4DVJA

Crystal structure of a putative zinc-dependent alcohol dehydrogenase protein from rhizobium etli cfn 42
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
343
structure length
341
Chain Sequence
YFQSMKAVGYNKPAPITDDASLLDIELPKPAPAGHDILVEVKAVSVNPVDYKVRRSTPPTDWKVIGYDAAGIVSAVGPDVTLFRPGDEVFYAGSIIRPGTNAEFHLVDERIVGRKPKTLDWAEAAALPLTSITAWEAFFDRLDVNKPVPGAAPAILIVGGAGGVGSIAVQIARQRTDLTVIATASRPETQEWVKSLGAHHVIDHSKPLAAEVAALGLGAPAFVFSTTHTDKHAAEIADLIAPQGRFCLIDDPSAFDIMLFKRKAVSIHHELMFTRPMFGTPDMSEQGRLLNDVSRLVDEGRLRTTLTNRLSPINAANLKQAHALVESGTARGKVVIEGFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative zinc-dependent alcohol dehydrogenase protein
publication title Crystal structure of a putative zinc-dependent alcohol dehydrogenase protein from Rhizobium etli CFN 42
rcsb
source organism Rhizobium etli
total genus 99
structure length 341
sequence length 343
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dvjA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4dvjA01
1VJTA 1FDUA 4CM6A 2EWMA 2V6FA 1UZMA 3ONDA 3VAZA 1ADFA 1PGNA 4FJ1A 1Y8RA 1KERA 4H16A 4D43A 3GH3A 1ZXLA 2O3SA 1MG0A 4DBVO 3AOGA 1HWYA 1NX6A 1EUZA 4XEHA 1Y9AA 3O4RA 2DLDA 3PLNA 4TROA 4J2HA 3JQCA 1A4UA 2EV9A 2V6BA 3KYCA 1ADCA 1T26A 2TMGA 3EC7A 4AJJA 4ND2A 4PG7A 4BKUA 2C82A 3H8VA 4ILKA 3OJOA 3ZGYA 3ZI0A 3K30A 4XRGA 1H5QA 1NYTA 4B4VA 5U1PA 1P45A 4PLYA 3ROPA 1F0YA 1SAYA 3RUEA 1EBFA 1GEEA 1JWBB 1WLYA 4UREA 3W8EA 5IDXA 1GDHA 1ZO8A 1N9GA 3M1AA 4LMRA 4ZRMA 1GUZA 4CM9A 1PQWA 4MIOA 3HDQA 4ALJA 1TLTA 2NTNA 1XLTA 2VZ8A 1HXHA 1U28A 3JQ8B 3LT0A 3W4IA 4FQ8A 1Y7TA 3PDJA 4I5DA 4XYEA 2BGLA 4BNYA 1QKIA 3AFMA 5G0UA 1GL3A 4H3VA 3DMYA 3KEOA 2VT3A 3G1UA 1NQTA 3AI2A 3PK0A 3WR5A 5AXCA 2HO5A 3OJ0A 2NTJA 1LSSA 2X5OA 1PZHA 3KRTA 3UCXA 3G79A 1KVRA 2IZ0A 3KLMX 4PLWA 3NV9A 5JDCC 5B4VA 1YBMA 3I6QA 4IBOA 3BMOA 3P7MA 2GUGA 2Y1DA 1EQ2A 4XYGA 2A9FA 2HRZA 3HB5X 1X1TA 2DBZA 3L9WA 3AY6A 3JQBC 2R00A 3HN7A 3JQ6A 3NJ8A 2H5LA 4RO0A 2VN8A 4FCCA 1PIWA 4B79A 5H83A 3TZCA 2B4TO 4M55A 3E9NA 4D7AA 2UUPA 1Q7BA 3PGXA 4J1QA 3QHAA 1ID1A 4L74A 4K6CA 4J91A 3JQAA 5COAA 2E4AA 4RPHA 1GU7A 2IE0A 3EGOA 5F1OA 3JQGA 1C0LA 3B70A 3WJ7A 1KS9A 3WFJA 2Q50A 5JDIA 1ZK0A 3NYWA 3TFQA 4HADA 3G17A 3GEGA 5AOVA 3LVFO 4UULA 4XGKA 3IMFA 3PWZA 3DQPA 4YVFA 1D7OA 1U7HA 3PIDA 2W98A 4WKGA 1OI7A 4PLFA 3OH8A 3PWKA 4CM4A 4B4OA 3PHJA 1XEAA 4JP2A 1A7AA 4II2A 4TSKA 2UAGA 5T67A 4NG5A 4LN1A 3KYBA 1Z82A 1J0XO 2B4QA 4AL4A 1C1XA 1R15A 4I1IA 3MJ4A 1HSOA 3LLVA 1HRDA 1YJQA 4W82A 3LF1A 4OOFA 2DQ4A 2ZCVA 4K1LA 3QV1A 4OSOA 5DBGA 1HYHA 3GC6A 1EEHA 4O1MA 4BO9A 5CDYA 3JQ7A 1O95A 4MKZA 4YJDA 1QMGA 1PZGA 5KNLA 1XGKA 2AE1A 1WXDA 2W2KA 2V6MA 3OICA 4CQLB 2PA3A 2NV6A 1UXJA 4RLSA 3WTBA 5F21A 4PRKA 1DAOA 1T4BA 3FHLA 3JD0A 1SMKA 4HKTA 1PEDA 4CLOB 1V3TA 2FRDA 4LCEA 2QW8A 5KVVA 4BO3A 2FWMX 3RUIA 2IXBA 4IMRA 5JMPA 3TFOA 4ZU3A 3WJAA 2JD2A 3BMCB 5K9ZA 1TB4A 3ASVA 1R4MB 1LEHA 1VSUA 2Q3EA 5FF9A 2HJSA 4CV0A 1IB6A 4D0SA 1I5RA 1QORA 2FMUA 2HU2A 4HV4A 1GYPA 3B20A 1TVEA 1I32A 1PJCA 2WEKA 1QSGA 4BV9A 4LCJA 3LSYA 4UVHA 5IZCA 2PZJA 1HDZA 1XSEA 2PKQP 3BZUA 3UICA 1ZUD1 2POQX 1GAEO 4GSKA 3WSWA 4MIEA 1HT0A 5EMHA 4BMVA 4E33A 4B3IA 3DHYA 1ONNA 3T7CA 1E3SA 1QYCA 2D4AA 2DBQA 5MDHA 1MFPA 3HNPA 4OHUA 3FSRA 3R6DA 3S2FA 3VZQA 2ZTMA 4OXYA 1GCUA 2UUOA 3EYWA 4Q3CA 3W4JA 2P9CA 4XQEA 3K9QO 2VUTA 3UCFA 3W6UA 1IOLA 4TZKA 4F6LA 3W8FA 4Y6SA 1O0SA 1NWHA 1ZEJA 3NTRA 4FW8A 3VKVA 2GF2A 3W8DA 4E32A 2NU6A 1BDMA 4YJFB 1RKXA 4EZBA 2ZCUA 1EUDA 4L4RA 3X2FA 1XR3A 1E92A 2FPGA 4FPXA 1QLJA 2GR9A 3QVSA 4Z9YA 1DIRA 3NUGA 5DP2A 1ML3A 4FR5A 1YH3A 1WMAA 3AI1A 2FP4A 3PZBA 4XCVA 1YS4A 1QR6A 2WD8A 3NRCA 1VL0A 2PZMA 2HQ1A 4NI5A 5G0VA 2O7SA 1YRLA 1WVGA 3QW2A 1XU9A 1FXSA 2DBRA 1V8BA 3QQPA 3H9GA 2VRBA 2I3GA 2P4HX 1XWFA 2AXQA 1P1RA 1L7EA 1RJWA 4EUEA 1VI2A 1NVMB 2X6TA 3HDHA 1XU7A 4M87A 4E2ZA 2QZZA 3JQFA 5TLSA 3N74A 4GWKA 2I5PO 1PJLA 2YDYA 3DOJA 4TRNA 2BFOA 1BDBA 3U49A 3WLEA 3UOGA 2OP0A 3TJRA 4BNFA 5IDQA 4E3ZA 2PZLA 1J6UA 4E31A 2WD7B 1KIFA 3FBGA 3BMQB 3PIIA 3M2TA 3TL2A 4MIYA 4P22A 4RVDA 3HFSA 2VTEA 1ZVMA 4A27A 3IC5A 1P33A 4TZTA 4YT2A 1EUCA 2Y0DA 3WQRA 3EHEA 5CG2A 2ZB7A 4B7XA 4HBGA 4NH4A 1KBZA 3JD3A 1SNYA 3G3EA 1ZEMA 4OIMA 3JQ8A 4UEKA 1PJ2A 4DYDA 1HZJA 1XDWA 4C7KA 1JTVA 1R0SA 1R0LA 4Q39A 4AJEA 1R4NB 3E5MA 1PR9A 3C85A 4OQYA 4XIYA 4DQUA 1T4DA 3D0OA 5H81A 1HE3A 2ZQZA 4N7RA 4DYVA 4EGFA 4Q3BA 2BD0A 3U4CA 3UFXA 1P0CA 1ZSVA 2X1HA 2Q49A 2PFGA 4GSLA 4QTZA 1HDGO 2V6GA 3MJEA 2BI8A 1HE4A 3Q1LA 1NM5A 2RIRA 1KC3A 3FBTA 2LDBA 1CERA 3F46A 3KSDO 4IGFA 5DF1A 2OOSA 1ULUA 3B1FA 2A94A 1ULSA 2J5QA 5LC1A 4RCVA 1L7DA 1D3AA 1QRRA 4DPMA 5IFLA 5GZ6A 3P5SA 2O48X 5T5QA 1YBAA 2EERA 1Z74A 2FPIA 1A71A 1LDBA 1UAYA 1GZ3A 1VLLA 1IZ9A 4GQAA 1OC4A 2NQTA 4U6SA 4CM8B 5JAZA 4DC0A 5EIOA 1NPYA 1Z73A 3ASUA 3ZWNA 3L77A 3WGQA 3TQHA 2UVDA 3FPLA 3FF4A 3WTCA 1B7GO 4UVGA 5B4TA 3NDJA 2PH3A 3E18A 3PXXA 3C7DB 4FBGA 4BO0A 1X7GA 1TT5B 4E5PA 2YQ4A 3RC9A 2ILTA 4W6ZA 5T8KC 1N8KA 1UXGA 2CF5A 1Y8QB 4FC7A 1PWZA 3CE6A 4BNNA 4CUZA 4RL6A 2D5AA 1FMCA 4E5MA 5J23A 2ET6A 2YJZA 4OGWA 4AICA 4I9NA 5G0WA 3F5QA 5EJ2A 1D8AA 2ZB8A 1U4OA 2CUKA 3R1IA 2FOIA 5L53A 4XRRA 3ZDFA 2VWPA 3ZU5A 3Q6IA 5TS3A 4CMBA 3QVWA 4W9NC 5ILGA 1I3NA 3GQVA 3DL2A 3PJDA 5AYVA 4LMPA 1GADO 3PTZA 4D41A 5HBRA 3NT4A 1DC6A 1I3LA 2OGUA 5ADHA 3K96A 3S8MA 1EMDA 3BXXA 3L0DA 2Y1EA 3GPIA 2NU7A 5CEFA 3L6OO 4CQLA 4QSMA 2Y1CA 3I52A 3JQ9C 3RC7A 2VYVD 1C0IA 4CLOA 1E3WB 2O3RA 3VZRA 4LVUA 5KJ1A 3PHHA 3ZN2A 2OL4A 4HNHA 1ISHA 1PL6A 3WB9A 1PL8A 3SBOA 1YVEI 4J4HA 4RJTA 4ZN6A 1IE3A 4DREA 3BMCA 1WDLA 4Z0PA 4IXTA 1FDSA 1LDNA 2GERA 5HS6A 3L9XA 1R4MA 3W1VA 3BTOA 4QO7A 1YOVB 4E30A 1N1GA 3GFGA 3SX2A 4CJXA 2V65A 2D8AA 2WE7A 3CSDA 1LLCA 5DCYA 2HMTA 4J16A 4XIJA 2DT5A 1JDJA 5JAIA 1E7WA 2GDZA 2XPCA 5I9NA 3OSUA 1E7QA 2P9GA 1BSVA 3LT2A 3MTJA 1KEPA 3GHHA 3WLFA 3L4BA 4RVFA 5C7LO 1SO8A 3CINA 3BHIA 5CDUA 3PJGA 3I3OA 3PP8A 2GZ3A 1DRWA 1GEGA 3SLGA 4KTTE 4GX2A 1SZJG 3TSCA 1VE9A 2YUTA 1NQ5A 1UR5A 3U4IA 3C1AA 3AFNA 4TMFA 3IAHA 2NWQA 3PVZA 3ANLA 1E7YA 3C7AA 3DZFA 4R41A 3RROA 2JFGA 1IUKA 2PD3A 3ANMA 4J0EA 2Y1GA 2WDZA 1X14A 3F6YA 1ZK4A 4FGWA 4G65A 1C14A 2PGJA 1QG6A 4QECA 4XYLA 1GQYA 1LA2A 4M86A 1KOLA 2NU8A 2VZ9A 2NLOA 1YQXA 3E03A 4E12A 3ZNNA 2C2XA 5TQVA 3TPCA 5LDGA 1OC2A 4EITA 1DC5A 1ZK1A 4LK3A 4ZGWA 4YJFA 2BMAA 4R54A 1SBYA 1HYGA 3EZLA 2B83A 4XWYA 2H63A 4RF3A 3KVOA 4GLLA 3UH1A 1Q0QA 3PHIA 2YHIB 3QWFA 1BHSA 5K1SA 2HDHA 2NQ8A 3Q3CA 5EL0A 1GTMA 1S6YA 2Q2VA 5FEUA 4KWHA 3TOZA 4DXHA 1HZZA 1HL3A 2RBEA 2A35A 5ER6A 1B8PA 1HDXA 1EQUA 2O4UX 4INAA 1KC1A 1PTJA 4CV1A 5ITVA 4IDDA 3CPSA 5GZ3A 4H15A 1LSUA 3E82A 2JFFA 4WOJA 2IEBA 3BTVA 3ZCXA 5CAEA 1G0NA 3GA0A 3VHRA 4WLEA 1LUAA 2QRKA 5A9TA 3RUHA 2VT2A 1KEUA 1M6WA 1PJBA 3AU9A 4BKPA 5ICMA 1ONPA 4L76A 4EBFA 3CTMA 4DLBA 1PU2A 3E48A 3VH3A 4IGEA 2DUUA 4IIVA 4XQ9A 4CMIB 2XXBA 1Z6ZA 2Z1MA 3QRWA 2GNAA 5I7SA 4A03A 2IRWA 4AFNA 5DOVA 2PY6A 4PLPA 4ZQEA 2VYVA 1T1SA 2X0NA 5BSHA 4CPDA 4YXFA 4I9HA 2Q1TA 2WD7A 3BMQA 4HFNA 4WECA 4LSWA 4TRJA 5GY7A 3EW7A 1O9BA 2VWHA 1UDCA 1WAMA 5IXSA 2B35A 4BNZA 2JFHA 5EQDA 5DN9A 4R1SA 5IF3A 1K5HA 3FRJA 2DVMA 4CM3A 5EINA 1X15A 4GH5A 4ALKA 3OQ6A 5TNXA 1R4NA 4PN3A 3VPFA 3NDRA 5L45A 1I2ZA 3EDMA 2AE2A 5DCWA 3K5PA 1HDCA 3QWAA 3ADOA 3H5AA 5DULA 4BO5A 1GR0A 3AJRA 3OA0A 4DIFA 5BSFA 4FB5A 3KXDA 3GVIA 2O50A 3ONEA 4GKBA 4Q3DA 3VVCA 5A04A 5C7OO 2H9IA 3JQDA 3KO8A 2Q4BA 3OJLA 3H3JA 1YONA 1JKIA 4LSMA 1NTOA 1TT7A 5DBFA 3DTYA 4YT4A 4QO8A 4XDYA 5HS4A 2EG9A 1ORRA 2PTGA 3P19A 1XYGA 1LC3A 5IDWA 3K2BA 3DZBA 5DNAA 3AU8A 1V6AA 1BGVA 3TNLA 5ES3A 2I9PA 4YA6A 4JBIA 4CM8A 1YB4A 2F1KA 1DFIA 3H5RA 5A05A 1DHTA 4EJMA 3JQAD 1K3TA 1DLIA 2GZ1A 4IDFA 4J6FA 4CL8A 4CV2A 1A4IA 4RDIA 1U3VA 5G4LA 1UZLA 1DXYA 2PD6A 4GAEA 3CXRA 2YQ5A 4Q3AA 3A06A 2VZ0A 1TT5A 4FFLA 2BF7A 3DFUA 4K26A 4ZQHA 1PS9A 2CVOA 1GFSA 1TEHA 2IODA 1OFGA 2D1YA 3MJTA 1H6DA 4BNMA 1Y8QA 1ISIA 4UVDA 3GT0A 4A5OA 3IOYA 2ZYAA 4TRMA 4BGUA 1U3WA 2GASA 5A3JA 1Z45A 4IXWA 3I9NA 4KDEA 4Z6KA 1PJSA 1R6DA 4CQMB 2EW8A 1ZSNA 4NNJA 3I6IA 3JQEA 3KB6A 4R9RA 2JCXA 4BNGA 3MWEB 4CLDA 2X5JO 3VPGA 2JHFA 5IZ4A 1I8TA 1A9YA 3KV3O 1VKOA 1WP4A 4MJLA 2X86A 4Z3KA 4ZHSA 3DAGA 2O7QA 5TGDA 1AXGA 3D1LA 5A1TA 1JKFA 1TI7A 4DBZA 1OMOA 1CWUA 1UP4A 3IKTA 4U8GA 4R68A 4RF4A 1WWKA 5BQFA 4I5EA 2EP5A 1DSSG 1P1KA 1B8UA 4AG3A 1UDBA 2BH9A 1D4FA 3WGGA 2ZATA 3Q0EA 3QJ5A 3C7CB 3RQSA 2BFMA 2YFQA 4PLVA 1WMBA 3UVEA 3SJUA 1LDYA 1JAXA 3GRKA 4KTVE 1L1FA 4DIBA 3GNSA 5TX7A 5TT0A 2YDXA 4DQXA 3DMTA 4BNXA 3WYCA 5CHEA 1VC2A 1P0FA 3HN2A 1MC4A 3R3SA 4LRSB 3WX0A 5TC4A 3I1JA 1SB8A 3KOUA 4NU5A 3DO5A 4N18A 1GQ2A 3RKRA 2GSDA 1PGOA 3SJ7A 3VZSA 2NADA 4RORA 4KUEA 5KOIA 3PWSA 5THKA 3ZU4A 3WSVA 2ZJ1A 4IM7A 5I7VA 3OIDA 3INRA 1NFQA 4KMSA 2DAPA 3R3JA 3NKLA 3WICA 1U4SA 2I3AA 1Q1NA 4B3JA 1XKQA 5JAMA 2Y1OA 3F47A 4URFA 5K6AC 1SOWA 4QFDA 4GWGA 4E21A 3E5RA 4ZRNA 5HRUA 1H0KA 3MWDB 3D3WB 2GRAA 3U0BA 5I8ZA 4ZJUA 1DHRA 3AOEC 3P2OA 4DMMA 3K2EA 4PG4A 3QVOA 2PH5A 3SC4A 2E49A 4JLWA 5U9CA 1KY5A 1YL5A 2X22A 3I9OA 3DBVO 3JYOA 4J4TA 4YWJA 3ZU3A 1LQUA 1K6JA 5KCZA 3LU1A 3VH2A 3ZHXA 5DDIP 3NDIA 2JAPA 1P44A 2HK7A 1UP6A 4N5NA 5G4KB 1EBUA 8LDHA 1CF2O 1NNUA 1XHLA 1GUFA 2PZKA 2YHIA 3HFGA 3K6JA 3ZV5A 4BMNA 3FTPA 1HLDA 2HAEA 4IDEA 3ROKA 3INTA 2OO5A 4D79A 4BMSA 1E1KA 4D3SA 1HETA 4UEOA 4ZQBA 5KWEA 4OL9A 2Q1WA 2O3QA 3RBVA 1E3LA 2OORA 3C8MA 3HJAA 3QSGA 3V8BA 4YB8A 2BI7A 4CODB 4LW8A 4FJ0A 1A5ZA 1DJNA 2EJVA 2Q45A 3DBRB 3MOGA 3VDRA 1CQIA 5G0TA 3D3EA 3X2EA 2SCUA 4IS2A 3OQBA 2Y1FA 1MV8A 1P1JA 4XB2A 4PGFA 4XA8A 4U7WA 4J2OA 4OJNA 2HMUA 3WQSB 2CFCA 2EP7A 4YJGA 3HHPA 2JJYA 1UP7A 3H6KA 2P2SA 4RGBA 1LSJA 4CMIA 3ITKA 3BTUA 1GY8A 3DC2A 3P2YA 2GO1A 4XDZA 1B16A 3ADPA 2X4GA 2AHRA 1P1IA 1SOVA 1AXEA 4IDAA 1MXHA 3G49A 4OXNA 5TJ9A 1HE2A 2UYYA 4KQWA 1NHGA 4ALMA 2FZEA 2J8ZA 2C5AA 3JCZA 3VH1A 1IYZA 5T64A 1A72A 5B1YA 3RWBA 5CP8A 3Q2IA 4N54A 1YKFA 1D1TA 2Y68A 4HWKA 3ETGA 1HSZA 1T2DA 3F1KA 3H2ZA 3LF2A 2JD0A 1UDAA 3KYDB 4ZICA 3F4LA 1AHHA 1MG5A 1RM0A 2X7HA 1LU9A 2V7PA 1EE9A 3DHEA 2NVBA 4CMAA 1I2BA 2FR1A 4WNIA 5TSDA 3G0OA 4DIOA 1Y9EA 4Q3EA 4DC1A 3PRJA 1B2LA 2C7GA 4FIZA 4AJ2A 3NTQA 4BKOA 3MTGA 5C5IA 4CR8A 5JY1A 5I9LA 1H6CA 5COBA 4J1SA 3M6IA 3MJVA 3RUFA 6LDHA 4IQGA 3WS7A 4IS3A 8ADHA 1PWXA 1EZ4A 2JCYA 3DZIA 2X8LA 1HYEA 2AG8A 4JJIA 3VDQA 4FFMA 4YAJA 5L7TA 4GPD1 2I99A 3KETA 2PV7A 1HTBA 3DZJA 1X13A 3BMNB 2WM3A 1N7HA 1DIGA 1T25A 2BKAA 1F17A 1NR1A 1JU9A 3NAQA 2DTXA 2ZB4A 1YGYA 2EKQA 4A26A 1G6KA 4GGPA 1IL0A 3LYLA 2FSSA 3TOXA 3AWDA 3FNHA 1KY4A 3ROMA 3WIDA 4DVJA 1DIAA 1EVIA 3HG7A 3B1KA 2Z95A 2W90A 1SEVA 4NBRA 4HUJA 2O23A 1W4ZA 3E1KA 3GVXA 4CQMA 1DLJA 1RM5A 4OXKA 4NFYA 3ZWAA 2I76A 4BKQA 3WGIA 3LC2O 3OMLA 4IJVA 3AM4A 4WLNA 1DPGA 3DBHB 2H6EA 4BNTA 1XA0A 1Q0LA 2I6TA 2ZJ0A 3INGA 1JLLA 1NQOA 4Y67A 2EXXA 3PQDA 1JA9A 1E77A 2HCTA 4MKXA 1YB1A 2YYYA 5AXDA 4WGGA 3E6AA 4XQCA 2B37A 3ICPA 3O8QB 1VKNA 4MVJE 3RC1A 3BIOA 3FCOA 1NQAO 1UUFA 2X9VA 4BO1A 2VHZA 3AUUA 4GLOA 1ZZEA 3OFSA 1U9JA 2JCVA 2Y0EA 1N2SA 3R0IA 2FPPA 3DWFA 5JE8A 4IQ8A 1IHYA 3FN4A 1JW9B 4CM7A 4D3FA 4J7CA 2ZYDA 1LTHR 2R2GA 3ICCA 3ZW8A 1LRKA 1EVJA 5BSEA 3JYQA 5TIIA 1NFFA 4YJHB 2AW5A 3H9QA 5F5LA 1MX3A 5JFOA 4FJ2A 3RJ9A 3WG9A 4EEXA 5JXWA 4D44A 2VUUA 2NVUB 4J90A 3PPIA 2XF8A 1M6HA 1H2BA 1JVSA 4JJGA 3HZZA 3VOSA 4CMEC 3RD5A 2OP1A 3ORFA 4Y6PA 4NK5A 1H9AA 4P4NA 5KJCA 3V2GA 3QWIA 3AM5A 2IDZA 2NACA 5EESA 3RFTA 2DM6A 2VWQA 4TQGA 4BOYA 2O3UA 3RBZA 2EHDA 1X0XA 3U9LA 2Y67A 5JW6A 1DRUA 3GY0A 4R3NA 3GNQA 4WNCA 5L95A 4IDGA 4M54A 2BFPA 2O3JA 1O89A 3D3WA 4CLEA 3DAPA 3L07A 3UHAA 1JKJA 4YYZA 1E5QA 3I83A 4FSHA 1PSDA 2R6JA 4LRTB 1MUUA 4BNLA 1RWBA 3WQQA 3OQ1A 5FYDA 2PKQO 3ETDA 3MCVA 4XGNA 3EUWA 4PZDA 2NNLD 3HDJA 3RUDA 5L9AA 4JJFA 3U09A 4LGVA 2D0IA 3RVDA 2BELA 1VSVA 4XYBA 5G4KA 1BG6A 4MP6A 4EJ0A 3UCEA 1WZIA 2AEMA 5JDCA 4A10A 1MC5A 3H9JA 4JQCA 4FOOA 5JCJD 2C7VA 1NPDA 3BHMA 3WMWA 4MVJD 3UGKA 1MGOA 1T2EA 1O6ZA 1YDEA 1N92A 4BNIA 3OIFA 5F1PA 2JKVA 5B37A 1EDZA 4R5MA 3JQBA 3WYBA 3TDKA 4OYRA 1Y6JA 4NFHA 4F6CA 3DBRA 3WIEA 3AUAA 4R1NA 3S2IA 4ND3A 3DOOA 4JBHA 3VC7A 4ZQFA 3DTTA 4G81A 4IINA 1QYXA 1B26A 1Y81A 1YO6A 1EDOA 3OHSX 4RPLA 1MLDA 4MPDA 1DIBA 1AE1A 1E7RA 1W0CA 1T2CA 1ZBQA 4YDRA 4L9RA 4AJLA 2BGKA 2C07A 3SVTA 4DTIA 4AJIA 1NASA 4WCDA 3GEDA 3HDYA 3KSUA 3V1YA 4RQUA 1QYDA 1GCOA 4WLUA 4R4JA 1DDOA 3I9KA 3RAJA 2OUIA 3IJPA 1K89A 1CJCA 2VNSA 1ADGA 3FWNA 3PHGA 4WEQA 3RC2A 4NPCA 3ZV4A 2O4CA 4RV9A 4WCFC 4UVIA 5ER9A 2VHWA 3MZ0A 2YV2A 4WOKA 5T57A 2C29D 1XCBA 3D64A 5I9MA 1I01A 2VNAA 4CMJA 2X0IA 2E37A 2OHXA 1PJTA 1NAIA 3QY9A 5JAQA 3PZRA 4NQZA 1YL6A 3KYDA 3PYXA 2GN4A 4YAEA 5A5EA 4YQYA 2QYSA 5A3VA 3H3FA 1GYRA 1Y5MA 1DB3A 1ZXBA 2DPGA 4OO3A 3K8ZA 4RVGA 4ESOA 5KJFA 3ZNOA 6ADHA 3IJRA 3N7UA 1OAAA 4R51A 4RPKA 4J7XA 3RIHA 2VQ3A 3EMKA 4JGBA 3HB4X 2Q1SA 3BTSA 2H1SA 4XX0A 2GGSA 4HFJA 4WCFB 4WUVA 3DONA 3GEMA 4IPTA 2C0CA 4C4OA 3GLQA 4CM5A 4OKIA 4K28A 5C7IO 1N5DA 2GD1O 2XXJA 4O5OA 3AY3A 4R69A 5JY6A 3BMNA 4M1QA 3RFVA 5LCXA 3E9MA 1U3UA 1FK8A 1NP3A 2NSDA 2R00C 4UEJA 3A9WA 5F3RA 3MEQA 4J3FA 3V2UA 3ZW9A 1Q2XA 1U8XX 1GV1A 3CEAA 2QZ9A 2D2IA 3ITDA 1I33A 3JYPA 3ETEA 1R16A 2C54A 3ENNA 1YQDA 1HF3A 3UKOA 3QA9A 1ISGA 5EN4A 1PR3A 3HADA 3H7AA 1HE5A 1CRWG 4BO7A 2PKRA 3AK4A 3VPXA 1CETA 4TRRA 5CEEA 5JDIC 1UXKA 1IHXA 3JD2A 1T24A 1W8DA 1GZ6A 1ZMOA 2CDCA 1KVSA 5JCJA 4W7HA 4MVJA 2Z5LA 4CMKA 4MP3A 1P77A 3NJ4A 2ZTUA 2GPTA 3NT2A 5BT9A 1YDWA 4BO6A 1ENPA 4DUPA 2PD4A 3GHYA 4IQ0A 5A03A 4E4YA 4BQPA 2HMWA 3GGPA 4P4GA 3U62A 5IN4A 3D4OA 4A0SA 2Q99A 2QYTA 3GG9A 3H4VA 4KOAA 3DBHA 3K73O 5ICSA 3CIFA 4YEDA 4BKRA 1A7KA 1R12A 1X1EA 3TF5A 1ZJZA 3NTOA 2NM0A 3DOCA 2WSBA 3ZWBA 4DMLA 3RFXA 3OEWA 2QRLA 3O8QA 4BO8A 5CDGA 1U5AA 3DHNA 5ITWA 1VM6A 4F3YA 2YFHA 4FDAA 2BLLA 4EUHA 2ZB3A 2RAFA 2QRJA 1UAGA 2JL1A 4NR0A 3RI3A 2G82A 1DBVO 2CMDA 4FFNA 2A92A 3Q2KA 4J0FA 4AJOA 1Y5RA 3FD8A 4OH1A 2CNBA 5JBIA 2FR0A 4YJHA 4HFRA 1EVZA 2X23A 1KVQA 1DOHA 2J6IA 4PLCA 4ZD6A 2AEFA 2NVUA 1H9BA 4WPGA 3IUSA 2YY7A 3WFIA 1ISJA 5C37A 1LRJA 5IZCC 3NGXA 4E5NA 3JSAA 3V1TC 4JP3A 2RHRA 3PLRA 2RCYA 2J5RA 4ND4A 3O9ZA 2DBVO 2HSDA 3KEQA 4LISA 4DLAA 1BVRA 5CEJA 4WJZA 1T2AA 3CZMA 4MOWA 4X54A 4U5QA 1U8FO 2VRCD 5AXAA 3LK7A 1BMDA 3DBLB 2W2LD 9LDTA 2DFDA 4GX0A 2ZIZA 3RU7A 1YQGA 1PQPA 4BS9A 3ZWXA 4PVDA 3I23A 5EPOA 2OFPA 4GMGA 4MVJF 1BXZA 2QHXA 2QIOA 4O6VA 2I66A 1DJQA 2BFAA 3OETA 1B8VA 3FPCA 1IZ0A 3A28A 4MP8A 4BHTA 1I10A 4AJKA 4QX6A 3ABIA 4M89A 4AJPA 5IAAA 5JCXA 3GUCA 2X5KO 2D3TA 4UUMA 3O03A 2C5EA 2VUSA 3S55A 3O26A 1LLUA 4BNWA 1PGJA 1GV0A 1NBOA 1QP8A 1YXMA 3GGGA 3FNGA 4QEDA 4BO4A 3KUXA 3GVHA 4P4LA 3GDFA 2B36A 4ND5A 1YJ8A 2PK3A 3H2SA 2DU8A 2X9NA 3IQDB 3LDHA 4RQTA 4W4TA 2PWZA 3BHJA 4GX5A 4GMFA 1V9LA 2HRBA 3TZKA 1KVTA 1XIVA 2WYVA 1B3BA 4JROA 4MVJP 1JAYA 3HSKA 2PNFA 2E48A 3F1LA 3G1TA 1J5PA 3VTZA 4BQRA 3C1TA 5KVQA 1BRMA 4B4WA 1HDYA 3H65A 4JN6B 3RBXA 3WOHA 3ZNQA 4E13A 4GI2A 4I8XA 1WPQA 3JD4A 4RF2A 1M66A 4KDFA 2CDBA 3NEPX 1ENOA 5T8KA 5LDHA 4JIGA 2PR2A 4Z3DA 4YAKA 3DEYX 2P4QA 1B3RA 1K0UA 2W8ZA 3AUTA 3JQFC 4ITUA 5L51A 3DR3A 3QLJA 3PQEA 2CDAA 5B12A 3E8XA 1E3WA 4FS3A 5GMOA 4IDCA 1LJ8A 1J49A 1ZCJA 3GFBA 4PZCA 5A06A 3VPSA 4W9NA 2DPHA 2PLAA 3NT5A 2O3TA 2G17A 1ENZA 4WLVA 4R1TA 4IY1A 4L0QA 3COSA 3GAFA 1K2WA 4Y98A 1ISFA 3WMXA 1YOVA 3EK2A 1GZ4A 1D1SA 2AG5A 3HE3A 1E7SA 4L4XA 3HQ4O 3ZWVA 1BW9B 3I5MA 3JQ9A 1P1FA 2P68A 4A73A 1CEQA 1VJ0A 4BNUA 2DUWA 1PZEA 4EEZA 1CYDA 3RASA 4PRLA 5A9SB 4BUCA 5DP1A 1FDTA 1ONOA 5JLAA 4XR9A 1B14A 2HMSA 3LZ6A 3T4EA 2P9EA 4UAGA 2D59A 4AVYA 5L40A 4RVUA 1M76A 1MB4A 3EVTA 5HM8A 2XOXA 5TRTA 3V5NA 2B4RO 4MVJI 2NU9A 2WYWA 3JV7A 4KP7A 4WCFA 3UUWA 1XELA 1HKUA 1NHWA 4XGIA 4MINA 2EJWA 1Q7CA 5JC1A 2Q46A 1U7TA 2BRUA 1LXCA 4IMPA 2VRCA 4BGIA 3CMCO 1QLHA 5CPBA 1TA4A 2B69A 4E2YA 3D4NA 1F14A 2W2LA 4YT8A 3DZHA 1PX0A 3S2GA 4M49A 2B0JA 3SLKA 4KQXA 3ZWOA 3STHA 2OMEA 4Q9NA 3TZQA 3WGHA 3GVCA 5KJEA 4RLHA 1P9LA 3A4VA 1KETA 5L4SA 3C1OA 3S1LA 5I8WA 1U1IA 3LLSA 4QT0A 4B3HA 1SB9A 3U3XA 2UDPA 4CM1A 4E5KA 1H6AA 2Y0CA 5L4NA 1PZFA 1ZK3A 4NHEA 4CUKA 4YAGA 4PFJA 2Q4EA 1EK5A 3KHUA 4PLGA 4Z9FA 3Q9NA 4MKRA 4CQMD 1LDGA 1HDRA 2GZ2A 4HX5A 4YRBA 5ILOA 2IZ1A 3ZWPA 3RKUA 2XAAA 1C3VA 3WDSA 4DRYA 1GYQA 4B8WA 4CR7A 4QUKA 4D46A 4FFOA 3CMMA 2Y99A 4NBVA 1WZEA 1YL7A 3GUYA 4DA9A 4NIMA 5FI5A 5AQ1A 1ARZA 1KVUA 4O59O 3V2HA 3WNQA 3V1UA 1BXKA 3ZWCA 5KVCA 3L6EA 4R9SA 1N7GA 4IUYA 2AA3A 5CG1A 3PI7A 2PGLA 4S1VA 3AI3A 5L7YA 1CIVA 3RUCA 3QWHA 5JNLA 4BO2A 5BSGA 1JVBA 2Z1NA 3D5TA 1G1AA 1GUYA 2LDXA 5BNTA 4Y9DA 4NJMB 3ZHBA 3I9LA 1H94A 4FN4A 5HWSA 1O8CA 1Q0HA 3A14A 1UXHA 4RZHA 2EGHA 1S7CA 4W99A 1E0DA 1R0KA 1I3MA 1SC6A 4AJ1A 3OF2A 3PHLA 4XD2A 4I08A 2ZTLA 3GDOA 2HK9A 1IULA 1Q7GA 1UH5A 3IKVA 3WGYA 1M75A 1RM3A 4PIVA 4CL3A 1TXGA 4GL4A 5JYEA 3MJSA 4RPGA 3L4BC 2F00A 2VYND 4F45A 5BR7A 5L3ZA 4R3WA 4XKJA 1YBVA 2EGGA 1ZNQO 2WMDA 3GRPA 3RUAA 4D3DA 2WTBA 1I24A 3DBLA 1ISMA 4KUGA 3MOIA 4FOSA 1BVUA 4R5HA 4OOEA 1WNTA 1I30A 1OZAA 5KIAA 3VPHA 1Z7EA 2GN8A 2QQ5A 4TVOA 2FHSA 4GVLA 5JMWA 3ZHZA 4ALIA 5KKCA 3ZWMA 1Z75A 3ULKA 4J49A 1H93A 3H5NA 2B5VA 3U4DA 3E9QA 3CKYA 5I7EA 4EI2A 4I9UA 5CFZA 1LI4A 4RPJA 3FI9A 1DO8A 2GCGA 1MA0A 1FDVA 1FJHA 4L73A 2YV3A 4J9VA 3DZGA 1SCUA 3M1LA 4NK4A 3DFZA 3EZYA 3B1JA 4AJ4A 1EE2A 1ZSYA 1DC4A 3D5QA 4FFRA 1H2HA 2HK8A 2VCYA 3QE3A 5A4DA 1NPTO 4L75A 1MFZA 4UUNA 4DGSA 3ST7A 5TT1A 3VH4A 1ADBA 1JQBA 4XJSA 2DC1A 4CLRB 4YACA 2JHGA 2X0JA 1I0ZA 1LBEA 5EQFA 4CMGA 1ZH8A 3C24A 4N5LA 3ZHYA 4ZVVA 4NJOA 3TWOA 1GPDG 5CDTA 1U5CA 1UJMA 4Y6RA 1BWSA 2J3JA 3N58A 3PGJA 4XB1A 4YCAA 5G2OA 1YB5A 4RDHA 1GPJA 3WWZA 3IUPA 1U2DA 5H82A 1M2WA 1UXIA 3L4SO 1E3EA 1PJ3A 4ROSA 3GMSA 1NFRA 2AQKA 4UUOA 4FGSA 5THQA 3VTFA 1DFGA 3BAZA 2J3KA 3I4CA 1T2FA 4TVBA 4MVJM 2VOEA 4DPLA 4E0BA 4A7PA 4I5FA 3OA2A 2W4QA 4NDNE 1XQ1A 1WDMA 3OP4A 3IL2A 5DCUA 4TKLA 3RU9A 1K6XA 4NBWA 4FC6A 1ZKMA 3H9UA 5CDSA 2D5CA 4QQRA 5IN5A 2I65A 4M8SA 4J9UE 3VVBA 2HJRA 4AJNA 3I9MA 1N1EA 4Y8VA 1VRWA 4DL9A 4DLLA 3Q11A 4MDHA 3TZ6A 4IJUA 4WEOA 4D0RA 1V3UA 3GNTA 2VTDA 4BIIA 1O5IA 3H9EO 3OEYA 3UAGA 1BW9A 4J1TA 2RH4A 3AUSA 3ZV6A 3CUKA 3F3SA 4K6FA 3ONFA 4RF5A 1MP0A 3ZV3A 4O0LA 5A5FA 1EFLA 3W4KA 1P74A 4J1NA 4IZIA 1I3KA 4ONEA 4EUFA 5A9SA 2RHCA 2DFVA 3BYZA 3JYLA 4Q3NA 1FDWA 4A2CA 4BNKA 1HEUA 2O2YA 1P3DA 2J3HA 3TL3A 4EW6A 2DTEA 2B5WA 4OSPA 5C3MA 4G5HA 4D45A 2HMVA 1QYVA 2TMDA 2RH8A 2CZCA 2VYNA 1X7HA 1E1NA 2YW9A 2BGMA 3GAZA 4BB5A 4ALNA 4BNJA 4EYEA 4IDBA 3FNEA 1I2CA 2Q1UA 1E7MA 1RYDA 2O2SA 4I5GA 3B6ZA 2CSUA 4MO2A 3FR8A 2WYUA 2E6UX 3F9IA 4CUJA 1BXGB 3GGOA 3RCBA 1NXQA 1ZJYA 2IZZA 1B0AA 4DWVA 3KZVA 5ENDA 4BVAA 1SPXA 5GZ1A 3IP1A 4HNGA 3KSZO 3UF0A 1DAPA 5KKAA 1F06A 3IS3A 3GF4A 5TF4A 3ROQA 2X9GA 4XJTA 2DTDA 3BA1A 5IJZA 2HLPA 3HUDA 3OJFA 3PJFA 3EAGA 5JPIA 1T1RA 2VOJA 1E1MA 3GN1A 1U3TA 4YAIA 1ZW1A 1Y1PA 5K6AA 2IEDA 3CZRA 4NMHA 1E6EA 3ANNA 4Z0TA 3RJ5A 4CMCA 4OMUA 3GZNB 3F4BA 1VPDA 2IYOA 4Z0HO 3TZHA 3U4HA 2FSVA 1NR7A 1HLPA 1H6BA 2Y66A 1E6WA 3GR6A 4IJWA 4LVCA 1GQQA 3GN2A 1PS0A 4RZIA 3AOEA 5FI3A 4QXMA 4BNHA 4E2XA 1ZK2A 1E3IA 2JD1A 1ZIDA 5A9RA 5HA5A 1LSOA 2Q2WA 4GGOA 1C1DB 5COQA 3WGOA 3AM3A 4MVJH 2EW2A 4BV8A 3KM0A 1V35A 3DZKA 2Y93A 1CQJA 4CR6A 4ZQGA 1PQUA 2C20A 2FN7A 4IJKA 3VZPA 3WWYA 3QP9A 1VJ1A 1YE3A 2GN9A 3KLPX 4JBGA 5EERA 3FR7A 4EDFA 4YRAA 4PLTA 2G0TA 4L4SA 4PLZA 1IPEA 3WYEA 4PCVA 1V0JA 4CLHA 1F8FA 4BGVA 5T6BA 4KWIA 4F46A 4CMHA 1PGQA 1QXSA 3O38A 3WNVA 4BL5A 2G5CA 5U4QA 5F5NA 4J7UA 5BNFA 3AY7A 4S3MA 4IIUA 4BB6A 3KTDA 1R37A 1M67A 1VL6A 4NJMA 5G0SA 7ADHA 4PG5A 3I4FA 1NAHA 4YQZA 1E3JA 4J4BA 5ENVA 1X0VA 1Y8RB 1Z7BA 3DMTC 5K0ZA 1PS8A 2HKIA 1I36A 2EIHA 4PLHA 4WLFA 5KJ6A 2GLXA 3PYLA 4GX1A 3JD1A 5AXBA 1LC0A 1VL8A 2J5KA 4GBJA 1E6UA 2I67A 1RPNA 3KYCB 2HUNA 3GK3A 3OBBA 1FF9A 5IXYA 3OIGA 2P5YA 1KYQA 2OBNA 3QIVA 2ZKLA 2X58A 3F5SA 1PGPA 3L6DA 1C0KA 1ZFNA 2EKLA 3FWZA 3D7LA 4PG6A 5IG2A 1B15A 3GDGA 1OBFO 5A02A 4JNKA 1N9GB 3WBFA 1HDOA 4NBUA 3JYNA 4NZ9A 2C2YA 4B4UA 3QWBA 4II3A 3VKUA 3RSHA 5JO0A 3FNFA 4PG8A 2AQIA 1PL7A 1U2GA 1LLDA 4DPKA 3ZU2A 2WE8A 3GMDA 3DB2A 4OAQA 4RVSA 2FR8A 1E1LA 4PVCA 3K92A 4W7IA 2E82A 5MGBA 1JWAB 4CV3A 2PGDA 4E5YA 3EVNA 3LQFA 4YPOA 3T7EA 2YV1A 1X7DA 5F1KA 5DT9A 4HFMA 2P5UA 1J4AA 3SC6A 3LT4A 3NX4A 4YRDA 3U5TA 3JTMA 4NU6A 3BMOB 4CLXA 2GYYA 2VHVA 3OM9A 3PFWO 2VWGA 4C7JA 1QV7A 1DEHA 3UXYA 1LX6A 4U0KA 9LDBA 4XQGA 1W73A 2ZQYA 4N5MA 4IZHA 4CLRA 5JSFA 4JXKA 1LLQA 2X0RA 4J43A 2QX7A 3LC1O 4KZPA 5BNIA 2G1UA 1ZMTA 3CH6A 3IIEA 1RYEA 2IYPA 3JQAB 4JX8A 3LC7O 2CY0A 2NTVA 3JQGB 4OKNA 4R16A 1DIHA 4UVEA 4E2WA 4NBTA 1KEWA 2P91A 5JO9A 4P8RA 3PEFA 3ZH2A 3WGTA 2Y05A 4WK6A 4WLOA 4JK3A 1ENYA 1V3VA 2DKNA 3ZWWA 1AUPA 1C0PA 2OZPA 1AGNA 2AQ8A 3IDSA 1GD1O 3KBOA 4YBZA 5FFFA 4B7CA 4B7UA 4OQZA 4PZEA 4CM4B 3WXBA 1QYWA 3LT1A 1AN9A 1LDEA 2BHLA 3D4PA 4B8ZA 1C1XB 4XR4A 4JCOA 3OECA 4YR9A 3PYMA 3AW9A 1PJ4A 4YJGB 3UW3A 5L4LA 5KVSA 4E6PA 4ZA2A 1IPFA 1BTOA 1K6IA 3JQ7B 4O63O 5AVOA 3MJCA 2GN6A 4GVXA 2W2KB 1NVTA 3C3XA 2C59A 2EF1A 4GKVA 4ID9A 4ND1A 3W6ZA 3WGZA 3S2EA 1NVGA 2IXAA 2OBYA 4TKMA 4BGEA 3HWRA 3ZNPA 4OM8A 5FWNA 1DFHA 5JS6A 2CVQA 3GG2A 2YZ7A 2AQHA 3SEFA 4CM9D 5HTOA 2WJPA 1EK6A 1XG5A 1BXGA 3PJEA 4U0JA 1R66A 5KTKA 3PFFA 3FTNA 4XZ3A 2EEZA 2CF6A 4KUHA 4CMEA 3QVTA 3TN7A 2CD9A 4QFCA 3QVXA 4ALLA 2NUAA 1AHIA 3NGLA 3ZWYA 3ENKA 3I9JA 3DXFA 2NVWA 2CVZA 1P31A 1G0OA 3Q9UA 4AJHA 1NWCA 1P1HA 2ZTVA 1IY8A 3SXPA 2QG4A 4FD3A 2EKPA 4Z9XA 1DC3A 3PDUA 3T4XA 4D42A 3TRIA 2AMFA 3GVPA 1LRLA 3GZNA 3UN1A 2VHYA 1EFKA 4U6QA 2AEJA 1WW8A 3M2PA 4L8VA 4WASA 1DRVA 4EJ6A 3GOHA 5IDYA 5JC8A 2FZWA 1UZNA 1W6UA 2J3IA 3PQFA 5DOZA 7MDHA 3ZZNA 2JAHA 2WWRA 1EVYA 1LQTA 1WDKA 4HY3A 3A1NA 1E5LA 2YHUA 1KEVA 3OJEA 1C1DA 1SEPA 4YTEA 1PJQA 4FFPA 5CPFA 5DZSA 1MXFA 2OXIA 1F8GA 4HP8A 4BNVA 3EY4A 1F12A 4NFSA 4P38A 3DAFA 1LDMA 1JN0A 3ON5A 1YWGO 1CDOA 3GZ4A 4DQVA 5I7FA 3K31A 1XQ6A 5B4UA 1LNQA 5DBIA 1A27A 1QV6A 4MVJG 5L7WA 4R01A 4K9DA 2ZK7A 2UV8A 3DDNA 4YT5A 4G2NA 2ZYGA 3GPDG 3IP3A 1RM4A 5TJHA 2VHXA 4HXYA 4UUPA 4XYMA 2G76A 1A9ZA 3WBBA 4R1UA 4WE3A 4TWRA 1O94A 2Q2QA 4RVHA 2FY8A 5JYDA 1OOEA 4H7PA 2A4KA
chains in the Genus database with same CATH superfamily
4ZO4A 4CM6A 1UZMA 3ONDA 5AVXA 2X6RA 3L0OA 3F98A 2HCFA 2ZE7A 4POAA 4RC9A 1ZXLA 2OECA 2X41A 3K4PA 1MG0A 2FXIA 2XE8A 4DBVO 2VATA 2E1PA 2DWPA 2EP8A 3ED5A 5JBQA 1QQ5A 1HWYA 2WJGA 1JKXA 4II7A 2F43A 4XEHA 1Y9AA 3O4RA 2DLDA 1ZM4A 2QDKA 2LR0A 3PLNA 4HH4A 3TPZA 1M83A 3E9EA 4TROA 4U7PB 5KHLB 4HDNA 1A4UA 2EV9A 4RPHA 2FPPB 3EC7A 3IDQA 2F62A 1V11B 1MJNA 2OBBA 3ZV7A 1THZA 5C5CA 3PC7A 2ECQA 1AKQA 4JB3A 2C82A 5IEJA 1OXTA 3H8VA 3MIIA 3OJOA 4TM7A 4GI7A 1S2DA 3P0EA 3K30A 3EXHA 1H5QA 4TS9A 3SIPA 2QUKA 4A6PA 4BFLA 1K3FA 2MOKA 1NXSA 2TRSB 5U1PA 1P45A 2QZSA 1SAYA 3WGUA 1Y5IA 3R0VA 1CUUA 3W8EA 1GDHA 1GQFA 3GDHA 3ZGZA 4FGLA 2P3LA 5JD5A 4FILA 1XL1A 3TRKA 3CRVA 3VHXA 1EUCB 3FDZA 4ARUA 4ZHQA 5C51B 2ZVDA 1TTTA 1PQWA 4HGPA 5LJLA 2GRUA 1JEEA 2WWGA 3EW9A 4MJ3A 5DNVA 3RC3A 3D7SA 1GUBA 3FLAA 2NTNA 1J1UA 1XLTA 3ESXA 4RKFA 3JQ8B 3ECAA 3LT0A 3W4IA 5IVDA 5C8YF 1Y7TA 3PDJA 4XYEA 3ZEIA 3ZHSA 1ZD8A 1L5YA 4H3VA 3DMYA 1CY0A 2WSSA 1LPOA 2HRQA 3H83A 4LDZA 4TX1A 5AJXA 3CCBA 2KM1A 3TXAA 1NQTA 3UFXB 1BE8A 1KJYA 1OFVA 3AI2A 4CT4B 1UBKS 2XWQA 1LSSA 4B33A 4ENVA 2LRHA 1PZHA 2X5OA 3AJAA 4GC5A 3G79A 3O0DA 3T7TA 3KLMX 5JDCC 1X7XB 4H6XA 1DZIA 3H6GA 1IBKB 1E20A 2GAFA 5I5EA 2ZKIA 2A9FA 5EZYF 1V37A 4K8RB 4QD3A 4C88A 1LBHA 4YC7A 2DBZA 2O2GA 3L9WA 5K3BA 1S3SA 3DLTA 3FSGA 5EXEA 3ESDA 3HN7A 3NATA 3JQ6A 3NJ8A 4ZAFA 4RO0A 1VHDA 2CHQA 2BONA 2C04A 4QPCA 4FCCA 5NLLA 5IKMA 3IQEA 5EWJB 5EZ5A 5BV2P 2ZJFA 4DBLE 2BUCA 2FW0A 2C5GA 1EIZA 3N6RA 4ERXA 4B8ZA 1Q7BA 4C29A 1OF1A 4CF7A 3GXOA 4B7ZA 3AMVA 3JQAA 3L18A 2E4AA 1L7AA 1GU7A 1Q0ZA 2HEIA 3EGOA 4J91A 4IIDA 3CC8A 1IM5A 4FK8A 2IL1A 3JQGA 1IEWA 1XL0A 1KS9A 2F4NA 2HNBA 3M3HA 2FETA 2R1TA 2H5IA 3HRHA 4I55F 5JDIA 2NXEA 3TFQA 5JZMA 1KDVA 1TIPA 5LFAA 4L0MA 5KTNA 4JKOA 5T41A 4UUBA 2XQVA 5I7OA 1T36B 3LVFO 4UULA 4XGKA 2WLSA 1P6QA 2IXEA 3DE6X 2GRJA 4ZT5A 3U9SA 4HJRA 1OI7A 4AIRA 3JVEA 1FOEB 2VDKB 4TYYA 3QBVA 4B4OA 4JP2A 1F6WA 1A7AA 1MPTA 4HEJA 4E7OA 5D2CA 3EXFB 4O4HA 3GPBA 5HCUA 3T9BA 3AM1A 1Z82A 3QNWA 1R15A 4CTKA 16PKA 1EWYA 4X7RA 4AMGA 3DE2X 5JSZA 4KBGA 3H4IA 3I0ZA 1HRDA 2F1JA 1KU6A 3KTAA 3R3ZA 5CTAA 3HYLA 2I34A 4QOEA 3RWMB 5CDYA 2W8BB 3NG1A 3PSHA 4ZHQF 2J4DA 4ARCA 1RRFA 1S2LA 2AFHA 4NPAA 3IMCA 3GAMA 3FGZA 3BSSA 5KB3A 2J6CA 2VJNA 5LZ5A 3UJAA 2NV6A 3RVOA 4BVHA 4MR7B 2AZMA 2PX3A 3FHLA 3JD0A 3RVQA 2QRHA 1GNQA 1SMKA 3R5TA 1C4KA 2VH5R 1IK4A 4PHHA 2Z9CA 1D09A 4HVCA 1RWOA 1V3TA 4M99A 2FRDA 3RODA 2QW8A 4KXVA 4QUHA 4WSOA 4BO3A 3QTBA 1Z4MA 2PJZA 3ECSA 1OVGA 1TF5A 5JMPA 3TFOA 2CV1A 4D9MA 3DXYA 2D0DA 5A2QA 4KN9S 4JQSA 3SNHA 3GLGE 3GLVA 1LX7A 1L6IA 1R4MB 1VSUA 4LQDA 3LLUA 4EH1A 5A71A 3K71B 4CV0A 1IB6A 5BN5A 2N1MA 2Q27A 3WVNA 1C2YA 3GARA 3N8GA 2FMUA 2HU2A 1OB5A 2G4VA 1GYPA 2UZ1A 1XQWA 3N3AC 3SNKA 3QFFA 3T9EA 1RC1A 3KEGA 3PNKA 4C89A 1KQ3A 1RAEA 2WKQA 5FBQB 3ML1A 4CI9A 2PKQP 4WXPA 4KAFA 4LDNA 4WK2B 1GAEO 4N8SA 4JLDA 3FYDA 4ZEVA 4R1QA 4R83A 621PA 4DSTA 4GXTA 4HYEA 3KL2A 4UTNA 4OG2A 5EMHA 1RWPA 4E33A 1WBJB 4D96A 3FF1A 4DEYA 2QNIA 4Z4CA 3Q12A 1ONNA 2ZWVA 3GP3A 1W2HA 2DBQA 3AGPA 4ZT6A 1G9TA 1MFPA 2REQB 3M9XA 4OHUA 3O9MA 2V7EA 4LYDA 1L5HA 1C0EA 2I2FA 5E4JA 2W37A 1WMFA 3R9IA 4BFZA 4Q00A 4A0HA 1J8DA 1KR2A 3AX6A 3IP7A 1WMDA 3FWYA 2D5BA 1A0OA 3TQRA 1FUEA 3LDFA 1KRXA 1QVVA 2WHPA 3MGKA 3VR3D 1UWLA 3IO5A 4MHSA 3BL8A 4TZKA 3FVVA 1ZD2P 4O4HF 4F6LA 2HBZA 2IEYA 1SFRA 1Z6YA 3FROA 3ISVA 4ZCSA 2C98A 5DYIA 1ZEJA 2F17A 3NTRA 4E32A 4UMVA 4YJFB 2JBWA 1JDZA 4JLUA 4EB0A 2B9VA 1KP3A 4L4RA 3X2FA 3KPYA 5ADVA 1LBTA 2QJTA 2NGRA 4MUHA 2ZI7A 3BSWA 1AHPA 3HM9A 1SIBE 1WEKA 3PXBA 1MD9A 1DIRA 2XRZA 2BTQB 3H0KA 3NUGA 3Q1KA 4IXMA 4LQCA 4ND6A 4QULA 5DP2A 1P7VA 5JVDA 1YH3A 3AF1A 3OKPA 4LY9A 5ESXA 2HWKA 5I9SA 3U1VA 2IGTA 4XLLA 3WK5A 2IYRA 1KYWA 2GKOA 4AY6A 1K8QA 2GTHA 1DC7A 1YS4A 2J31A 5AK6A 2FU5C 5K3FB 3UXEA 1XZIA 5AO9A 4CFSA 1UPAA 1M33A 3BE6A 5K3AA 1CX9B 1WXXA 2ECFA 2OFOA 4BLTA 4C6SA 4A16A 1QH8A 1CK4A 3O47A 3ZIDA 1RFLA 2FF7A 1YRLA 1QWSA 1S96A 1RLUA 2HU7A 3FUTA 1YT5A 1JFVA 4CKBA 2PWPA 2RGDA 1O6FA 3S1SA 5KPJA 4LA4A 4C4TA 4PGMA 2HYDA 3CISA 4LV8B 1W36D 3GFTA 1CHDA 1EFPB 3HVUA 1P1RA 1L7EA 1EA7A 1RJWA 3LFTA 2X6TA 3GRFA 4EFKA 4I1PA 3HJTA 4B3TB 4LOLA 4E2ZA 2PWAA 2ZPTX 3INNA 4JA2A 4C5BA 2QPLA 5LVAA 1XD2A 3JQFA 4G1BA 3KJQA 4KR2A 1PJLA 3DOJA 2FTKE 4L8WB 4N6OA 1Y9ZA 2R25B 3U49A 1QRUA 1TK9A 3UOGA 4ADSG 3O83A 3FIJA 2QTRA 4RZUA 4PYOA 1BAPA 4HXEB 4H7KA 4JP8A 4BN0A 4RHUA 4F9GA 5J47A 1W9MA 3NWJA 2WD7B 1R0YA 1UC8A 2NX2A 2PBZA 1J8FA 3M2TA 3PIIA 3PE4A 5EIBD 3NVMB 5B6JA 3HUEA 4Q1FA 1GPWB 1I94B 3AV3A 3HFRA 4YI5A 5F2OA 3H5OA 1OHHD 5E6RA 1RABA 1J39A 2A86A 2OQRA 3NETA 2FZGA 2Y0DA 4L5AA 4ED9A 5HKKD 3EHEA 4FWIB 5AHKA 1UJBA 4NH4A 5CW1A 2JFXA 1KBZA 4HAZA 4EPTA 5LXTB 3G3EA 1K06A 1ZEMA 1QYRA 2ZUDA 2ZSIA 1JEYA 1I80A 3HUTA 1R0SA 2ZTSA 1NNLA 3WYAA 1R4NB 4OQYA 1PR9A 2ODNA 1QGOA 4HXGA 5I4BA 1T4DA 3D0OA 5H81A 1HE3A 1QDUA 3FYUB 3LXUX 3OQHA 3B3JA 4K5QA 4WESA 4D4KA 4EGFA 3PEYA 1N5IA 2BCGY 2ZRJA 1X77A 2IDMA 1OH7A 5LQJA 2X1HA 3IQHX 3S0JA 3WAKA 2PFGA 1GTVA 1ZNYA 2P6NA 3IPLA 3PC6A 4EG1A 1HE4A 1FNCA 1NUQA 1ZRSA 1NM5A 4MLZA 1R00A 1BX0A 1Z33A 4UU7A 4ZJPA 3QJGA 1W30A 3HBAA 4UM7A 3BREA 3F46A 5K1ZA 1JUDA 1YQWA 4BVJA 1ZGAA 5KTTA 1OBOA 4LRXA 5LZ4A 3W8NA 1K5DA 2AUMA 1Q0PA 2V1XA 3Q7TA 1DV2A 1E5VA 1ULSA 1LVGA 1PFUA 2J5QA 2Q5QA 4RCVA 3WZ2A 2XWPA 1L7DA 3JRXA 5JVDF 2Q6KA 1Z28A 2J0EA 2VF7A 3DS8A 4HAXA 2F2TA 3ZS9A 4ZAYA 5K3OA 2EERA 4DR4B 1TJ3A 1G8HA 1EVKA 2FPIA 4KCGA 2FDRA 2WWYA 3QENA 3ZI7A 4EWLA 2IZ7A 2O2IA 3F49S 4Z99A 1MOPA 3QY0A 5EIOA 3VR3A 1Z73A 3EARA 2ISQA 2YXLA 2G71A 3WGQA 3EXIB 2CUNA 2JJ8A 4ZMSA 1ABEA 2UVDA 4U2GA 3WTCA 1Q3HA 3PRKE 5LZ8A 3TTXA 4C0WA 4UVGA 2HRRA 4N65A 2MR5A 4IH4A 3E18A 3PXXA 4FBGA 4E5PA 3RDPA 3D7KA 3RC9A 4W6ZA 4OXXA 1XNJA 3D3JA 4S1NA 1L8QA 1MJGM 2YFKA 3C4VA 2VXCA 3CF4A 4BFVA 2RGGA 2MTBA 3WP0A 1FMCA 1OLSB 3BS4A 5J23A 2ET6A 4HLCA 4UZEA 3QLVC 4QRHA 3PT5A 1WP9A 5I4KA 1QZUA 5G0WA 2YHSA 5B2FA 2I33A 5FL3A 1E2PA 2I2BA 2KBFA 4EEKA 4ZEMA 3UUGA 1AQYA 4WDQA 4YCJA 1U4OA 2RJOA 4N3NA 2WVJA 2X4LA 3H8JA 4RESA 4IHQA 3Q6IA 4B0PA 1K7FB 1OKKD 3H0EA 3Q8WA 4DDVA 4KWCA 3D0KA 3R0JA 5ETJA 3IV6A 3PTZA 4DR2B 1Y8AA 2BGTA 1G20B 2GJAA 3X1JA 4D41A 2PX6A 3NT4A 1DC6A 1X1SA 2VH2A 5EP3A 1CZLA 5REQA 1C3EA 2VSYA 5ADHA 3ZDBA 4OBEA 2Y1EA 1F9AA 2BBTA 3N28A 4L0DA 3V97A 2R8EA 3ZGLA 3O3CA 4EA7A 3QVUA 3S8EA 1UK8A 1PAUA 3I09A 4QSMA 1BC5A 2FV8A 4JWTA 3T94A 5LPNA 4GZ3A 5GTDA 2HFJA 4RS3A 4P81A 2JA1A 3ND9A 4CLOA 5AJYA 2AMLA 3EFHA 4CIVA 3OWOA 4V0SA 3ND8A 4ZKDA 3ZN2A 3HZOA 1PL6A 4XXHA 4QDTA 2CJPA 3KQYA 5K3DA 3RS8A 3SBOA 1BHO1 2ILVA 4J4HA 2XLCA 5ESDA 4DREA 4ZN6A 4P3PA 4Z0PA 3BFPA 1TE2A 4P4SB 1ICIA 3KYJB 1GL7A 4JP5A 4HNUA 1QC5A 1JJVA 4QGHA 4E30A 3AQIA 3L1HA 3R76A 3NBFA 2WWIA 1BS2A 1QANA 2RB4A 1FQKA 3T1OA 2LIPA 2HL6A 2WE7A 2KI5A 1LLCA 5D5PA 4XIJA 2DWCA 5JAIA 1OHHA 1LJLA 2Y0BA 3RIXA 4LYJA 4G24A 1J5XA 2O57A 2QSUA 3VO2A 2QMOA 4MGKR 5HKKA 5K0CA 2ES4A 2P9GA 4KIFA 2FSPA 2J3LA 2BLNA 4G56A 3LT2A 2EW1A 2H3EA 2PVCA 2C1EA 2QKYA 1P75A 3PJGA 1UJ5A 3I3OA 3PP8A 3FSEA 3MUEA 2QSYA 3GP5A 3MG9A 2MJLA 3WYDA 4D5EA 4IX1A 4TMYA 2ETXA 1YV9A 4JEMA 4KTTE 1NT4A 4GX2A 3W3ZB 3CUSA 1R3DA 5T4FA 4COOA 2Q5FA 5BORA 1UR5A 4PPGA 4Y2QA 4JWKA 2HBRA 4HEA1 3IAHA 3QYFA 3RU2A 1GPYA 3D6JA 1E7YA 4IDPA 4R41A 3SM9A 5TQ2A 5MFZA 4FYVA 3VR0A 4Y2SA 2JFGA 4E5VA 1J1ZA 1YRHA 1IUKA 1X7ZB 4RY9A 1R10A 3SQMA 1ZL2A 1DAGA 5KQGA 3AEQB 1V4NA 1ZK4A 4FGWA 1C9KA 3BXPA 1JALA 3ICQB 1XV5A 3TI7A 1ZH0A 1YMQA 2NSYA 1GQYA 1LA2A 3KXKA 2BMVA 2NLOA 4IQFA 1YQXA 3JTEA 4KZKA 4WA8A 4KRYA 4DLPA 4E12A 5BPHA 4Z53A 3RYIA 3I2FA 5TQVA 5EJ8A 5LDGA 4GR4A 1QDEA 5EGSA 3CBQA 4PNHA 4QLBA 2F3QA 2BMAA 3EQ7A 3M6WA 4RSGA 1QDLB 3ZE1B 1HYGA 1MEJA 3DDSA 3R5XA 3FOFC 4V02A 2R4UA 1C3OA 4RF3A 3TTUA 4FZ3A 4JJKA 2MHCA 5K4HA 5FAXA 4LJRA 1E0SA 2ABWA 3Q2OA 3OU2A 5AKKA 3KFXA 1JIUA 4TV9B 4CL0A 5EL0A 5IUJC 2XQFA 1DCKA 1VCNA 3LW7A 1E2QA 1Z6GA 3DQQA 3B78A 4FDVA 1QP7A 3OTHA 1EQUA 2GKSA 4INAA 2XNDD 3I1IA 2R6AA 2CJWA 4CV1A 1N57A 4H15A 2RKBA 3JVDA 1ORWA 2GHRA 3K0AA 1RXSA 3O92A 5COAA 2GTIA 5E9QA 3OZIA 4G0WA 4D0LB 1RHMA 3IEKA 4WLEA 1RYYA 2QRKA 2NUPA 3RUHA 2ZE8A 1GLNA 5LMNB 3IAUA 2ZUTA 1KEUA 3TTTA 2N42A 1OKKA 2XA1A 2XECA 2IZOA 2IUYA 1DUSA 2ZJYA 5KQSA 3QEAZ 4GR5A 3BIWA 4MYCA 5AKXA 4U1RA 4EBFA 3GFVA 2H54A 5T3UA 4F6RA 2WF5A 4X8MA 5MFPA 4IIVA 4JC4A 2OQIA 3IESA 3I8OA 1X7WB 2XXBA 4B3SB 4WXEA 5AI5A 2GNAA 5FCDA 1NQVA 2IRWA 2KHZA 2Y2VA 4FYXA 4ZVOA 1U0HC 3VPAA 4AFNA 3X3HA 3PC2A 5DOVA 2PY6A 4CDGA 2COUA 1KK3A 4WZAA 2DFTA 1T1SA 1ZNXA 2Q4TA 2C2MA 4LDJA 2YL2A 4JBXA 4RWEA 4MLPA 4WK4B 4DMCA 2PRJA 3STYA 1XCGB 1WKBA 1N9KA 4JBWA 3PWTA 1D2AA 3EWSA 4H6PA 3UPDA 1PDWA 3C6QA 1G18A 1A4XA 1WAMA 2ORVA 3GJRA 2B35A 5IXSA 3RM3A 1NLYA 4I1RA 4QZVA 4QVIA 4KRGA 2JFHA 1CRQA 2CCJA 3DKPA 4MQ4A 3EN0A 5LBUA 3DE4X 3NIWA 2V9CA 5IF3A 1HG0A 5IWAB 4E09A 1T6ZA 4INPA 3QYAA 2CHUA 4ALKA 1PNRA 5TNXA 2WAOA 4KGXA 3NDRA 1CC1S 5L45A 2WINI 3M6AA 4D82A 4J76A 3LTEA 5BSFA 4PC3A 3EAFA 2XCSB 3DAHA 2QRMA 3AB8A 3OCCA 1H0SA 2REBA 1I6KA 3FPAA 2H9IA 5ECYA 4A92A 4CW7A 3OJLA 4IMIB 4UASA 1A9RA 1YONA 2HM7A 1CZHA 3EXG1 4LEIA 1NTOA 4ZVRA 1QRAA 4RIFA 5WRFA 5HQJA 2C03A 4RZ3A 3NRBA 3AVWA 3QOXA 1QHSA 2EG9A 1V96A 1MN6A 3SZUA 3PX7A 2CNOA 1W19A 3K1YA 1KOFA 1LC3A 1YKSA 2H7YA 4IFIA 5BO5A 4BMCA 3VZQA 1Q2UA 3EZ9A 4CEJA 1HOTA 3L8FA 4ZT4A 1LZKA 1Z26A 4URWR 2I9PA 5FXMA 2YFYA 3ZD8A 1RPJA 3OJXA 4BWFB 1ADJA 4JBIA 5GAJA 1S9HA 3NH6A 1YB4A 1ZGCA 2F1KA 4FWBA 5A05A 3UWSA 4CM8A 3CLUD 1W4CA 4GM0A 10MHA 1K3TA 2D62A 1P2UA 3FTCA 3HEBA 4GLJA 1ESZA 2IIVA 4RDIA 2EGUA 2DQKA 1H65A 4M2LA 4GAEA 1VE7A 4XASA 3ZDEA 3GBVA 2NZ8A 3QKSB 2ONZA 4LXXA 1U2DC 1ZM2A 4FFLA 4DDMA 4ZQHA 3U7QA 1JB9A 2CVOA 1XC7A 4BNMA 3V00A 2NSHA 3ZE0B 1Y8QA 1ISIA 1H2EA 1T5IA 2W2VA 3VC2A 2N1BA 2QRZA 1UOQA 1MR3F 4W6QA 4BGUA 3B3AA 1YJ5A 2GCEA 3RS9A 5KNCH 4K0KB 1B76A 4IXWA 5LWQA 4FD2A 5B3JA 2QPAA 2CKMA 2F48A 1ZSNA 5IX8A 3NTXA 4MULA 3PPVA 5JQWA 1NW6A 2XNDA 4P80A 1NI4B 2CZGA 3I6IA 5FNZA 1KAQA 4BFXA 4ESHA 4F9FA 1J00A 4RSHA 1RKVA 5CX1A 3ZCPA 2FMHA 2JCXA 3KPWA 4REQA 3VI4B 4BNGA 3MWEB 2FLKA 2X5JO 3CA8A 2JHFA 4B35A 1I8TA 4FSXA 3QKRA 5ITZB 5IZ4A 1V5WA 3Q6NA 1NOJA 3CHYA 5ALIA 1SC9A 4PV7A 2MINB 5F9MA 4ZHSA 2UZ4A 2WM8A 3DAGA 1N1DA 1ZOOA 3EHDA 4I1OA 5BRJA 2FB9A 2R6ZA 1HEYA 4J1TC 2H00A 2XMZA 2GNOA 4DBZA 2XB8A 4IJ5A 1WWKA 1UM8A 1QB7A 4R2XA 1T0UA 2WG0A 1Z6AA 1DSSG 3KLNA 4G41A 4JJ6A 1UDBA 4EENA 1S7GA 1HNNA 2XB2A 2HQOA 4RFLA 3PE6A 3JQPA 2ZATA 1DJOA 1DP4A 2DH6A 3KWJA 2BFMA 3DZCA 1AUVA 1PR4A 2PV0A 2YFQA 1RMQA 3GFPA 2I8AA 5LYJB 2J0UA 4DN6A 5KHOC 4Q0MA 4UNQA 4NCNA 4DIBA 4DQXA 1BN7A 2XTJA 3AZPA 3DMTA 2V7UA 4INJA 3FXAA 4JR0A 4NYJR 1HK7A 1ZHOA 3TLYA 1MC4A 1VGQA 2ATIA 1FVHA 2I4MA 5FTKA 3I1JA 3KOUA 4NU5A 4ARVA 2VAPA 3DYBA 4MCIA 1ZAYA 2O5EA 4X62B 4BMYA 1PGOA 1NBME 2OY0A 2Y1KA 3VZSA 2ZE6A 5K99A 2ZDGA 2G67A 4PR0A 3C45A 1KDPA 4XUGB 1DL5A 3MCWA 4MWGA 3OTQA 5THKA 4ZMRA 2ZJ1A 5EZQA 3JATA 5I7VA 4LTNA 3W5IA 4K9QA 2DHRA 5E4YA 1NFQA 1OIVA 4KMSA 4WNYA 3U7HB 4KRXA 4G09A 3OZCA 1X1DA 3QKWA 3CGWA 4ZQIA 1Q1NA 1XKQA 2EFJA 5IBRA 5KO2A 2SBTA 3ZE2B 2OILA 4J7AA 1SOWA 1V9SA 4MS4B 3R7FA 1H3NA 5ED0A 4KBYA 3ZUGA 1BCRA 4I9FA 3VJRA 1SJ9A 4JSYA 5DHQA 1GPAA 1VFPA 3CF0A 4BEVA 1H0KA 1EUQA 1MQ8B 3KV1A 4TMKA 1JECA 3IHWA 2ZUFA 3D3WB 2XRMA 1INLA 4GI5A 3VV2A 2X42A 1L8AA 4D9FA 1RRMA 2A3RA 5FFMA 3QVOA 3A6PC 2JEOA 4U3JA 3K20A 1YU6A 2PQ0A 5U9CA 1W94A 1CS0A 1RRGA 2R96A 4ZVKA 4HDKB 3LY5A 5DNEA 2HSWA 5AM5A 5KOHB 4WD3A 1U6KA 3ZHXA 4RDCA 3NDIA 1RI4A 4RENA 4DA7A 2JAPA 2W48A 1GPNA 3L6BA 1P44A 2HK7A 3IQXA 4M7PA 1UP6A 4N5NA 3TIVA 1Z47A 4JFRA 2QUJA 4M8IA 1VLQA 1CF2O 2NZJA 2PZKA 1Q17A 2UYQA 1QK3A 3G0GA 4HNAB 5H7XA 2CXXA 1RMTA 1W8IA 3SZOA 3ZV5A 1TZBA 1R9MA 3TE6A 1XRMA 4QARA 4YP5A 1A9TA 1VLHA 4MPPA 2OZLB 4B46A 4G1VA 5LOVB 4D79A 4X93A 1ZRMA 2I4NA 4D3SA 1XQVA 1ZP6A 4ZQBA 5JJKA 2VR1A 2Q1WA 4CCYA 2O3QA 3ZHTA 3BH6A 4AZ3A 4OL0A 1YZNA 2OORA 3ESRA 3ZBQA 2X0FA 3GGCA 1M2OA 3EZ2A 3N5KA 4LW8A 2EJVA 2Q45A 2R8YA 2CZQA 1VYVA 1CQIA 3PT9A 4LJYA 4YREA 1CUEA 3RYHA 1CUYA 4MQEB 1QZTA 1JXQA 3LPCA 1J24A 3PFIA 1KDOA 1P1JA 4O5AA 5FI1B 4OHBA 4XB2A 4Y7DA 4MW6A 4BATA 4U7WA 5B1SA 2PL5A 1YDMA 2EP7A 3W90A 1ODKA 4YJGA 3FZQA 3S44A 1WR8A 1F8YA 2PKCA 3UBTA 3H6KA 3V7NA 4QDOA 1BJRE 4RGBA 3VR6D 2VF8A 2ZGVA 1V2GA 3BTUA 3WLSA 5K0JA 3P2YA 3IHTA 2GO1A 1KR5A 4FMCF 4TYMA 4EB8A 1FSGA 3H9BA 1NJ1A 2DY0A 3GFQA 3UQZA 4CETA 2AHRA 4DSZA 1P1IA 2QPTA 4NJEB 2O54A 5KSOA 4RTJA 1H05A 1P2DA 1FS6A 1SRQA 2YJ4A 4HLUA 1JDBB 4KW7A 4KQWA 1NHGA 4H4EA 4ALMA 1KDZA 3BXEA 2FZEA 1YI8A 2QJRA 3TZBA 2ASVA 1HLFA 1SUAA 3GXBA 4DJTA 4EG8A 3JAMA 2P4UA 1G55A 1FLDA 4IRXA 4LDAA 3HI4A 1DAKA 3PEUA 3SFZA 1NXWA 2DRIA 5AUPB 3STVA 2P9JA 3Q2IA 3HXMA 4AYXA 2Y68A 3H2ZA 4LI0A 3FFTA 3LF2A 1CUDA 1QE5A 1XRRA 5AQEA 1VJ5A 5SZHB 1BGWA 1NMZA 2B7LA 3T41A 1CVRA 1UDAA 1XNGA 2R68A 1HQYE 4Q7QA 2GXAA 3B36A 1RM0A 2X7HA 3NBYC 4JCCA 2CW5A 4OA8A 1W75A 1X7YA 5JWOA 3LUKA 3M4NA 4WOPA 1FFWA 4PC6A 2Z3VA 2EFHB 4OTZA 4B74A 2PUVA 1OD6A 2FR1A 2FR8C 5EJFA 4ETIA 3TFWA 4LG1A 3G0DA 4Q3EA 3LGAA 3PRJA 1KEEA 5F2NA 1KYIA 1IXKA 3L1JA 5C5IA 5TVGA 1L5WA 1QCYA 2BMEA 3M4ZA 3D6UA 4CR8A 2NSLA 4YLYA 1W0KD 2VQSA 3ACBA 5COBA 2XNJA 2ZUEA 4F85A 4LMAA 5AUNB 4QGFA 6LDHA 2RGUA 1JFFA 2HCBA 2WSLA 3LVQE 3ER8A 4JJIA 4PAMA 5JHHB 3P1JA 4GPD1 3FZNA 4LXQA 3KETA 3AL0C 2F8LA 2QTHA 3P9CA 2JVIA 2IKQA 1TMOA 1QS0A 2NZ2A 3HB1A 3N2KA 2XADA 2AZ4A 3OCVA 4DR5B 4GLFA 4LOAA 1DG1G 7AT1A 1FPMA 2BKAA 5I51A 1K27A 1BYIA 3ND7A 4ZVTA 1SCQA 4CTNA 3GUVA 3L7DA 3TSOA 3G2JA 4TTJA 3WQHA 2EFCB 3UWDA 2EKQA 3VOAA 1NE7A 5DGDA 4GGPA 1MMFB 4O25A 5ELLA 3ZHRA 3LX8A 1BGXT 1C2TA 4D56A 3G9UA 3AWDA 3FNHA 1G3RA 2A84A 2VH1A 3WIDA 1Q0TA 5JZVA 2E0IA 3HG7A 1V6SA 3FGOA 3BGDA 5LMUB 5DMHA 1ESNA 5JTUA 2YWBA 5FB3A 2OAP1 2Z95A 5ITSA 2W83A 1NBEA 2C4TA 1DAMA 3CS3A 4NBRA 1DT3A 2WKWA 5D51S 5C1IA 1ZUIA 3GVXA 1DLJA 4NVRA 1RADA 1G2IA 2CMHA 4NFYA 2I76A 4F86A 4HZUA 8MHTA 5LL6P 3LC2O 2RK6A 3EVGA 2G9RA 5LKRA 3EPLA 2PRIA 2VBFA 2XBLA 2Y27A 5DSXA 4N5DA 2A0UA 4ZEOA 2ATEA 3RUPA 1E0KA 4JLKA 1ISRA 2B2XA 1USIA 5AR1A 3GLKA 4ERNA 1OA0A 2EARA 3AM4A 3TQFA 1VHQA 4A8JA 3DYVA 1ZJJA 3EZXA 3O6VA 3DBHB 4A2WA 2BM0A 1VRCA 2H6EA 4JLVA 1Y1TA 4CNQA 4DCGA 1XA0A 1A95A 1VQ1A 2I6TA 1EWVA 2VKTA 3B2QA 4HNVA 2QTAA 1U0FA 3SK0A 2EXXA 4GEGA 5CJJA 1JA9A 2HCTA 4DIUA 3IDAA 1NSTA 3EYAA 2FP3A 5EIFA 3BBLA 3L46A 3T5GA 4AKGA 4LE2A 2D1TA 2X9VA 4YMWA 1TJPB 2YQZA 3VR6A 4NU8X 5KOJB 3DWFA 2XE7A 3V8NA 4L07A 4OJKA 4QU8A 3AIMA 5F51A 4IQ8A 1IHYA 5LWHA 3MCAA 1KMCA 5ENZA 2JCBA 4F93B 1RJ9B 3QFRA 4G1FA 2ZYDA 2SHKA 3R09A 4J7CA 4F2PA 3NVKI 3KR2A 1YZ3A 2QXUA 3F78A 1FSPA 2OHOA 1AGYA 1LRKA 1DGQA 2EKBA 5BSEA 3JYQA 3Q5EA 1YTUA 1KFEB 1S4MA 3I53A 1MX3A 2AS0A 1T8SA 3QUBA 5ALHA 5PNTA 4MICA 4GICA 1QHHB 3NM6B 2IBMA 2XSZD 3RJ9A 2FG7C 3OZEA 2ZR0A 3A05A 5GJWC 3CE9A 1BHQ1 2QB5A 3PPIA 1XDUA 1M6HA 4GOXA 3HZZA 3MFQA 1NSYA 4QGBA 2BEJA 3QPWA 5CLGA 5CVCA 5HK8A 4H7HA 4E3WA 2I7TA 6REQB 4C7OA 2AUNA 721PA 1G8SA 2OP1A 3LXXA 3OVMA 4MYHA 1XZJA 4EGCB 1XA3A 1YUBA 2F8MA 1AX9A 3K2IA 4BQOA 4JI3B 3V2GA 4BN5A 4PYMA 4MYTA 4UUQA 2NACA 4AZSA 4EHDA 4EYGA 4Y0VA 2VWQA 3RBZA 1ODCA 1Z38A 2Z5GA 1DRUA 3GY0A 5ULLA 3LMKA 3VNBA 3WADA 5FTLA 2GWHA 1HLGA 1EJ0A 4PO9A 2XT9A 4NYIR 2O7RA 1URPA 4IDGA 2BFPA 4M54A 3O73A 3Q8XB 4JT8A 2C9MA 5JWHA 1W0KA 4XGQA 3WAJA 2OCLA 3L07A 3R8XA 1JKJA 3QBTA 3G0IA 4I6JA 4K1XA 4E1BA 3KUKA 2H4HA 4RABA 3DVQX 4HH3C 2HYIC 4IUBS 3R9XA 1LI7A 4YUZA 4U2CA 2QDXA 2QU8A 1Q6YA 3M7IA 1AF7A 4ZGBA 4KR3A 3ETDA 3EUWA 1EU1A 2XDQB 3HDJA 4XUEA 5GOZA 3RUDA 3UJHA 4KPEC 3P9RA 4W5OA 3ADDA 2FWIA 2D0IA 2GCOB 2L82A 3RVDA 2R1VA 4GE3A 4ASUD 1HE1C 2BELA 1WCIB 4XYBA 3R4VA 3GLSA 5G4KA 4B4DA 2O8CB 2H4JA 1DC8A 4BLUA 5F52A 2AEMA 5JDCA 3BT7A 3OPYA 4A10A 1DV1A 2JLAA 2QTGA 3GA5A 2K7FA 1K75A 3BHMA 2SKEA 3TLJA 2VNHA 3I9FA 1KMIY 1FYDA 2CXPA 4DDHA 2Y6UA 4BNIA 3OIFA 5B37A 2AKEA 3VMFA 1WVIA 3FAZA 1EDZA 4R5MA 4X1YA 3WYBA 4EAQA 1BVHA 1OXXK 3BERA 2BR3A 2LIVA 3KKPA 1Y80A 4F6CA 1Z13A 3H5WA 5H16A 1O94C 3AUAA 3NYIA 3A6JA 4KDRA 3GJ3A 2XUOA 3B82A 1TKRA 4JH0A 3S2IA 4HS4A 3H75A 1Z15A 4RY2A 5F33A 1JR2A 4G9GA 5F7ZA 2XQIA 1MTZA 5FTWA 2YZGA 3NC0C 3DTTA 1B43A 2ROQA 5EWLB 5EXDA 1IUPA 1SK8A 1JH9A 1MAHA 3AHDA 1W85A 2YWCA 1UJCA 2QAIA 5JR3A 1YE5A 3OSZA 4MPDA 4WV3A 3UAYA 4EF5A 2WB2A 2VQEB 4YDRA 4L9RA 1WB6A 3ELUA 4HN4B 4ISCA 2C07A 1UPFA 3O4JA 4PX9A 4EY3A 5K0TA 2EYUA 3DMPA 4BX0A 3P2IA 3KSUA 2HBQA 4RA9A 5AVVA 2A1TR 1XZDA 1L7OA 1GNRA 1QYDA 4DVGA 3M49A 2AYYA 2O2ZA 3ETJA 1OV6A 2ZDHA 4HGNA 1UKZA 2GJ4A 4BDTA 4ZXFA 1RAGA 4WBXC 1YI0A 1Z3IX 2CYCA 4R2IA 3RGWS 1V41E 5CH5A 1FFXA 1VPVA 3IJPA 3RC2A 1ADGA 1Q19A 1GVNB 3CYFA 1TMKA 1AT1A 2ZIXB 3OX4A 5ER9A 1OPRA 5T57A 4WOKA 1HMYA 1QWOA 3D2LA 1XCBA 2HSJA 1CJSA 4M0PA 3EZGA 2E37A 2EIXA 4I55B 1D0IA 3V4VB 3BGSA 5CT4A 3SYKA 1B4DA 2FQYA 4PNEA 4K3UA 1W34A 2RAVA 3ELBA 3PYXA 5CCBA 4IVQA 2IHTA 2XSZA 3ROTA 3KT0A 4UTPA 1I7DA 1ULBA 4UDYX 1S8NA 1XK6A 2A9RA 2HY7A 4KIWA 5FTJA 2P6RA 1X86B 1GYRA 1Y8ZA 4RVGA 2DPGA 2NZXA 4ESOA 2HN9A 5GGYA 2QW0X 3L0ZA 2W6ID 3N7UA 3X1WA 1OAAA 2FUCA 2C4NA 1OLUB 4R51A 4RPKA 4J7XA 4RVOA 4C1BA 3BFJA 4EK9A 3HB4X 3R5FA 4P5PA 3V1NA 5SICE 2H1SA 2GGSA 4K40A 1L2TA 3EDQA 2R8OA 4HQKA 5E6UB 2J09A 1GITA 1T3LA 2YOHA 2QG6A 1U6IA 4ANFA 2B34A 4OKIA 4K28A 2BFEA 3N6XA 3VQTA 4MVCA 4IICA 1BH2A 4BWYA 3HHEA 2FZ4A 2XXJA 5GV8A 3PX2A 4O5OA 3MQ2A 4C76A 4LTDA 5JY6A 1XYVA 3RFVA 1HX7A 1TUBA 3RF7A 5HPYB 2ZITA 1VYTA 1U3UA 3CRNA 5BRNA 3Q8MA 3GRZA 4MZXA 1D4OA 3QUQA 3TCNA 3MEQA 3INYA 3L7YA 1C3JA 2VJOA 1VMKA 4KQ2A 5FOXA 3ZW9A 5KNBD 4HGYA 3VDXA 2D2IA 3ETEA 4OKSA 3QPVA 3REQB 2H4FA 3UHPA 1RKQA 5GGXA 1KBQA 4XTCS 5DXJA 5BV7A 2ATXA 4J0DA 4UDXX 3QA9A 1ISGA 5EN4A 1M54A 4EGJA 4DV7B 1KO1A 1XFDA 4M0EA 4J0JA 1WHSB 2WMYA 4XDHA 1HE5A 3H4MA 4BCDA 4BC1A 4ASUA 4WKCA 2EQ5A 4M9UA 3ORQA 4PYQA 4C0AC 2PXAA 5KYKA 2MYUA 4IVPA 1IHXA 1Z9BA 1W8DA 1GZ6A 1ZMOA 1N2IA 3N7AA 2Z8XA 1D2MA 2CLDX 4DG5A 2Z5LA 4GKJB 4HAYA 4Q7JB 4WERA 1RWKA 3ANYB 3SEAA 4IF4A 2F1OA 2AK3A 4MB2A 2ZFUA 4R84A 1DX6A 3LV8A 3QV2A 4BO6A 3KB2A 1JZQA 5A03A 1T2NA 3LBNA 3EWIA 1E2GA 2XY4A 3DKKA 4OYHA 4BQPA 4BWVA 5IN4A 2Q07A 2Z4RA 3ZK8A 2QYTA 1ZI8A 1JV2B 3S40A 3WIVA 1A5AB 3CF4G 4NXNB 4BVBA 4BMDA 3U7FB 1JNXX 3ZE7A 3BK1A 2JZCA 1BA2A 3DOCA 2ZAMA 4UE6A 3UMBA 1K7EB 4FHEA 1G38A 5LKAA 2QRLA 3O8QA 1VM6A 5K7SA 2C2OA 4FR0A 4F3YA 4Y2VA 1QFSA 4RGQA 1E1QA 2P77A 2RAFA 3CV3A 2HK6A 1VCOA 1UAGA 1JDUA 2JL1A 2PXXA 1DBVO 4FFNA 1VJCA 4Q7EA 2AL7A 3Q2KA 4IEIA 3OKFA 2P2YA 3NKFA 1YACA 4HMPA 4WGFA 4ER5A 4OH7A 5ISMA 4C0HA 3EDRA 3HPQA 3NW9A 1AZWA 4YJHA 1ST2A 4FOLA 1EVZA 4RD3A 4OV6B 1KVQA 4CEHA 3HCRA 4YIHA 4M6WA 3UY4A 3DC7A 4PLCA 2CLEB 1ZI9A 3V4SA 5IANA 4IMJB 3VVLA 2MDTA 5DGXA 1M2JA 2NVUA 1Y6ZA 3BFKA 1ISJA 4YJ3A 4BE9A 3I5UA 4URYR 1YJCA 3NPMA 4PHFA 4V39A 4X95A 1XJCA 3NGXA 5IZCC 5DTIA 2XUJA 1I7SB 1VE5A 4EAAA 5B3LA 1E2LA 5JYDA 3B52X 1XNRB 1BCSA 3GEIA 3A36A 1YA4A 2J5RA 2JIMA 2QM8A 5JYCA 4DV6B 3PQ3A 1Z7YA 4ND4A 3C41J 3HKCA 4W7SA 3HK2A 4M4SA 2HSDA 2HPHA 4LISA 1A1SA 1BVRA 5KYXA 3PGVA 1MOSA 2DECA 2GVZC 3IPRA 3DDCA 2PMDA 4D9KA 3CZMA 2PUCA 4PBSA 4FI3C 2VRCD 2W6IA 4V0OA 2EQAA 4EB6A 2W2LD 4DMKA 3BWMA 2A78A 2FHPA 2UZ1B 3PUZA 4UTOA 3YASA 5F9HA 1PQPA 1ZCBA 3E4CA 5ARDA 1ZD1A 1EB8A 3DE3X 3I23A 5EPOA 1BXZA 3E2PA 3UKDA 3U44A 3EMVA 3U81A 2ZT7A 3N53A 3M9WA 1Y5NA 5FPKA 1ZUNB 4C4XA 1MIOA 4D1YA 1KAOA 3BQ9A 2WWVD 3CVXA 3QI7A 4MP8A 2ZU6A 3W2GA 3WGKA 4BHTA 2I2AA 2J07A 2ZYWX 3CWZA 4NESA 4I46A 4QX6A 2WJ6A 3UAXA 3W2EA 4DSUA 1W96A 5JD4A 1U0GA