL5A 2EF1A 2HMUA 4U0JA 4RJTA 2Y67A 3ENNA 4XJTA 1BDBA 3L9WA 3PI7A 3ZWAA 3VKVA 3ASUA 1P1KA 5L7TA 4BO6A 5JMWA 1XG5A 4FOOA 4NG5A 4FB5A 1YONA 3C8MA 3EUWA 4YRDA 2HSDA 3F1KA 4MVJG 4BNJA 3R3JA 4YRAA 3HUDA 3TOXA 3DHYA 4BKUA 2GPTA 3RWBA 3CINA 3IS3A 3B6ZA 3K73O 1HT0A 1PX0A 1TI7A 3G1UA 2EG9A 2GN9A 2RAFA 3GR6A 3JV7A 3Q2IA 3RC2A 1A72A 3GGOA 2X1HA 4CUKA 3WGQA 4HXYA 4JXKA 4WKGA 3WGGA 2P4QA 4O63O 3U49A 1R0LA 3MZ0A 3U62A 3VDRA 1OC4A 4Q39A 1Y9EA 4CLRB 3VH4A 1PJCA 3DB2A 1ZW1A 3CE6A 3JD3A 4GX2A 4C7JA 4E5KA 3GGGA 3I52A 1E3WA 2W4QA 2P5YA 1DIHA 3WG9A 1VL6A 5L51A 3Q11A 3EDMA 3STHA 1RYDA 2DPGA 5JAIA 3PDJA 5EPOA 2HJRA 1JKJA 4KWHA 1N1EA 2ZB8A 3WTCA 4Y9DA 4DMMA 2VQ3A 4P22A 4WOKA 3RQSA 1YJ8A 1JWAB 2DUUA 4BGVA 1PQPA 3TZKA 5JLAA 4NR0A 1ZUD1 4CR6A 1W0CA 3IMFA 4JROA 2AG5A 1DFIA 1Z74A 4PLYA 3OP4A 5BSFA 4FOSA 2RHCA 3ROMA 1NQOA 2V7PA 1T2EA 3GEMA 1NQAO 3DFUA 4Z0HO 1B0AA 1QKIA 3WFJA 3P2YA 1H9AA 4W6ZA 2EERA 1UXIA 1VC2A 4AL4A 3QWIA 1VSUA 4D46A 4D0SA 3GNQA 3FBGA 1C3VA 3NAQA 2PA3A 1UP6A 3I3OA 3QVOA 5JPIA 3OBBA 4HFJA 5ITWA 3ICCA 2I3GA 3D4NA 2ZQYA 5IXYA 3QVSA 1K6JA 2ZTMA 4C4OA 2Q99A 2VTDA 4J9VA 5FEUA 4XZ3A 1PU2A 1SCUA 3QWBA 3JQ7B 1GCUA 2GERA 2OBYA 3ULKA 1J5PA 2Q4EA 2CDBA 3K8ZA 1B15A 3AM5A 3JQ9C 3AI2A 4ZD6A 3NDIA 1YRLA 2R2GA 1XWFA 3GUCA 5B12A 1H94A 3L4BC 1Y7TA 3HADA 3H3FA 4BKOA 2Q49A 5I7EA 3DTYA 3HN2A 3PRJA 4CV2A 4CM4A 5A9SB 5CDYA 4CLRA 1H2HA 3DZFA 3S1LA 1GZ4A 3HB5X 4F6LA 2X5JO 4UVIA 1JAXA 3OJLA 2JHFA 2GYYA 3SJ7A 4BV9A 4EDFA 1DRVA 4P38A 3FRJA 3PJDA 3QRWA 1E1MA 2ZB3A 1GUFA 4TZKA 4GLOA 4RPHA 4YAJA 1JWBB 2VHWA 1YQDA 2X0NA 4Q3DA 1XR3A 2V6GA 2C2YA 2X5OA 3IAHA 4WLVA 3TDKA 3JQ8A 3PHIA 4KTVE 1TA4A 3RJ9A 4KQWA 3PP8A 2EJWA 4Q3AA 2G1UA 1FK8A 2BFPA 1R12A 1CYDA 1TLTA 4NK4A 3NJ4A 4ND3A 3QJ5A 4Q9NA 2HK9A 2J5RA 2ZCUA 2V65A 2VWGA 1O0SA 3FR7A 3WNQA 2C0CA 2CFCA 2P91A 4W9NC 3S55A 3CKYA 1ZNQO 3H6KA 4WJZA 4EI2A 1HDYA 1RPNA 1QLJA 3RJ5A 2Q1SA 4NBWA 4FBGA 4HKTA 8LDHA 5C3MA 4UUOA 5AOVA 4FSHA 1H6CA 1WDLA 2Y1OA 3JQ7A 7ADHA 2YFQA 4J7UA 2A94A 2AQHA 3IP1A 3O03A 4I5FA 4IY1A 4O5OA 1ZXBA 4GL4A 1Q7BA 4XGKA 5K6AA 1ZJZA 2JFHA 1DIAA 3DXFA 4XJSA 3M1LA 2UDPA 5F5NA 3GMSA 1BHSA 5KCZA 2OOSA 3I83A 4YTEA 3GNSA 4AFNA 1E7WA 1QYWA 3RUFA 1QYXA 4OHUA 2Q2VA 3D3WB 1I0ZA
chains in the Genus database with same CATH superfamily
1LDNA 1QZZA 4GR4A 3EGIA 4ROSA 2Q9BA 3KSRA 3SYLA 4RHEA 4YCLA 3UC9A 4J1NA 3EHEA 1EDZA 4MUJA 4ZJYA 4Z4EA 4H7FA 4WK2B 2QL7A 4L28A 5HZMA 3VUEA 1IIRA 2EWWA 2PU7A 2BRUA 4FU0A 4U8GA 1A98A 2CMGA 5ANRB 4LJRA 1E79A 3GRVA 1IOVA 1ONPA 1N92A 2G7ZA 3QV2A 3U7IA 5CB4A 2K2QB 5FA5A 2FP3A 2WOJA 2XVAA 1I2AA 4IKOA 2QTMA 3SS7X 5CPBA 1EINA 1PZHA 1Z2PX 4BO7A 2JCGA 1G5PA 2C8VA 3TTVA 1VPWA 3AVTA 1X38A 3ED1A 4RORA 2OBNA 2WSIA 1DC8A 4U3JB 1SVMA 4Y6SA 5FJIA 5K3FB 1GPMA 3FUWA 1ZXXA 2DSNA 2DQSA 3Q9UA 4WASA 5KTNA 3E58A 1BIFA 4UE6A 5MGNA 2EFDB 2I65A 2B36A 4QEZA 5EE5B 4NYMQ 2P9GA 5KNBH 1N3IA 2X0JA 1RKVA 1BX1A 3D6HA 1E2BA 3A6GA 1XSEA 5KNBD 2QUAA 4LC9A 2V55B 4MRNA 2F17A 2FJUA 4FD2A 4RWEA 4RZ2A 3V4RA 3OZTA 1IHOA 2DUJA 3DMPA 2WJWA 3H87A 1C2YA 1NDUA 1L8AA 2P79A 4IVQA 4K9SA 2X4LA 3G2OA 5DI9A 4EHFA 2I6TA 5JZOA 5LXTF 5C31A 4D8XA 2RGUA 4L51A 3L4EA 3ZHYA 1I10A 3I42A 1DIOB 2HCRA 3M3HA 3LRPA 5KQMA 5KNDD 4FONA 3S70A 2IUEA 1BS1A 1M0TA 1XD2A 2X0EA 1Q7TA 1PR9A 1TYBE 3L1UA 2LRHA 4RLSA 3V2IA 5GY7A 4IHJB 4KN6A 4WV3A 2QY9A 2W7TA 1RKUA 2UKDA 4UATA 2ZAGA 1WW3A 1ORWA 3K9QO 1YVUA 2YOGA 4BRSA 2WJ3A 5M3BA 1E2GA 1ISJA 2PMDA 4O3FA 1VHLA 1U2QA 1XMSA 2A3RA 2KM1A 1OGJA 5LZ2A 1MV8A 5KOYA 3AUFA 3K0SA 1I3NA 4KACA 4WL0A 2NO9A 2IYWA 3T1VA 3HPRA 1VBKA 1XTTA 4NEQA 3T0IA 2MYNA 1RAFA 1TDJA 1U4OA 3ENWA 3IV9A 4EVSA 1Z34A 2VUTA 4B6RA 2F1JA 2CNDA 5LOVA 3O8QA 2PZLA 1VPVA 2OENG 2VDJA 3QBVA 4TTTS 4X71A 5A4AA 3N6RA 1GV1A 2QE6A 1ADYA 2GHIA 3IURA 3TJRA 6ADHA 3PG5A 5HM6A 2J8ZA 2XMSA 4JQSA 3DBRA 3N2EA 1N5RA 1UBCA 4X85A 4PZDA 2VJBA 1AY0A 3NT2A 2X4GA 4LBVA 4ZC8A 4LKOA 5C4GB 4R7GA 4L9WA 2HY7A 3DFIA 3BMCA 1TZMA 4RADA 1JHPA 3ELUA 2RK4A 1H8HA 3PGMA 1CHNA 3A1VA 4K6CA 1E3MA 1ZPDA 1ADFA 1JSRA 1IOZA 1PQYA 4MSUA 3SC2B 2V96A 3WLTA 1WB9A 3IB3A 3S2EA 3FYDA 1W2GA 3ECCA 3L49A 1POWA 2NU7A 4GECA 5HKKD 4M7PA 5EXPA 3EXHC 4QYSA 4BP1A 4YR9A 2VZEA 1BKYA 4CF6A 4OMDA 3WMFA 2QZSA 1QYDA 2BFAA 1XCJA 2I3AA 5LA6A 4IJWA 4RTJA 4AY6A 4W9RA 1GKYA 1BJRE 3AR8A 4TLEA 2IUFA 1FX0B 2QZ9A 3AM3A 3D4OA 1TTPB 1UL1X 5FF9A 4DDMA 4NMHA 4AVYA 2HIGA 5IJ0A 1LX7A 3FHOA 1VIDA 1YRYE 2BE7A 1MAHA 1H2XA 1QYVA 4UHKA 1KDOA 2O3QA 2PUDA 3TIIA 1A69A 2YJ4A 1F12A 3FZYA 4IJQA 4RSMA 2WWTA 1Q92A 2EZ8A 4IFIA 4C2AA 3C3KA 5K9ZA 2Y68A 4U02A 4DN6A 5J3JA 3DNMA 1JVSA 3I4LA 3VC7A 1MNQA 4TQ9A 2XEDA 4PIMA 3TF5A 4PC3A 2I54A 1XTRA 2B21A 3C4JA 3RIEA 3D64A 3EZYA 3M33A 4MS4B 3WHPA 4A36A 4S24A 4HFMA 3FPHA 4BWYA 4RFSA 4R9UC 1P81A 5DLPA 4BFYA 1YXMA 2OC9A 1P8JA 1QLHA 1SK8A 3GLRA 3OLWA 3UAGA 1O87A 3R5SA 3KE9A 2XTZA 4LRWA 3IKMB 3E9EA 4JK3A 4ZHSA 3T4EA 5D6NA 1JEQB 4ZU6X 2VCHA 3C7TA 2CVFA 2NXWA 3CNLA 4PPYA 5HF8A 4C08A 2X23A 4CM7A 4HBZA 4EA9A 2JS7A 3O2SB 2WHXA 4Q1CA 2M2IA 3HGTA 3DVSX 1FPMA 1Z5VA 5E6RA 1R4NB 3G59A 3VR4A 1XB2A 3SF8B 3NU1A 1DINA 1XPRA 1I7NA 1QTRA 3GWZA 1PJQA 3KCNA 1MO5A 3QF4B 2AYZA 4H6WA 4IS2A 4WLFA 5F64A 1Q3TA 1ZITA 1NBWB 5FWXB 4EKGA 4UDOA 5CFLA 1VP3A 4PS0A 1H4SA 5JY1A 1NQXA 4B5LA 2X4DA 2VPWA 3EMVA 4R1OA 4AP9A 1Y63A 4OXXA 3R7SA 1S9HA 1XE3A 1E0KA 4V2UA 4UTNA 1ZW6A 1KBQA 3ZV3A 4HHEA 3IEMA 1KJYA 1KY3A 1TK3A 3FNFA 2H7YA 1CEXA 3AGPA 5DRYA 2O2ZA 5HDBB 3ZV6A 2B4YA 1I24A 1LFAA 3AJRA 5GPBA 3RVBA 3BL5A 3AR4A 3KZVA 5DLYA 1R4MA 2DTXA 1CR1A 2JHAA 1LC3A 2W98A 3B7GA 1GPLA 1U9YA 2ID4A 2J3IA 2RC6A 3LBHA 4YC7A 1M34B 1Y3FE 2R8XA 1DKUA 1BXZA 5CCXA 3HCDA 1KSFX 1VBFA 1BMFA 1T15A 1OQAA 3ZHVA 5JWHA 5KHLB 4WNAA 2RGRA 1FDTA 1HKHA 3L8EA 3GCWA 1T1SA 2JI8A 4Q9HA 5CBPA 1RXSA 3QEJA 3GLFA 3RV3A 3BMNA 1RI2A 4KPGA 2YXDA 4R31A 3WP0A 1L4MA 1N0VC 3KX2A 4G5GA 3N2GB 2D8MA 4COOA 4QC2A 4Z0NA 3KJEA 5LVAA 4FBMA 4UHBA 2BFWA 2OD9A 1GGVA 2OAGA 1EFPA 4MRSA 2OM2A 3N2KA 4TV8F 3SC3A 1WMEA 2WIDA 3MWDA 4HP8A 3E61A 2WKSA 1JQKA 4J6EA 3I9JA 3ZGYA 3NRCA 2VUSA 1E6CA 5JQGA 2QR3A 1A04A 1RQ7A 5C7IO 1KR2A 1ZJWA 4YFYA 2WQZA 5DDIP 1N8NA 2GTHA 2VTBA 3MOGA 2OILA 3GNLA 3WGKA 1AHPA 4UFOA 4RZIA 1IC6A 1DKQA 2NPOA 2R84A 3K94A 1MC1A 1PZEA 2IIVA 4AMUA 1N2XA 2HX1A 3O4IA 3JVDA 4CMIA 1AHHA 4RAQA 4NCIA 2BZ0A 1QRRA 2C4NA 1PT5A 3JWHA 1S3SA 4R83A 1QWSA 1ZHFA 3U7HB 2X2EA 3MWLA 4NH0A 1XFDA 3VU9B 5IDXA 4MDFA 3SG0A 1SIOA 1QZ3A 1JIJA 3L6BA 4I4TA 4JCOA 3H18A 1YZVA 2IWRA 4F6RA 4YMUA 1EG7A 2IVZA 2C84A 5ALNA 4YYZA 4DZRA 2B20A 4QOGA 2LUOA 2JEOA 2PL5A 2GUGA 5A0VA 4G5SA 4U2DA 3WRXA 4EFNA 4TGLA 3HRHA 4NMWA 4TRRA 2PLRA 3T4PA 5IDQA 1SCJA 3L79A 1NBAA 2M6KA 4I08A 2E48A 1LTQA 1PQWA 2JAPA 3P45A 1O5TA 3G2QA 3STXA 1P6UA 3SHQA 5JW6A 2YFHA 4F84A 4M0CA 3BHJA 4RW0A 1HLFA 2DPLA 4E5VA 1RHUA 4ZCMA 1LVGA 1JLKA 2QM8A 3G5AA 4PPGA 1YL7A 5L6MB 3MCAA 1XHFA 4IUCS 5F7JA 4QGAA 1W5AA 4ARZA 1MLDA 1GA6A 1LVUA 4TMVA 3KYCB 3AILA 4RPGA 2HMSA 3KKMA 3H97A 2JAQA 1UBFA 2VSXA 3QW2A 3KB8A 3LKBA 1RRPA 5IVHA 4RXUA 3DC7A 4GOXA 2PT7A 3E48A 1HYEA 3COSA 5DM1A 4XYBA 3KQHA 1VDMA 1MQ9A 4R8VA 4JMPA 5JAQA 3R7AA 2Y27A 4JJFA 3E1KA 2QI9F 2R00C 2FP4B 4GICA 2CE2X 4QATA 3KQLA 3CX4A 3IIKA 1LXCA 9MHTA 4G4GA 2BONA 4MKXA 4QXRA 3ZDZB 4CIXA 1EWVA 4NMLA 4UXJA 4B83A 2RIRA 3E35A 3GJ3A 1J39A 2QVLA 1T6XA 4Z4GA 3GROA 2C2KA 3ML1A 1ZUWA 3FLMA 4J75A 1O8CA 2VSOA 4HLDA 3X1ZA 4LGCA 4TKLA 4YJFA 1LI4A 2R47A 5AOBA 4CF7A 2GHQA 1QP7A 1N9GA 1QRDA 1PIWA 4J0DA 4U6SA 4F4CA 3FTNA 3ZU2A 2JANA 3ZHTA 3QWFA 4Y6PA 1RLMA 2C5SA 3O91A 5KS2A 5FBKA 3L9XA 5KC8A 2FZVA 3KLNA 3V3KA 3GWGA 2FDXA 3G17A 4BATA 4JSTA 4BO8A 3V7NA 3OTGA 1M8KA 3KFXA 5EGNA 3O8OB 3TW8A 2JAOA 1B00A 3O26A 5M04A 1QNFA 5B1HA 2ZB7A 3CR7A 3K6KA 1EVZA 2A6PA 1ZGZA 5HJ5A 5KX5B 2B8EA 4KXYA 2WIAA 1ACJA 2BFDA 2CDCA 2GN6A 5IH7A 3CLKA 2DOKA 1CEQA 2HMVA 2UZAA 3TTWA 2GZHA 1YE3A 4MDYA 5CLHA 2YV3A 3MLEA 4MGZR 3VYTB 1ST2A 5FPSA 3RFFA 1B7GO 3JQFC 3VAYA 1QF6A 4B75A 4EF4A 2N75A 1ICEA 1WBBA 2AJ8A 1YRBA 3D31A 4U9HS 5GINE 2HO5A 3ZHSA 4YJHA 4ZO7A 5I3CA 1GDDA 4UMEA 3C3JA 4N7MA 3KYIB 3OJCA 4PY2A 1L5SA 4BIIA 4NENA 1T25A 4AB1A 2GXAA 3WOHA 3MELA 2GPSA 1YT5A 3GLIA 3K70D 3A8TA 3IQIX 4G36A 2H07A 1U63A 3OLZA 2A59A 1U2TA 2D00A 1VJ0A 3WWYA 2VTKA 3T3HA 2UU9B 1RC1A 2ID7A 3OO1A 4Q7KA 2Y99A 1KYQA 3KXKA 4BY9E 2HW8A 1NLUA 3DW1X 4PHHA 3VZQA 2XWJI 5KPJA 1W85A 4WKOA 3DW3X 4E46A 5HUHA 5JXHA 3QW4B 2XUQA 3N0TA 5EWJB 4EITA 2B8WA 4XCQA 2YJTD 3JQGA 3QWHA 2H5LA 5SZIA 3RD5A 4DBLE 4YMGA 2J0SA 1U2DC 2UVPA 4YVFA 3VJMA 2DTEA 4ZVNA 1TECE 4Y6LA 3B1JA 3DBLA 1PEAA 1U2GA 4R3NA 3FCSB 5EZ6B 2V58A 4JOSA 1A8HA 2XIQA 3O2QB 1Z28A 2A9OA 3DT9A 2J3LA 4A2PA 1II9A 3ANSA 4WW0A 1SKQA 3RTGA 4DEVA 4TV9F 1E7YA 1EM6A 2XUJA 4RANA 4WGFA 3NANA 3IOMA 2DLDA 1IZ8A 1MQ8B 3K32A 3LGAA 1PGQA 2PR2A 4N6OA 1E4OA 2FU5C 2W2MA 3NBUA 4Z2AA 1PLJA 3M6MD 4ERXA 5JJLA 4G0OA 1OZHA 3NP7A 4Q3EA 2QTAA 3AIKA 2FOXA 3WLFA 4QZVA 5I4KA 2PBLA 5AKZA 4M99A 5ICMA 3A6EA 5KYTA 1WHSB 4F72A 3E0XA 3RYHB 2CZCA 4AYWA 3ZDDA 4JENA 1GNPA 3R9KA 1UBNA 2Y71A 4E15A 5FV4A 3I34X 2DXIA 3VRHA 1CDOA 3RRZA 2O14A 1OWPA 3L77A 1VIAA 4MI1A 3W8RA 4XRGA 3EJ6A 2VHEA 4PBSA 4AT1A 5AW5A 4JNCA 2HHAA 1DT5A 5I9MA 4DMLA 1NLMA 4UD6A 5IBQA 2WWRA 2XTJA 3DOUA 3V2GA 1J8FA 1N6OA 3PNPA 4MMZB 4WVLA 6LDHA 3GZNB 4RDHA 3C3XA 4JKYA 3QPAA 4CM5A 2W22A 4NK5A 5ILQA 5K3SA 1E77A 1KOJA 4JEIA 3TN7A 2EYQA 4QIHA 3P32A 4EHIA 4X00A 4D0LB 2LKCA 4EQ6A 2BH9A 3TCKA 1WIWA 1H4TA 2NN3C 3NBYC 3Q3IA 1DMRA 2G8LA 4LYGA 4WD3A 3V8PA 3ZDFA 1UMKA 3I6BA 4DNXA 1L5QA 4ZK6A 1K88A 3D54D 4X92A 3IVAA 3U7EB 4IMJB 1U65A 5LU8A 2HEGA 4PZZA 4C0JA 4MS1B 1CRQA 2FW8A 1U1GA 2F3RA 3KAPA 4JA2A 3NT5A 4L08A 3UHJA 3IAEA 2JAXA 2RJ3A 5KWVA 4MGKR 3OKAA 5F1PA 5H7XA 3QMWA 3WK7A 4BO3A 4FQ8A 4R9VA 1HR0B 4OGLA 2BMEA 2O2IA 3OQJA 2FN7A 1CQJA 1VMEA 4RELA 2JBAB 2BR5A 2D3WA 2JC3A 1C3OB 1Q22A 4MUFA 2Z6AA 3ZE9A 3RE1A 3ROZA 3CS3A 5KYWA 3HV2A 4O2BF 1UBMS 4NFSA 2P41A 2TRSB 1JAZA 2XUPA 4DTCA 2ZWMA 1KORA 1A71A 4H08A 4INOA 5IARA 4CT0A 3CN7A 2O2JA 1OPXA 5EIBD 5K6RA 4X9XA 1HRKA 2AKEA 4IZHA 1NOKA 2ECOA 4P0TA 1SXJD 5IAJA 1N9ZA 2FI1A 2AG8A 3AZQA 3WZLA 3ZIUA 4OHFA 1D2MA 3FYCA 3RAGA 3C3EA 3KOMA 4JJGA 1Q5PA 3RKRA 2AMJA 2O7QA 1CZUA 2XYRA 4ZJZA 4H6XA 5M7EA 4GDFA 2AQIA 3TLJA 1J9GA 4OGKA 1PL7A 2FPIA 2ZRNA 4P7FA 1NYQA 2V7TA 3WL8A 3CIOA 3C14C 4D98A 1R4AA 2Y3IA 3LAWA 2GFHA 1XZLA 1OI7A 4R8KA 4UVHA 4E2ZA 2Z04A 5BV7A 2JFOA 6ABPA 1PS0A 2AS0A 2GEJA 3IGFA 4UCXA 1SHZA 2R60A 3L7AA 4PWYA 4EEZA 5F76A 2NU6A 1HLPA 2EDCA 2J0UB 5KJ6A 4E6PA 3VR0A 1M1XB 3IERA 2R48A 2Y9MB 3KTDA 3ZHOA 3KUDA 5K4GA 2DZDA 1F8GA 1W4ZA 1WZNA 2C7VA 2CKMA 3NHSA 1JB1A 3RV4A 4X20B 2XZLA 3A4TA 1YC2A 2GF9A 1J1ZA 2BGTA 4WESA 3T1OA 1X2BA 2ZRJA 1I6WA 1GUBA 1K2VN 2Z5GA 1ND6A 3OBIA 4HGOA 1MAAA 1QR6A 2A7XA 1I9CA 1Q0PA 3AB7A 3DQQA 1E9DA 1Y3AA 2GZAA 1U2RA 2I4IA 1AUQA 3I2FA 1IZ7A 2CJPA 1SUPA 3HDJA 5DISB 5LIPA 3CU5A 5E38A 2MR6A 3HVKA 1RW4A 3ZHXA 4PTLA 2C9DA 1I4TD 3MUEA 2BZ1A 5K8JB 4UMDA 2AG1A 5FBVB 1KYTA 4CW7A 4GBJA 2YJNA 3MW8A 1G6KA 3RVPA 1CKEA 3BJIC 2V3CC 1DXQA 4PZ0A 1KGSA 2DR3A 1RS0A 4UPEA 2RSLA 1J8YF 2J08A 3O8DA 3QOYA 3S0JA 4JC0A 4YROA 2PZJA 1QBKC 2FMXA 4M0DA 3GOQA 1Q83A 3B3FA 3W5CA 3AI7A 5C52B 4Q02A 3MERA 3N2LA 2AB0A 2X8JA 2XGSA 3GJXC 1FUYB 4YRJA 4DCPA 2DVMA 4IVPA 3BGIA 4KXMA 5GZ6A 3CX3A 1QAQA 2JGMA 2YC2C 4K9DA 4BXOA 1QV7A 1GCOA 2C4WA 4N9WA 1QHFA 3ABZA 4RIEA 3ONDA 1YKFA 2A57A 2DRIA 2H57A 1NAHA 1OXSC 1HZZA 3G23A 4R71A 4KX5A 2ZRFA 1VCHA 3QKTA 1C9YA 3OIWA 4R51A 2CKDA 1ZO8A 2HLDD 3ZY5A 5CG2A 2WWGA 3ZY4A 5EUBA 3OF2A 3X1KA 1C5KA 3Q7SA 1FMCA 5DCWA 2CJFA 1XN1A 4AKIA 3B70A 1GYRA 3TR6A 3O83A 4M4SA 4FFBB 5E9WA 4EYOA 1OCEA 2BKUA 4QEKA 2YICA 4KCGA 4BLUA 1K06A 1CJTC 4YYEA 821PA 1C1DA 3RS0A 5JS6A 4JD5A 1Q1QA 4NZMA 4CFSA 1ZN8A 3I01M 2V7GA 4PLPA 4DJDC 3D0OA 3QI7A 4I2VA 2HCBA 1BC5A 2P7IA 4ALJA 1F2UB 1GKIA 1KAEA 2KBEA 3AG6A 3NIFB 4N5NA 4U0KA 4YP1A 2HLNA 3PEVA 2NO5A 3AKYA 3V1NA 2BIFA 4F45A 2EKZA 1W7AA 2DCUA 3O38A 1YBMA 3DT8A 2HYDA 3VO8A 4OGFA 5CNKA 3DUWA 1VPDA 1JDBB 2CXUA 1J0EA 2NZXA 3EPRA 3H5AA 1VJDA 4S1TA 4QUAA 5DM60 4DCCA 4Y2QA 2ZDHA 4IOLA 4YUZA 4M1EA 2XCOA 3TDNA 2PEZA 1ZM2A 2QXTA 1SC9A 2DP4E 1X1EA 2G06A 4MMXB 1DHTA 4F0JA 1SM4A 2YHIB 1U8ZA 3AKDA 4ZHQF 4NXMB 3RSFA 4W1SA 1JWLA 1N75A 4R2XA 3Q0IA 3E6AA 4HZGA 5I5EA 2FZGA 3IVCA 4J7CA 1XTPA 1E6KA 3EAGA 5C8YA 1EVKA 3LK6A 5CYGA 2LIPA 4MVXA 4FC7A 5EJAA 1T6ZA 2VK4A 5P8WA 2PKWA 2FPOA 1T36A 2PU5A 3Q3JB 3WDSA 2Z6UA 1LPNA 1ZD1A 4DCMA 4AJ2A 5FPKA 1C29B 3D8UA 3SEQA 3EUAA 1MC8A 5K0SA 2KB0A 1OD6A 4JLPA 3C3PA 3ZXUB 1XCMA 3PC8C 4LZZA 1MX9A 4N49A 4WFIA 3GGPA 4DSOA 3I53A 3Q6IA 3WQHA 4JT9A 5B6IA 3GYBA 3PUHA 5CEEA 2O19A 1MXFA 5HXAA 3QOXA 3HYSA 1PNOA 3CB4A 2QLMA 3QMPA 5CTAA 4NICA 4FK8A 4MS3B 3QE9Y 2ODNA 4GOJA 4NAVA 4BCBA 1DWOA 4B6PA 1TT5B 5B57C 1QH1B 4TLBA 1VOTA 1AIPA 3GA7A 4PX5A 4LNHA 3QVGB 3Q0EA 1EFDN 3FCUB 4MW7A 5DW3A 5FH9A 1QH8B 4DQDA 4DZTA 4D9KA 2P6RA 4QUHA 2VHZA 4HO1X 4NX2A 1T9AA 1UODA 1CG6A 3M3PA 4WMLA 1IM2A 3VH2A 5F3WB 1YRHA 5L4NA 4CNBA 4E5PA 2M32A 5HKAA 3GT7A 2QNRA 3FYTA 2GARA 4PLCA 2IKQA 4PLWA 1XZJA 2C1XA 2NGRA 1II8B 1JH9A 4B44A 3TFQA 4HAXA 1G7CA 2XWQA 1PJZA 5T7BA 2G82A 4S04A 4CHTA 1LW6E 5HF5A 3C15C 3CNQS 2H4WA 1HT3A 5B1IA 5CAEB 1Z13A 1X7XA 3KKQA 1W46A 4LY9A 5I7AA 3DHNA 3G9XA 3D8NA 2CVHA 2VDQB 4AN0A 4F7WA 2HWYA 4Z53A 1DE0A 3ETGA 3SGLA 3I8XA 3LUPA 3UN1A 1FFWA 3L8FA 2FFHA 5FO0A 3AUXA 5EE3A 2OYCA 4Z4CA 1OLUB 1GDHA 1XTSA 2QY6A 1RABA 3CUVA 3OY2A 1FTSA 3QY9A 5GONB 3T9CA 4WBNF 8GPBA 5E6UA 1P18A 3CF0A 3QTLA 1VE6A 4BMPB 3OQNA 5IM4A 3FPGA 3IOEA 2AXQA 4UQPA 2YMPA 4NYMR 1U0FA 2ZUBA 5D51S 5AQEA 1S8FA 4HGQA 1JPNA 1SG0A 1DI0A 1HC7A 1UADA 2X5NA 3WGZA 2GZRA 2WU8A 3U31A 5JMTA 2QDKA 1W88A 4W8GA 3ZDXB 2PK3A 1I1OA 1SBTA 3NHZA 1U1DA 2TECE 4KN5A 4CM6A 4EHKA 2PDAA 1L7VC 4V0RA 4MIYA 3WO0A 5JCOC 2AJBA 1HDOA 2O07A 4RQAA 4K6MA 3IAFA 3NWPA 1ZVMA 2GLUA 4H60A 4TWZA 5FUXA 3QBEA 3KZXA 1SXJE 5G02A 2Q6LA 1MEEA 1ZLXA 2J41A 4RY2A 1U0BB 3E27A 1YIDA 4JB3A 1N2EA 3VU3A 3NEAA 4IMRA 1V37A 1RZVA 1CQXA 1VI6A 1G18A 2WV9A 3EXFB 5AM4A 4FJ0A 3R7LA 5K0JA 2J31A 4OV6B 3CX8A 3H75A 2FWAA 1PG5A 3JD0A 2WSSA 1SOWA 3C98A 3R0XA 1IY0A 4BUCA 5L3RA 2DKOA 3LC1O 2AN5A 2YXBA 3CC8A 3BGWA 4FYHA 1NFFA 1AN9A 2Z83A 2WWHA 4C0HA 1ZUIA 1F3LA 4CM8A 5F3DA 2XUAA 1JPJA 2PS0A 1G8AA 3G1TA 2G1AA 1Y4UA 4BQSA 2VNIA 3JZDA 4ZVLA 2AEMA 2DX7A 3ORHA 4FFPA 4XQCA 2NSDA 4ZAXA 5TRTA 3T7TA 3REGA 2DF8A 1OGYA 1MT0A 2F1OA 1XRSB 3DLAA 5JVDB 4QDUA 4DC0A 1S0UA 3OOWA 4PFQA 1J20A 3KIPA 4OEHA 3RIMA 4Z3OA 1J00A 4DCGA 3NNSA 3TLZA 4Q15A 3OI7A 1CRZA 1PUJA 5AUOB 1JBQA 3HA3A 2BFEA 3EDYA 1SC4A 4X1KA 1XZAA 3R4VA 3EOZA 3GFOA 4IIFA 1A9XA 2BFBB 1OTXA 2IXFA 4CKXA 1Z6GA 4NJMB 3Q3VA 4DXAA 1G8YA 3M5DA 5ADWA 1P2VA 2XCLA 2ODWA 3H7AA 1GAXA 1X3LA 1OTHA 5AW7A 3ONWA 3HWX1 4J03A 3DPUA 4LVUA 2Q0XA 1L9KA 3MJRA 4BX3A 5EKSA 5LB4A 2VQFB 4MR7A 2HRRA 2QTBA 3FY4A 3KJXA 3LFTA 4LE2A 3RUCA 3LQFA 3K5PA 5FO1A 3GVIA 3WAKA 4BASA 2ZIEA 1GZHB 1O97D 1RD4A 3OEWA 5FORA 4FIZA 1M5TA 1XQWA 3MS2A 1JQAA 1AQNA 4L2IB 1TM2A 2H06A 2QAIA 1L6IA 2DEUA 3W5SA 3DPSA 3CZRA 5F21A 3HJTA 4J0FA 3HXOA 5GOZA 3U61B 3K0HA 2VYND 4LOJA 4UQLA 3C45A 4OLAA 2J45A 3KR1A 3GEDA 5FBHA 1KJIA 2LIVA 4LDRA 3A4IA 3AOGA 1AHNA 4FFVA 4NARA 4P7BA 2CNKA 5KNCD 4I50B 2H0RA 5EKXA 3IKTA 1GA1A 3UKJA 1T2FA 3ROQA 1GYPA 1VE7A 5ENDA 3P97A 1NI3A 4FIDA 4YAEA 2LDXA 1I0LA 3PUKA 1OOEA 4CKBA 5I6DA 4Z7OB 3PSHA 4RTPA 4JJIA 3QE4A 1GQOA 4R81A 3ZD8A 1YR9A 3THXB 1RYHA 1HDIA 2WDZA 5KAPA 4Q93A 3L8YA 2JJ2D 2DR0A 1XI2A 3IEPA 1XEFA 5T3UA 4DPLA 2FUNB 2B99A 1PVDA 4D9EA 4NQZA 3UWSA 1PGOA 2EBHX 2BFNA 2O2CA 3BAZA 3QU2A 4OGWA 4BQNA 2YZGA 2XXBA 1TMKA 4FZRA 4YJGA 4HFNA 4G84A 4P32A 5EE9A 2VQEB 1U1FA 3VNSA 4P34A 1D2HA 2IYLD 3FUVA 16PKA 1TVEA 3V8MA 1GR0A 3LDFA 3MQFA 3G85A 3QUTA 4CMEA 4ZYVA 4FSDA 2PGLA 1XDGA 4FBLA 4MVJI 4I9GA 3QFTA 4HVTA 3LYUA 4N4AA 5E9AA 3V46A 5DULA 1OX4A 4GQIA 2RHWA 1ZVJA 3IBTA 5ALTA 3HCOA 3RLFA 10MHA 1HL3A 5D6OA 5TEVA 2QORA 3GX1A 5EQJB 1GLNA 2VDNB 3BKWA 3GOHA 2VUUA 1QGUA 2X0DA 3PUXA 4UARA 4QAJA 4CCAA 4URFA 4RTQA 5E7MA 5DKFA 3B5JA 3BHMA 1RP7A 1AGYA 4TQGA 3WWCA 2MSLA 2OBMA 1EFRA 1G291 3U19A 2RKOA 5AKIA 3IAM6 2OGTA 3O90A 2AHOA 5HFJA 1RCUA 4ED9A 2ARKA 2D0PB 1CIVA 4EUFA 1PJ2A 5DTEA 2RAUA 3IO5A 3WYEA 4DIUA 3FYSA 1QGOA 1T5SA 4LF8B 2XSZD 2P2CA 4NZPA 2OA0A 2C20A 3KKPA 1EXWA 4HJRA 4DL9A 3E9CA 4L4YA 1BE6A 2L18A 3WS7A 1VRWA 5IZCC 3LP6A 4KWCA 2MU1A 2PYIA 3CA8A 2JCVA 1C3XA 1PV1A 4LYDA 3CUTA 3TGWA 4L76A 2G08A 2ZBQA 3W6OA 4P5DA 4KQIA 3AJ9A 4MUAA 4IV0A 3A4LA 2PN1A 3E84A 5L9AA 4Q4HA 3C3WA 2NXNA 5ALGA 1EESA 3AHFA 3N8GA 1A5BB 3BDIA 1Q91A 3F5MA 3HNOA 3LCRA 3P9YA 5CH5A 5HWSA 2FETA 4KH1A 1AQJA 1GD1O 3SE7A 4WCFA 1VZ2A 1ZSNA 3IESA 1VYTA 2O3JA 2QL6A 3FBTA 1YS1X 4K9RA 2WI8A 2PMFA 3HN7A 1DLIA 4PPNA 4C14A 3GN1A 5E7QA 2ZTLA 2OP0A 2QVZX 3UH1A 2I4TA 1V3TA 2WM3A 1IUPA 1KAHA 2PTHA 3QA3E 5EZYB 3VVMA 4CETA 4JKIA 3E0QA 5L7YA 2YH2A 3ER6A 3ICQB 4ZI7B 3Q0TA 4BL5A 4ZT4A 4L15A 1JDUA 2OZLB 5CU7A 1NUHA 2Q4RA 3KEFA 4Y6OA 4ZARA 4LC1A 1L4KA 2VHTA 1M7BA 5JC1A 3L6OO 5F98A 1VE3A 1BA3A 2ZXFA 4YAWA 3AUUA 3EPPA 4MVJD 3AF5A 3IMKA 4MZDA 1FYFA 5E1DA 2OWEA 5BVGB 1QS0B 1SQ0A 1WMDA 4C0BA 3D0RA 3VGJA 4EGSA 3DEAA 1EDBA 3NS7A 1M7HA 1QG0A 2EKPA 4JB8A 4YJKA 1NKTA 2QYOA 2RAPA 3AUKA 3SQOA 3EA0A 2D2IA 3RG2A 3E9ZA 5H81A 5BR4A 3V8BA 3C6ZA 1QPBA 1NM5C 3VR6A 1E6WA 1FXWF 5KKNB 1Z5ZA 4RAOA 1AZLA 3KLPX 3DCIA 1NN3A 1DMSA 1EUDA 4HAIA 1UK8A 1ZRSA 3B12A 1Q84A 4UZSA 1UANA 4W7IA 4YRGA 1J1UA 3MIZA 4TVKA 4W5RA 3R8FA 1U8UA 3TUJC 4FGUA 4UAUA 4TMTA 1NHWA 1V8FA 3WLQA 2VKQA 1RNLA 5IVIA 3AW9A 3HU2A 1I0IA 1RQNA 3NTRA 4FFDA 4IQ4A 4D41A 2BP7B 4F1KA 4AC9A 1NJ6A 1UEJA 3SD7A 3KC2A 4JYAB 3WGLA 4UTZA 2CUKA 2QLBA 3SCZA 1F9EA 3ASVA 3WGYA 1HDRA 4WXHA 4DZZA 3DMRA 1ZMRA 3PNVA 4P08A 5FJJA 2N1MA 1JA9A 2FW7A 4HRAA 3RNLA 1U7UA 4F4IA 1DADA 1C9KA 1X0XA 4JASB 4LQCA 3AV0B 2OAEA 1NBME 1Y7PA 4LQ4A 5F73A 4QJ3A 4UNRA 4ZC1A 5KYYB 4DV2B 1XLTC 1YU6A 4QLOA 1LLDA 5E4JA 2FSHA 3JR7A 2X7JA 2A1UA 1JHVA 1NSTA 4DIEA 4HQRA 4FZ3A 1GSHA 4CZ2A 4DMCA 5HE9A 1GUZA 2Z58A 5BUQA 2GDJA 3HJBA 5ADHA 3O8RA 1P74A 2CFOA 2TYSB 4RD3A 1SFRA 1DO8A 3E1GA 2PLFA 3GB9A 4JSYA 3V2HA 1SIUA 1R9NA 1U4NA 2QU7A 2YWFA 1NUAA 5L40A 2VDPB 3LT0A 1G8GA 1MO4A 1N7JA 1YQ9A 2GEKA 4MWOA 5AVKA 2XWSA 2RI0A 5BV8A 5I8WA 3PQFA 1JZQA 3VR5D 2VA8A 3AY6A 4ASUA 4KQ6A 4JLKA 3ZCSA 1KZ9A 1GL9B 2SBTA 2PT5A 3VO2A 3LA8A 4IOMA 2HQOA 4CM3A 1N0HA 1XPUA 1QNLA 2OXRA 3BRCA 3OOSA 3EZNA 5F2EA 4KQKA 1TYZA 1GWNA 4FFLA 1Z2NX 5H5JA 2CXXA 2IYNA 3IR6A 4AZ3A 1UFQA 3QV1A 4I1PA 2B1RA 1IY2A 2WG1A 1MJFA 3BFXA 3A27A 4PYNA 5AM1A 1ONNA 2B8NA 3F67A 5HZHA 4Q4JA 1I7LA 1FQKA 4H1VA 4J43A 2Q6TA 3TRFA 4ZZ0A 3KVNA 3HO6A 5B2EA 3SBXA 1K98A 4UPDA 3FI0A 5PGMA 2ZSAA 5ICSA 1KJJA 2P6PA 4MW1A 4NS4A 5CA0B 4W5WA 1CJVC 4NZZA 1KK2A 1AGPA 1DWPA 2GKOA 2HIMA 1K6MA 2XT9A 4CGZA 3JQ9A 3OF5A 1VKHA 3UMFA 1YU9A 2H8KA 4Y2RA 1SUWA 4UULA 2IHKA 3CF6R 2CNWD 2I0FA 4DQ0A 1GFIA 4BPBA 2QNBA 4KPUA 3L04A 3ND7A 5JATA 2BTEA 5IN5A 3VH3A 4BKMA 4B1FA 3BULA 2WAXA 4B43A 1C7EA 1I2BA 2GBIA 5GOTA 2XMRA 2WHYA 1HE4A 2G63A 3I01A 2C59A 1L9XA 2GI4A 4ILKA 3O1HB 4LYFA 5CM8B 4X6YA 1GA4A 2KQUA 3WL4A 1CUAA 4GNRA 1NVVQ 2CLEB 2WDPA 1Z62A 2Q3EA 3NUGA 3Q7RA 4MICA 3N75A 1M2OB 3LUKA 1QRTA 4BEVA 5TR9A 5BO5A 4IDDA 1KERA 2JVIA 3IH5A 5GAJA 5K20A 1H2EA 1RMTA 3GMTA 1YVPA 3LPCA 1C4OA 3S8MA 1NQ5A 2CZQA 2Y92A 1E60A 3K9NA 3DE7X 3G8CA 1HSZA 2FR8C 5A5FA 2QS9A 3AKCA 4WNIA 2DFKB 2XBMA 4IV8A 1VI5A 2W6NA 1MJGM 2P8SA 2WJPA 1PP4A 1KY5A 2HDWA 1PEYA 3C1UA 2OGUA 2I99A 3D6JA 4N7RA 4XVQA 3S1SA 3MHPA 1LV8A 1NJFA 1HFJA 1PAUA 1PR6A 3JCZA 4JT8A 3FOWA 2XTNA 4Z1MD 3MJ4A 1ZIXA 5NULA 2XYQA 2ZYSA 4J2TA 1TGVA 4MR9A 4ECEA 1G7RA 1YQGA 3OEED 1NVGA 4CT5A 1MB2A 3OEYA 4MW5A 2XD4A 3SBOA 2HZ7A 3A10A 4X8LA 5KVQA 5AFSA 4P3KA 1E0SA 2G4VA 1J70A 1F06A 2RIPA 1KYIA 3PCRB 4GMFA 3O4FA 3M6VA 4F11A 4I1VA 2MYPA 3RKUA 5F23A 5AW3A 4RZHA 1J25A 3WMRA 4FNGA 4X61A 4E08A 3AKEA 2C3YA 2R4TA 4GZMA 1YZKA 3OOYA 3ACBA 3DOJA 3ORSA 3CCCA 3QNUA 4RMGA 5INTA 1YQWA 1WMSA 2ZREA 4LRTB 1VLVA 4MV1A 1UBTS 2E82A 1G3IA 4ND8A 5AUPB 4IDHA 5I9SA 4Q7EA 4B82A 5EJ5A 2HJVA 4XOIA 3W3ZB 3V8NA 3CLSC 1XXHE 3Q5GA 1IVNA 1VL2A 3ADDA 3S4YA 5E1BA 2WPDA 3JATA 4C7OA 1X0VA 2WSLA 2PLAA 3D8RA 5LP6F 4G1BA 5EHGA 4AX8A 1C1XA 1UMBB 1GU7A 2QRPA 2LXNA 1QVAA 1QOPB 3DOOA 3MT8A 1Q2XA 1XXHB 5AD1A 1JXOA 4NWIA 4TTVA 4WK0B 4JDPA 2REOA 3I09A 4CM4B 3G0CA 3L1HA 3W9UA 4D7AA 2CSXA 4RQTA 3HLYA 3NTLA 3D7KA 4BNUA 1JR6A 1IQPA 4ER7A 4N5LA 4GOMD 1M2VA 4MH0R 3ZWYA 3OPXA 5JZ9A 1WV1A 5D1HA 1O95C 3GRFA 3ADBA 5CD9A 1XELA 1RLOA 3X2EA 4PZCA 1X8JA 4RQUA 1HTWA 1OLOA 2GO7A 2JIZD 5EKTA 5ICCA 2IEGA 1E3LA 2PRYA 1OZ0A 4M1OA 5AK3A 1R8XA 1TJ4A 2B6NA 3FMFA 1F6WA 3N6XA 3N8DA 4NNJA 4J94A 2X14A 1WF6A 4OP2A 5CJPA 5DX8A 2IT1A 3F2IA 3J7TA 1CF9A 4FSXA 4ODIA 2Y1GA 1VTKA 2Z3VA 1XPJA 1ZAYA 2BOVA 4D57A 2ZLBA 1WZEA 2DY1A 4HGRA 4C30A 1VJCA 2Z0MA 4ZVQA 4BEWA 1ZHOA 3E8XA 5KUTA 1KK1A 3C6MA 5LMNB 1A9ZA 1HV8A 3FAZA 3QUCA 2YDYA 3IBFA 1NX9A 2EZTA 5FNVB 3IVRA 3SJAA 1SHUX 1NP3A 2EKLA 3THOA 5ALOA 3RNOA 4CLOB 4EY4A 4D6XA 2B82A 3QG1A 1RI5A 2Q5FA 3AF4A 5LQNA 4LFAB 5F51A 1TTQB 2O2XA 3GRUA 3H8VA 1GPDG 2H2GA 3HCPA 4JUFA 3NV7A 1J9EA 4Z4IA 4FGLA 1WJGA 1BE0A 1JSXA 5DZSA 1E7MA 1FDRA 3I5MA 1QO0A 1JA0A 4M9CA 5DHQA 5ELXA 1Z63A 2XBLA 1R15A 4ER6A 1DG3A 1HKUA 1K27A 1RVV1 3ON5A 1D6JA 4JP2A 4MVJE 4UXIA 4P84A 2RGXA 5C7OO 2OKCA 1RP1A 2HTEA 4DMGA 4LSZA 4AJKA 1E0DA 3HABA 4ZT3A 3HZZA 4BMOB 1JV2B 3G8DA 5H82A 1JFFA 4D3FA 3UEOA 1WXDA 4KQHA 2NTNA 2P90A 1R9GA 3MMPA 2IVFA 4MB0A 4MO2A 4NBUA 1A3CA 2X19A 1GP2A 5LDDC 2R44A 3JQAA 2XUIA 3SZ3A 1XLVA 1NRWA 1GG8A 1BE1A 2DPYA 4F93B 3H19A 4OI4A 1A2BA 2JFFA 4RMHA 3NM5A 2XLCA 1H9BA 2YY5A 5FLEX 4JI1B 1T9ZA 4KXXA 1ORTA 1E18A 3K9BA 4N01A 1OXTA 1AS3A 2ZT7A 3KTOA 4P93A 3FPKA 4YECA 4DG5A 3AL2A 3K1YA 3W7BA 3LHIA 1MPXA 4KVFA